4GNEA

Crystal structure of nsd3 tandem phd5-c5hch domains complexed with h3 peptide 1-7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
molecule keywords Histone-lysine N-methyltransferase NSD3
total genus 20
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gneA00
4LK9A 2IDAA 3LQIA 4C9ZA 2CKLB 3KV6A 5G05B 1X4IA 2MD8C 4X3GA 4AYCA 2HYED 2YSJA 5B79A 4PTBA 4NN2A 3N9OA 2KFTA 4MVTA 4AVXA 3KNVA 2MUMA 3EB5A 5D1KB 1WEWA 2FUUA 2BAYA 2G45A 3VK6A 3ASLA 3ZNIA 5D1LB 3RTRB 3RPGC 3N9LA 5B78A 2EODA 1VD4A 4UP0A 1K2FA 4PPEA 1XWHA 4W4UA 3N9QA 2ECNA 2UZGA 3MHSA 3T6RA 2PNXA 2YREA 2LDRA 5TDRA 4GNFA 1WEEA 4YABA 4YBSA 2YSMA 3C6WA 1VFYA 3LQHA 4ZDTA 3T7LA 4BBQA 2G43A 5H1TA 4WZ2A 2KIZA 1IYMA 3SOUA 1JM7A 2K17A 4N4FA 2XEUA 2ECIA 3EB6A 2QJ0A 3O33A 1U6GB 5H1UA 4AP4A 2KWJA 3M62A 5TDWA 2KR4A 4B7YC 2F6JA 5TABA 5J3XA 3V43A 5AITA 2M1RA 3SHBA 3ZPVE 4R7EA 2YQMA 3O37A 1Z2QA 3GL6A 1BORA 2D8SA 1V87A 1WFKA 4O64A 4YBMA 4R8PK 5B76A 2LN0A 2KU3A 2C2VS 3L1ZB 2K4DA 1WGMA 2MD7B 2YT5A 4I7BA 5KH9A 1N87A 3NG2A 1WEQA 4LADB 5JG6A 4IC2A 2C2LA 5EYAF 3KQIA 3MHHA 4N3WA 2YHOA 1JM7B 2ECGA 2KWKA 4FO9A 2KREA 3HTKC 2CSYA 4FK5A 2LXPC 1JOCA 2CT2A 3QZVA 3LQJA 5G04B 3N9PA 2G6QA 4UP5A 1Z60A 5H1VA 2OXQC 4S3OC 2PUYA 4YC9A 2VPEA 4GB0A 5TBNA 2LRIC 2RSDA 2YW8A 4TKPB 3ZVYA 2L43A 2FSAA 4ZUXU 4IC3A 1ZBDB 4LKAA 4XI1A 4FJCA 3HCSA 4A0CD 5LKZA 1HYJA 2YUCA 2M6MA 2MNZA 3FL2A 5B75A 4B86C 2VPBA 4A4CA 5DINA 1WEOA 3DPLR 2EA6A 1WEMA 1X4JA 3ZVZB 5D1MB 2MIQA 2M3HA 2F42A 4WZ3B 2YYRA 5LCWB 4S3OB 2VPGA 4A49A 4QF3A 1FP0A 2JMJA 4MSXA 4QF2A 4GNGA 3RPGB 3HCUA 2ZETC 2L5UA 2VJFB 2Y1MA 3U5NA 4YBTA 2LGVA 1FBVA 4GNDA 4P5OB 5FB1A 2LGLA 1WENA 5DKAA 4YATA 5I3LA 5B77A 1E4UA 3O7AA 3C5KA 1MM2A 2CKLA 2VPDA 4F52B 4LJNA 5FEYA 5G0FA 3I2DA 4L58A 2L80A 4FIPA 1WILA 4YADA 2K1JA 3M99A 3O36A 3GV4A 2JMIA 2KGGA 5FERA 2H0DB 4I7CA 1X4UA 4UI9B 1F62A 2ECTA 1LDJB 2HDPA 3HCTA 2KWOA 5LKTA 2DX8A 2VNFA 1RMDA 5TRBA 4L7XA 2YU4A 3SOXA 4AYCB 3PUQA 1CHCA 3ZYQA 3M63A 1MM3A 4V3KC 3U5MA 3IHPA 4LLBA 2MA5A 2ECJA 3N9NA 1HYIA 3N9MA 4BHWA 2YURA 5FB0A 3DQVR 2I50A 2VP7A 2XB1A 2VJEA 2Y43A 4GNEA 2LQ6A 2E6SA 5LKUA 2ECWA 3U5OA 4CA1A 4CCGX 2M85A 3O35A 3SOWA 2LGGA 5C13A 3PURA 3L1XA 5KH3A 5KH7A 3PHDA 2LXHC 2FUIA 2LV9A 1WEPA 5B8DA 2E6RA 2QIZA 2EGPA 1WIMA 2ECVA 3ZPV1 2H0DA 3KV5A 2JRJA 2KGIA 2RI7A 2CSZA 4AUQB 1WEUA 1Z6UA 4V3LC 4YAXA 1LDKC 1WEVA 2F6NA 1T1HA 2YHNA 3O70A 2JMDA 4WZ0A 2L75A 4R2YA 4WA6A 4A4BA 5AIUA 2MT5A 4I7DA 2KWNA 1WESA 3U5PA 5H9MA 3LRQA 1G25A 2AN6A 2L0BA 3L11A 2NAAA 2KYUA 2Y1NA 5C11A 2QICA 1WE9A 2YQLA 5LKXA 2VJFA 2K16A 2MNYA 4ZQLA 1DVPA 2KE1A 3O34A 4Q6FA 3ZTGA 1VYXA 2LGKA 2VJEB 2MA6A
chains in the Genus database with same CATH superfamily
1DCQA 5K3QA 4LK9A 2IDAA 3LQIA 4C9ZA 2CKLB 3KV6A 5G05B 1X4IA 2MD8C 4X3GA 4AYCA 5SVIB 2HYED 2YSJA 4PTBA 4NN2A 5B79A 3N9OA 2KFTA 4MVTA 4AVXA 3KNVA 2MUMA 3EB5A 5D1KB 1WEWA 2FUUA 2BAYA 2G45A 3VK6A 3ASLA 3ZNIA 5D1LB 3RTRB 3RPGC 3N9LA 5B78A 2EODA 1VD4A 4UP0A 1K2FA 2OWAA 1XWHA 4PPEA 2CRRA 4W4UA 3N9QA 3FEHA 2ECNA 2UZGA 3MHSA 3T6RA 3M7KA 3H7HA 2PNXA 2YREA 2LDRA 5TDRA 4GNFA 1WEEA 4YABA 4YBSA 2YSMA 3C6WA 1VFYA 3LQHA 4ZDTA 4QQ4A 3T7LA 4BBQA 2G43A 2M13A 5H1TA 4WZ2A 2KIZA 2IQJA 1IYMA 3SOUA 1JM7A 2K17A 3FAOA 3LVQE 4N4FA 2XEUA 3KDEC 2ECIA 3EB6A 2QJ0A 3O33A 1U6GB 5H1UA 4AP4A 2KWJA 3M62A 5TDWA 3DDTA 2KR4A 4B7YC 2FFWA 2F6JA 5TABA 5J3XA 3V43A 2DSMA 5AITA 2M1RA 3SHBA 3ZPVE 1MBMA 4R7EA 2YQMA 3O37A 2YVRA 1Z2QA 3GL6A 1BORA 2D8SA 1V87A 1WFKA 2FD4A 4O64A 4YBMA 4R8PK 5B76A 3MDBC 2LN0A 2KU3A 2C2VS 3L1ZB 3LJUX 2K4DA 1WGMA 2MD7B 2YT5A 3SUBA 4I7BA 5KH9A 1N87A 3NG2A 1WEQA 4LADB 5JG6A 2D8UA 4IC2A 3PLWA 2C2LA 5EYAF 3KQIA 3MHHA 4N3WA 2YHOA 2CSVA 2ECGA 1JM7B 2KWKA 4FO9A 2KKYA 2KREA 3HTKC 2CSYA 4FK5A 2LXPC 1JOCA 2RR4A 2DJAA 2CT2A 3FM8C 3QZVA 3LQJA 5G04B 3N9PA 2G6QA 4UP5A 1Z60A 5H1VA 2OXQC 4S3OC 2PUYA 4H9DA 4YC9A 2XOCA 2VPEA 4GB0A 5TBNA 2LRIC 2RSDA 2YW8A 4TKPB 3ZVYA 2CRWA 2L43A 2FSAA 4ZUXU 2JM3A 4IC3A 1ZBDB 4LKAA 3FJUB 4XI1A 4FJCA 3HCSA 4A0CD 5LKZA 1HYJA 2YUCA 2M6MA 2CONA 2MNZA 3FL2A 5B75A 4B86C 2VPBA 4A4CA 5DINA 1WEOA 3DPLR 2EA6A 1WEMA 1X4JA 4OGEA 3ZVZB 5D1MB 2MIQA 2M3HA 2F42A 4WZ3B 4Z0RA 2XOYA 2YYRA 5LCWB 4S3OB 2VPGA 4A49A 4QF3A 4O62A 1FP0A 2JMJA 4MSXA 4QF2A 4GNGA 3RPGB 5SVYA 3HCUA 2ZETC 2L5UA 2VJFB 2Y1MA 3U5NA 4YBTA 2LGVA 1FBVA 4GNDA 4P5OB 5FB1A 2LGLA 1WENA 5DKAA 4YATA 2L7PA 5I3LA 5B77A 1E4UA 3O7AA 3C5KA 1MM2A 2CKLA 2VPDA 4F52B 4LJNA 2EGMA 5FEYA 2B0OE 3I2DA 4L58A 5G0FA 2L80A 4FIPA 1WILA 4YADA 2K1JA 3M99A 3O36A 3GV4A 2JMIA 2KGGA 5FERA 2E61A 2H0DB 4I7CA 1X4UA 4Z0OA 4UI9B 1F62A 3LDYA 2ECTA 1LDJB 2HDPA 3HCTA 2KWOA 5LKTA 2DX8A 2VNFA 1RMDA 5TRBA 4L7XA 2YU4A 3SOXA 5SVIA 4AYCB 3PUQA 1CHCA 4OGCA 3ZYQA 4F1PA 3M63A 1MM3A 4V3KC 3U5MA 3IHPA 4LLBA 2EXUA 2MA5A 2ECJA 3N9NA 1HYIA 3N9MA 3T9KA 3Q1DA 4BHWA 2YURA 5FB0A 3DQVR 2I50A 2VP7A 2XB1A 2VJEA 2Y43A 4GNEA 2LQ6A 2E6SA 5LKUA 2ECWA 3U5OA 4CA1A 4CCGX 2M85A 2XOZA 3O35A 3SOWA 2LGGA 5C13A 3FANA 3PURA 3L1XA 5KH3A 5KH7A 3PHDA 2LXHC 2FUIA 2LV9A 5SVXA 1WEPA 5B8DA 2E6RA 2QIZA 2EGPA 1WIMA 2ECVA 3ZPV1 2P57A 2H0DA 3KV5A 2JRJA 2KGIA 3E2DA 2RI7A 2CSZA 4AUQB 1WEUA 1Z6UA 4V3LC 2JUNA 4YAXA 3O47A 1LDKC 3JUEA 2KKXA 1WEVA 2F6NA 1T1HA 2YHNA 3O70A 2JMDA 4WZ0A 2L75A 2LAUA 4R2YA 4WA6A 4A4BA 5AIUA 2MT5A 4I7DA 2KWNA 1WESA 2XP0A 3U5PA 5H9MA 3LRQA 1G25A 2AN6A 2L0BA 3L11A 2NAAA 2KYUA 2Y1NA 5C11A 2QICA 1WE9A 2YQLA 3DWDA 5LKXA 2VJFA 2K16A 2MNYA 3LVRE 4ZQLA 1DVPA 2KE1A 3O34A 4Q6FA 3ZTGA 2MKEA 1VYXA 2LGKA 2VJEB 2MA6A
chains in the Genus database with same CATH topology
4LK9A 2IDAA 3LQIA 4C9ZA 2CKLB 3KV6A 5G05B 1X4IA 2MD8C 4X3GA 4AYCA 2HYED 2YSJA 5B79A 4PTBA 4NN2A 3N9OA 2KFTA 4MVTA 4AVXA 3KNVA 2MUMA 3EB5A 5D1KB 1WEWA 2FUUA 2BAYA 2G45A 3VK6A 3ASLA 3ZNIA 5D1LB 3RTRB 3RPGC 3N9LA 5B78A 2EODA 1VD4A 4UP0A 1K2FA 4PPEA 1XWHA 4W4UA 3N9QA 2ECNA 2UZGA 3MHSA 3T6RA 2PNXA 2YREA 2LDRA 5TDRA 4GNFA 1WEEA 4YABA 4YBSA 2YSMA 3C6WA 1VFYA 3LQHA 4ZDTA 3T7LA 4BBQA 2G43A 5H1TA 4WZ2A 2KIZA 1IYMA 3SOUA 1JM7A 2K17A 4N4FA 2XEUA 2ECIA 3EB6A 2QJ0A 3O33A 1U6GB 5H1UA 4AP4A 2KWJA 3M62A 5TDWA 2KR4A 4B7YC 2F6JA 5TABA 5J3XA 3V43A 5AITA 2M1RA 3SHBA 3ZPVE 4R7EA 2YQMA 3O37A 1Z2QA 3GL6A 1BORA 2D8SA 1V87A 1WFKA 4O64A 4YBMA 4R8PK 5B76A 2LN0A 2KU3A 2C2VS 3L1ZB 2K4DA 1WGMA 2MD7B 2YT5A 4I7BA 5KH9A 1N87A 3NG2A 1WEQA 4LADB 5JG6A 4IC2A 2C2LA 5EYAF 3KQIA 3MHHA 4N3WA 2YHOA 1JM7B 2ECGA 2KWKA 4FO9A 2KREA 3HTKC 2CSYA 4FK5A 2LXPC 1JOCA 2CT2A 3QZVA 3LQJA 5G04B 3N9PA 2G6QA 4UP5A 1Z60A 5H1VA 2OXQC 4S3OC 2PUYA 4YC9A 2VPEA 4GB0A 5TBNA 2LRIC 2RSDA 2YW8A 4TKPB 3ZVYA 2L43A 2FSAA 4ZUXU 4IC3A 1ZBDB 4LKAA 4XI1A 4FJCA 3HCSA 4A0CD 5LKZA 1HYJA 2YUCA 2M6MA 2MNZA 3FL2A 5B75A 4B86C 2VPBA 4A4CA 5DINA 1WEOA 3DPLR 2EA6A 1WEMA 1X4JA 3ZVZB 5D1MB 2MIQA 2M3HA 2F42A 4WZ3B 2YYRA 5LCWB 4S3OB 2VPGA 4A49A 4QF3A 1FP0A 2JMJA 4MSXA 4QF2A 4GNGA 3RPGB 3HCUA 2ZETC 2L5UA 2VJFB 2Y1MA 3U5NA 4YBTA 2LGVA 1FBVA 4GNDA 4P5OB 5FB1A 2LGLA 1WENA 5DKAA 4YATA 5I3LA 5B77A 1E4UA 3O7AA 3C5KA 1MM2A 2CKLA 2VPDA 4F52B 4LJNA 5FEYA 5G0FA 3I2DA 4L58A 2L80A 4FIPA 1WILA 4YADA 2K1JA 3M99A 3O36A 3GV4A 2JMIA 2KGGA 5FERA 2H0DB 4I7CA 1X4UA 4UI9B 1F62A 2ECTA 1LDJB 2HDPA 3HCTA 2KWOA 5LKTA 2DX8A 2VNFA 1RMDA 5TRBA 4L7XA 2YU4A 3SOXA 4AYCB 3PUQA 1CHCA 3ZYQA 3M63A 1MM3A 4V3KC 3U5MA 3IHPA 4LLBA 2MA5A 2ECJA 3N9NA 1HYIA 3N9MA 4BHWA 2YURA 5FB0A 3DQVR 2I50A 2VP7A 2XB1A 2VJEA 2Y43A 4GNEA 2LQ6A 2E6SA 5LKUA 2ECWA 3U5OA 4CA1A 4CCGX 2M85A 3O35A 3SOWA 2LGGA 5C13A 3PURA 3L1XA 5KH3A 5KH7A 3PHDA 2LXHC 2FUIA 2LV9A 1WEPA 5B8DA 2E6RA 2QIZA 2EGPA 1WIMA 2ECVA 3ZPV1 2H0DA 3KV5A 2JRJA 2KGIA 2RI7A 2CSZA 4AUQB 1WEUA 1Z6UA 4V3LC 4YAXA 1LDKC 1WEVA 2F6NA 1T1HA 2YHNA 3O70A 2JMDA 4WZ0A 2L75A 4R2YA 4WA6A 4A4BA 5AIUA 2MT5A 4I7DA 2KWNA 1WESA 3U5PA 5H9MA 3LRQA 1G25A 2AN6A 2L0BA 3L11A 2NAAA 2KYUA 2Y1NA 5C11A 2QICA 1WE9A 2YQLA 5LKXA 2VJFA 2K16A 2MNYA 4ZQLA 1DVPA 2KE1A 3O34A 4Q6FA 3ZTGA 1VYXA 2LGKA 2VJEB 2MA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK9 A;  2IDA A;  3LQI A;  4C9Z A;  2CKL B;  3KV6 A;  5G05 B;  1X4I A;  2MD8 C;  4X3G A;  4AYC A;  2HYE D;  2YSJ A;  5B79 A;  4PTB A;  4NN2 A;  3N9O A;  2KFT A;  4MVT A;  4AVX A;  3KNV A;  2MUM A;  3EB5 A;  5D1K B;  1WEW A;  2FUU A;  2BAY A;  2G45 A;  3VK6 A;  3ASL A;  3ZNI A;  5D1L B;  3RTR B;  3RPG C;  3N9L A;  5B78 A;  2EOD A;  1VD4 A;  4UP0 A;  1K2F A;  4PPE A;  1XWH A;  4W4U A;  3N9Q A;  2ECN A;  2UZG A;  3MHS A;  3T6R A;  2PNX A;  2YRE A;  2LDR A;  5TDR A;  4GNF A;  1WEE A;  4YAB A;  4YBS A;  2YSM A;  3C6W A;  1VFY A;  3LQH A;  4ZDT A;  3T7L A;  4BBQ A;  2G43 A;  5H1T A;  4WZ2 A;  2KIZ A;  1IYM A;  3SOU A;  1JM7 A;  2K17 A;  4N4F A;  2XEU A;  2ECI A;  3EB6 A;  2QJ0 A;  3O33 A;  1U6G B;  5H1U A;  4AP4 A;  2KWJ A;  3M62 A;  5TDW A;  2KR4 A;  4B7Y C;  2F6J A;  5TAB A;  5J3X A;  3V43 A;  5AIT A;  2M1R A;  3SHB A;  3ZPV E;  4R7E A;  2YQM A;  3O37 A;  1Z2Q A;  3GL6 A;  1BOR A;  2D8S A;  1V87 A;  1WFK A;  4O64 A;  4YBM A;  4R8P K;  5B76 A;  2LN0 A;  2KU3 A;  2C2V S;  3L1Z B;  2K4D A;  1WGM A;  2MD7 B;  2YT5 A;  4I7B A;  5KH9 A;  1N87 A;  3NG2 A;  1WEQ A;  4LAD B;  5JG6 A;  4IC2 A;  2C2L A;  5EYA F;  3KQI A;  3MHH A;  4N3W A;  2YHO A;  1JM7 B;  2ECG A;  2KWK A;  4FO9 A;  2KRE A;  3HTK C;  2CSY A;  4FK5 A;  2LXP C;  1JOC A;  2CT2 A;  3QZV A;  3LQJ A;  5G04 B;  3N9P A;  2G6Q A;  4UP5 A;  1Z60 A;  5H1V A;  2OXQ C;  4S3O C;  2PUY A;  4YC9 A;  2VPE A;  4GB0 A;  5TBN A;  2LRI C;  2RSD A;  2YW8 A;  4TKP B;  3ZVY A;  2L43 A;  2FSA A;  4ZUX U;  4IC3 A;  1ZBD B;  4LKA A;  4XI1 A;  4FJC A;  3HCS A;  4A0C D;  5LKZ A;  1HYJ A;  2YUC A;  2M6M A;  2MNZ A;  3FL2 A;  5B75 A;  4B86 C;  2VPB A;  4A4C A;  5DIN A;  1WEO A;  3DPL R;  2EA6 A;  1WEM A;  1X4J A;  3ZVZ B;  5D1M B;  2MIQ A;  2M3H A;  2F42 A;  4WZ3 B;  2YYR A;  5LCW B;  4S3O B;  2VPG A;  4A49 A;  4QF3 A;  1FP0 A;  2JMJ A;  4MSX A;  4QF2 A;  4GNG A;  3RPG B;  3HCU A;  2ZET C;  2L5U A;  2VJF B;  2Y1M A;  3U5N A;  4YBT A;  2LGV A;  1FBV A;  4GND A;  4P5O B;  5FB1 A;  2LGL A;  1WEN A;  5DKA A;  4YAT A;  5I3L A;  5B77 A;  1E4U A;  3O7A A;  3C5K A;  1MM2 A;  2CKL A;  2VPD A;  4F52 B;  4LJN A;  5FEY A;  5G0F A;  3I2D A;  4L58 A;  2L80 A;  4FIP A;  1WIL A;  4YAD A;  2K1J A;  3M99 A;  3O36 A;  3GV4 A;  2JMI A;  2KGG A;  5FER A;  2H0D B;  4I7C A;  1X4U A;  4UI9 B;  1F62 A;  2ECT A;  1LDJ B;  2HDP A;  3HCT A;  2KWO A;  5LKT A;  2DX8 A;  2VNF A;  1RMD A;  5TRB A;  4L7X A;  2YU4 A;  3SOX A;  4AYC B;  3PUQ A;  1CHC A;  3ZYQ A;  3M63 A;  1MM3 A;  4V3K C;  3U5M A;  3IHP A;  4LLB A;  2MA5 A;  2ECJ A;  3N9N A;  1HYI A;  3N9M A;  4BHW A;  2YUR A;  5FB0 A;  3DQV R;  2I50 A;  2VP7 A;  2XB1 A;  2VJE A;  2Y43 A;  4GNE A;  2LQ6 A;  2E6S A;  5LKU A;  2ECW A;  3U5O A;  4CA1 A;  4CCG X;  2M85 A;  3O35 A;  3SOW A;  2LGG A;  5C13 A;  3PUR A;  3L1X A;  5KH3 A;  5KH7 A;  3PHD A;  2LXH C;  2FUI A;  2LV9 A;  1WEP A;  5B8D A;  2E6R A;  2QIZ A;  2EGP A;  1WIM A;  2ECV A;  3ZPV 1;  2H0D A;  3KV5 A;  2JRJ A;  2KGI A;  2RI7 A;  2CSZ A;  4AUQ B;  1WEU A;  1Z6U A;  4V3L C;  4YAX A;  1LDK C;  1WEV A;  2F6N A;  1T1H A;  2YHN A;  3O70 A;  2JMD A;  4WZ0 A;  2L75 A;  4R2Y A;  4WA6 A;  4A4B A;  5AIU A;  2MT5 A;  4I7D A;  2KWN A;  1WES A;  3U5P A;  5H9M A;  3LRQ A;  1G25 A;  2AN6 A;  2L0B A;  3L11 A;  2NAA A;  2KYU A;  2Y1N A;  5C11 A;  2QIC A;  1WE9 A;  2YQL A;  5LKX A;  2VJF A;  2K16 A;  2MNY A;  4ZQL A;  1DVP A;  2KE1 A;  3O34 A;  4Q6F A;  3ZTG A;  1VYX A;  2LGK A;  2VJE B;  2MA6 A; 
#chains in the Genus database with same CATH topology
 1DCQ A;  5K3Q A;  4LK9 A;  2IDA A;  3LQI A;  4C9Z A;  2CKL B;  3KV6 A;  5G05 B;  1X4I A;  2MD8 C;  4X3G A;  4AYC A;  5SVI B;  2HYE D;  2YSJ A;  4PTB A;  4NN2 A;  5B79 A;  3N9O A;  2KFT A;  4MVT A;  4AVX A;  3KNV A;  2MUM A;  3EB5 A;  5D1K B;  1WEW A;  2FUU A;  2BAY A;  2G45 A;  3VK6 A;  3ASL A;  3ZNI A;  5D1L B;  3RTR B;  3RPG C;  3N9L A;  5B78 A;  2EOD A;  1VD4 A;  4UP0 A;  1K2F A;  2OWA A;  1XWH A;  4PPE A;  2CRR A;  4W4U A;  3N9Q A;  3FEH A;  2ECN A;  2UZG A;  3MHS A;  3T6R A;  3M7K A;  3H7H A;  2PNX A;  2YRE A;  2LDR A;  5TDR A;  4GNF A;  1WEE A;  4YAB A;  4YBS A;  2YSM A;  3C6W A;  1VFY A;  3LQH A;  4ZDT A;  4QQ4 A;  3T7L A;  4BBQ A;  2G43 A;  2M13 A;  5H1T A;  4WZ2 A;  2KIZ A;  2IQJ A;  1IYM A;  3SOU A;  1JM7 A;  2K17 A;  3FAO A;  3LVQ E;  4N4F A;  2XEU A;  3KDE C;  2ECI A;  3EB6 A;  2QJ0 A;  3O33 A;  1U6G B;  5H1U A;  4AP4 A;  2KWJ A;  3M62 A;  5TDW A;  3DDT A;  2KR4 A;  4B7Y C;  2FFW A;  2F6J A;  5TAB A;  5J3X A;  3V43 A;  2DSM A;  5AIT A;  2M1R A;  3SHB A;  3ZPV E;  1MBM A;  4R7E A;  2YQM A;  3O37 A;  2YVR A;  1Z2Q A;  3GL6 A;  1BOR A;  2D8S A;  1V87 A;  1WFK A;  2FD4 A;  4O64 A;  4YBM A;  4R8P K;  5B76 A;  3MDB C;  2LN0 A;  2KU3 A;  2C2V S;  3L1Z B;  3LJU X;  2K4D A;  1WGM A;  2MD7 B;  2YT5 A;  3SUB A;  4I7B A;  5KH9 A;  1N87 A;  3NG2 A;  1WEQ A;  4LAD B;  5JG6 A;  2D8U A;  4IC2 A;  3PLW A;  2C2L A;  5EYA F;  3KQI A;  3MHH A;  4N3W A;  2YHO A;  2CSV A;  2ECG A;  1JM7 B;  2KWK A;  4FO9 A;  2KKY A;  2KRE A;  3HTK C;  2CSY A;  4FK5 A;  2LXP C;  1JOC A;  2RR4 A;  2DJA A;  2CT2 A;  3FM8 C;  3QZV A;  3LQJ A;  5G04 B;  3N9P A;  2G6Q A;  4UP5 A;  1Z60 A;  5H1V A;  2OXQ C;  4S3O C;  2PUY A;  4H9D A;  4YC9 A;  2XOC A;  2VPE A;  4GB0 A;  5TBN A;  2LRI C;  2RSD A;  2YW8 A;  4TKP B;  3ZVY A;  2CRW A;  2L43 A;  2FSA A;  4ZUX U;  2JM3 A;  4IC3 A;  1ZBD B;  4LKA A;  3FJU B;  4XI1 A;  4FJC A;  3HCS A;  4A0C D;  5LKZ A;  1HYJ A;  2YUC A;  2M6M A;  2CON A;  2MNZ A;  3FL2 A;  5B75 A;  4B86 C;  2VPB A;  4A4C A;  5DIN A;  1WEO A;  3DPL R;  2EA6 A;  1WEM A;  1X4J A;  4OGE A;  3ZVZ B;  5D1M B;  2MIQ A;  2M3H A;  2F42 A;  4WZ3 B;  4Z0R A;  2XOY A;  2YYR A;  5LCW B;  4S3O B;  2VPG A;  4A49 A;  4QF3 A;  4O62 A;  1FP0 A;  2JMJ A;  4MSX A;  4QF2 A;  4GNG A;  3RPG B;  5SVY A;  3HCU A;  2ZET C;  2L5U A;  2VJF B;  2Y1M A;  3U5N A;  4YBT A;  2LGV A;  1FBV A;  4GND A;  4P5O B;  5FB1 A;  2LGL A;  1WEN A;  5DKA A;  4YAT A;  2L7P A;  5I3L A;  5B77 A;  1E4U A;  3O7A A;  3C5K A;  1MM2 A;  2CKL A;  2VPD A;  4F52 B;  4LJN A;  2EGM A;  5FEY A;  2B0O E;  3I2D A;  4L58 A;  5G0F A;  2L80 A;  4FIP A;  1WIL A;  4YAD A;  2K1J A;  3M99 A;  3O36 A;  3GV4 A;  2JMI A;  2KGG A;  5FER A;  2E61 A;  2H0D B;  4I7C A;  1X4U A;  4Z0O A;  4UI9 B;  1F62 A;  3LDY A;  2ECT A;  1LDJ B;  2HDP A;  3HCT A;  2KWO A;  5LKT A;  2DX8 A;  2VNF A;  1RMD A;  5TRB A;  4L7X A;  2YU4 A;  3SOX A;  5SVI A;  4AYC B;  3PUQ A;  1CHC A;  4OGC A;  3ZYQ A;  4F1P A;  3M63 A;  1MM3 A;  4V3K C;  3U5M A;  3IHP A;  4LLB A;  2EXU A;  2MA5 A;  2ECJ A;  3N9N A;  1HYI A;  3N9M A;  3T9K A;  3Q1D A;  4BHW A;  2YUR A;  5FB0 A;  3DQV R;  2I50 A;  2VP7 A;  2XB1 A;  2VJE A;  2Y43 A;  4GNE A;  2LQ6 A;  2E6S A;  5LKU A;  2ECW A;  3U5O A;  4CA1 A;  4CCG X;  2M85 A;  2XOZ A;  3O35 A;  3SOW A;  2LGG A;  5C13 A;  3FAN A;  3PUR A;  3L1X A;  5KH3 A;  5KH7 A;  3PHD A;  2LXH C;  2FUI A;  2LV9 A;  5SVX A;  1WEP A;  5B8D A;  2E6R A;  2QIZ A;  2EGP A;  1WIM A;  2ECV A;  3ZPV 1;  2P57 A;  2H0D A;  3KV5 A;  2JRJ A;  2KGI A;  3E2D A;  2RI7 A;  2CSZ A;  4AUQ B;  1WEU A;  1Z6U A;  4V3L C;  2JUN A;  4YAX A;  3O47 A;  1LDK C;  3JUE A;  2KKX A;  1WEV A;  2F6N A;  1T1H A;  2YHN A;  3O70 A;  2JMD A;  4WZ0 A;  2L75 A;  2LAU A;  4R2Y A;  4WA6 A;  4A4B A;  5AIU A;  2MT5 A;  4I7D A;  2KWN A;  1WES A;  2XP0 A;  3U5P A;  5H9M A;  3LRQ A;  1G25 A;  2AN6 A;  2L0B A;  3L11 A;  2NAA A;  2KYU A;  2Y1N A;  5C11 A;  2QIC A;  1WE9 A;  2YQL A;  3DWD A;  5LKX A;  2VJF A;  2K16 A;  2MNY A;  3LVR E;  4ZQL A;  1DVP A;  2KE1 A;  3O34 A;  4Q6F A;  3ZTG A;  2MKE A;  1VYX A;  2LGK A;  2VJE B;  2MA6 A; 
#chains in the Genus database with same CATH homology
 4LK9 A;  2IDA A;  3LQI A;  4C9Z A;  2CKL B;  3KV6 A;  5G05 B;  1X4I A;  2MD8 C;  4X3G A;  4AYC A;  2HYE D;  2YSJ A;  5B79 A;  4PTB A;  4NN2 A;  3N9O A;  2KFT A;  4MVT A;  4AVX A;  3KNV A;  2MUM A;  3EB5 A;  5D1K B;  1WEW A;  2FUU A;  2BAY A;  2G45 A;  3VK6 A;  3ASL A;  3ZNI A;  5D1L B;  3RTR B;  3RPG C;  3N9L A;  5B78 A;  2EOD A;  1VD4 A;  4UP0 A;  1K2F A;  4PPE A;  1XWH A;  4W4U A;  3N9Q A;  2ECN A;  2UZG A;  3MHS A;  3T6R A;  2PNX A;  2YRE A;  2LDR A;  5TDR A;  4GNF A;  1WEE A;  4YAB A;  4YBS A;  2YSM A;  3C6W A;  1VFY A;  3LQH A;  4ZDT A;  3T7L A;  4BBQ A;  2G43 A;  5H1T A;  4WZ2 A;  2KIZ A;  1IYM A;  3SOU A;  1JM7 A;  2K17 A;  4N4F A;  2XEU A;  2ECI A;  3EB6 A;  2QJ0 A;  3O33 A;  1U6G B;  5H1U A;  4AP4 A;  2KWJ A;  3M62 A;  5TDW A;  2KR4 A;  4B7Y C;  2F6J A;  5TAB A;  5J3X A;  3V43 A;  5AIT A;  2M1R A;  3SHB A;  3ZPV E;  4R7E A;  2YQM A;  3O37 A;  1Z2Q A;  3GL6 A;  1BOR A;  2D8S A;  1V87 A;  1WFK A;  4O64 A;  4YBM A;  4R8P K;  5B76 A;  2LN0 A;  2KU3 A;  2C2V S;  3L1Z B;  2K4D A;  1WGM A;  2MD7 B;  2YT5 A;  4I7B A;  5KH9 A;  1N87 A;  3NG2 A;  1WEQ A;  4LAD B;  5JG6 A;  4IC2 A;  2C2L A;  5EYA F;  3KQI A;  3MHH A;  4N3W A;  2YHO A;  1JM7 B;  2ECG A;  2KWK A;  4FO9 A;  2KRE A;  3HTK C;  2CSY A;  4FK5 A;  2LXP C;  1JOC A;  2CT2 A;  3QZV A;  3LQJ A;  5G04 B;  3N9P A;  2G6Q A;  4UP5 A;  1Z60 A;  5H1V A;  2OXQ C;  4S3O C;  2PUY A;  4YC9 A;  2VPE A;  4GB0 A;  5TBN A;  2LRI C;  2RSD A;  2YW8 A;  4TKP B;  3ZVY A;  2L43 A;  2FSA A;  4ZUX U;  4IC3 A;  1ZBD B;  4LKA A;  4XI1 A;  4FJC A;  3HCS A;  4A0C D;  5LKZ A;  1HYJ A;  2YUC A;  2M6M A;  2MNZ A;  3FL2 A;  5B75 A;  4B86 C;  2VPB A;  4A4C A;  5DIN A;  1WEO A;  3DPL R;  2EA6 A;  1WEM A;  1X4J A;  3ZVZ B;  5D1M B;  2MIQ A;  2M3H A;  2F42 A;  4WZ3 B;  2YYR A;  5LCW B;  4S3O B;  2VPG A;  4A49 A;  4QF3 A;  1FP0 A;  2JMJ A;  4MSX A;  4QF2 A;  4GNG A;  3RPG B;  3HCU A;  2ZET C;  2L5U A;  2VJF B;  2Y1M A;  3U5N A;  4YBT A;  2LGV A;  1FBV A;  4GND A;  4P5O B;  5FB1 A;  2LGL A;  1WEN A;  5DKA A;  4YAT A;  5I3L A;  5B77 A;  1E4U A;  3O7A A;  3C5K A;  1MM2 A;  2CKL A;  2VPD A;  4F52 B;  4LJN A;  5FEY A;  5G0F A;  3I2D A;  4L58 A;  2L80 A;  4FIP A;  1WIL A;  4YAD A;  2K1J A;  3M99 A;  3O36 A;  3GV4 A;  2JMI A;  2KGG A;  5FER A;  2H0D B;  4I7C A;  1X4U A;  4UI9 B;  1F62 A;  2ECT A;  1LDJ B;  2HDP A;  3HCT A;  2KWO A;  5LKT A;  2DX8 A;  2VNF A;  1RMD A;  5TRB A;  4L7X A;  2YU4 A;  3SOX A;  4AYC B;  3PUQ A;  1CHC A;  3ZYQ A;  3M63 A;  1MM3 A;  4V3K C;  3U5M A;  3IHP A;  4LLB A;  2MA5 A;  2ECJ A;  3N9N A;  1HYI A;  3N9M A;  4BHW A;  2YUR A;  5FB0 A;  3DQV R;  2I50 A;  2VP7 A;  2XB1 A;  2VJE A;  2Y43 A;  4GNE A;  2LQ6 A;  2E6S A;  5LKU A;  2ECW A;  3U5O A;  4CA1 A;  4CCG X;  2M85 A;  3O35 A;  3SOW A;  2LGG A;  5C13 A;  3PUR A;  3L1X A;  5KH3 A;  5KH7 A;  3PHD A;  2LXH C;  2FUI A;  2LV9 A;  1WEP A;  5B8D A;  2E6R A;  2QIZ A;  2EGP A;  1WIM A;  2ECV A;  3ZPV 1;  2H0D A;  3KV5 A;  2JRJ A;  2KGI A;  2RI7 A;  2CSZ A;  4AUQ B;  1WEU A;  1Z6U A;  4V3L C;  4YAX A;  1LDK C;  1WEV A;  2F6N A;  1T1H A;  2YHN A;  3O70 A;  2JMD A;  4WZ0 A;  2L75 A;  4R2Y A;  4WA6 A;  4A4B A;  5AIU A;  2MT5 A;  4I7D A;  2KWN A;  1WES A;  3U5P A;  5H9M A;  3LRQ A;  1G25 A;  2AN6 A;  2L0B A;  3L11 A;  2NAA A;  2KYU A;  2Y1N A;  5C11 A;  2QIC A;  1WE9 A;  2YQL A;  5LKX A;  2VJF A;  2K16 A;  2MNY A;  4ZQL A;  1DVP A;  2KE1 A;  3O34 A;  4Q6F A;  3ZTG A;  1VYX A;  2LGK A;  2VJE B;  2MA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...