4GNEA

Crystal structure of nsd3 tandem phd5-c5hch domains complexed with h3 peptide 1-7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
98
structure length
98
Chain Sequence
b'PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase NSD3
publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
total genus 20
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gneA00
4B7YC 1X4JA 2ECJA 1WEVA 2YT5A 2MD7B 4ZDTA 3MHHA 3LRQA 2EGPA 1WEWA 1ZBDB 1T1HA 1JOCA 4I7CA 1WEQA 2EODA 2YHNA 3GL6A 2LRIC 5G05B 2M85A 4LJNA 3O37A 2QICA 3FL2A 2MA6A 5FERA 2K4DA 2VJFB 2JRJA 3DQVR 4AYCB 3V43A 5AIUA 1WFKA 2CT2A 3L11A 4I7BA 2DX8A 2VNFA 3ZNIA 3IHPA 1FP0A 4IC2A 2YURA 2CSZA 4YAXA 4V3KC 2VP7A 2KGIA 5LCWB 2MNYA 2KU3A 3KV6A 2KWNA 2ZETC 1WEPA 3ZYQA 4YATA 3N9QA 1G25A 2M1RA 5KH7A 2ECIA 4XI1A 2LDRA 1VFYA 2LGVA 3PURA 5TABA 5H1VA 1WGMA 4LK9A 1CHCA 3MHSA 5G04B 3M62A 2MNZA 5D1MB 5C11A 1N87A 2ECWA 4YADA 4YBTA 1F62A 4WZ2A 2KIZA 5C13A 1X4IA 5H1TA 1X4UA 3EB5A 1U6GB 4R2YA 4R7EA 4F52B 3N9NA 5KH3A 4LKAA 4YC9A 2KE1A 2YYRA 1WIMA 5B77A 4WZ3B 3O7AA 4A4CA 4UP0A 2QJ0A 3N9OA 1WEUA 5EYAF 4LADB 3O35A 2ECVA 3SOUA 4PPEA 3LQHA 2LGKA 1DVPA 4PTBA 2KFTA 4L7XA 2LGLA 2ECNA 4N3WA 2KGGA 1WE9A 3NG2A 4YBMA 4ZUXU 3RTRB 3O70A 2VJEB 2JMJA 4QF2A 3L1ZB 2K1JA 3O36A 2VPGA 3KQIA 2K16A 3L1XA 2L43A 1RMDA 1FBVA 3LQJA 2JMDA 4R8PK 4C9ZA 2L0BA 2M6MA 4AUQB 1JM7B 3U5NA 2KYUA 3ZVZB 5LKUA 2VJFA 4ZQLA 1HYJA 1Z2QA 4AYCA 5B76A 2I50A 2BAYA 2KR4A 4L58A 2YQMA 2VPBA 1JM7A 5G0FA 3DPLR 4MVTA 4GNEA 5LKXA 3QZVA 1E4UA 3M63A 1LDKC 3O33A 4AP4A 4UI9B 2LQ6A 2G45A 4A49A 2CKLB 5H9MA 3HCUA 2YREA 3KV5A 3LQIA 1V87A 3PHDA 2RI7A 1WEEA 4GNFA 2FUUA 2MIQA 4FO9A 2OXQC 2LV9A 1K2FA 4IC3A 2YUCA 3HTKC 2MA5A 4YBSA 3I2DA 2PUYA 2D8SA 1Z6UA 3C5KA 5H1UA 1HYIA 1VD4A 3SHBA 3HCSA 2ECGA 5B79A 4YABA 5LKZA 2Y43A 2KWOA 4B86C 3N9PA 2NAAA 4Q6FA 3N9LA 3T6RA 2YHOA 2XB1A 4V3LC 2FSAA 5D1KB 3ASLA 2G6QA 1WILA 2H0DB 5B75A 2PNXA 4N4FA 4NN2A 3SOXA 3N9MA 3U5PA 2L75A 2RSDA 4GB0A 4FIPA 3EB6A 1IYMA 5B78A 2YW8A 2Y1NA 5DKAA 4GNGA 2KWKA 4A4BA 3U5MA 1MM3A 2E6RA 2ECTA 3U5OA 2H0DA 4LLBA 2LXPC 2MUMA 2YU4A 5DINA 3ZPV1 3ZPVE 2CSYA 1Z60A 2M3HA 1BORA 2VJEA 2VPDA 4BBQA 2Y1MA 2LXHC 2UZGA 2LN0A 5AITA 5LKTA 2C2VS 4WA6A 2VPEA 3T7LA 2AN6A 4UP5A 1MM2A 3M99A 2YSMA 2QIZA 2L5UA 5B8DA 2EA6A 5FB0A 2FUIA 5TDWA 1WEOA 3ZVYA 2JMIA 4S3OB 2F42A 2KREA 2C2LA 3KNVA 4S3OC 5TRBA 3GV4A 4A0CD 2E6SA 5J3XA 3VK6A 4QF3A 5TDRA 1XWHA 3PUQA 2CKLA 2HDPA 4MSXA 1LDJB 4WZ0A 4I7DA 2KWJA 1WEMA 2MT5A 2HYED 3SOWA 5TBNA 4AVXA 2F6NA 4O64A 3ZTGA 4CA1A 4TKPB 2IDAA 4FK5A 4X3GA 3HCTA 2LGGA 2YSJA 4CCGX 5JG6A 2L80A 4FJCA 2K17A 1WENA 2YQLA 5KH9A 5FB1A 4GNDA 3RPGB 4W4UA 3RPGC 2F6JA 3O34A 2G43A 3C6WA 5FEYA 1VYXA 5D1LB 5I3LA 2XEUA 1WESA 2MD8C 4BHWA 4P5OB
chains in the Genus database with same CATH superfamily
4B7YC 1X4JA 2ECJA 3T9KA 1WEVA 2YT5A 2MD7B 4ZDTA 3MHHA 2JM3A 3LDYA 3LRQA 2EGPA 1WEWA 1ZBDB 1T1HA 1JOCA 4I7CA 1WEQA 2EODA 2YHNA 3GL6A 2LRIC 5G05B 2M85A 4LJNA 3O37A 2QICA 3FL2A 2MA6A 5FERA 2K4DA 2VJFB 2JRJA 3DQVR 4AYCB 2B0OE 4F1PA 3DWDA 3V43A 5AIUA 1WFKA 2CT2A 3L11A 3FEHA 4I7BA 2DX8A 2VNFA 3ZNIA 3IHPA 1FP0A 4IC2A 2YURA 2P57A 2CSZA 4YAXA 4V3KC 2L7PA 2VP7A 2KGIA 5LCWB 2MNYA 2KU3A 3Q1DA 2KKXA 3KV6A 2KWNA 2ZETC 1WEPA 3ZYQA 3KDEC 4YATA 3N9QA 1G25A 2M1RA 5KH7A 2ECIA 4XI1A 2LDRA 1VFYA 2LGVA 3PURA 5TABA 5H1VA 1WGMA 4LK9A 1CHCA 3MHSA 5G04B 4QQ4A 3M62A 5K3QA 2MNZA 5D1MB 2XP0A 5C11A 1N87A 2ECWA 4YADA 4YBTA 3O47A 4WZ2A 2CRRA 2KIZA 5C13A 1X4IA 1F62A 5H1TA 1X4UA 3EB5A 1U6GB 4R2YA 4R7EA 4F52B 3N9NA 5KH3A 4LKAA 4YC9A 2EGMA 2KE1A 2YYRA 1WIMA 5B77A 4WZ3B 3O7AA 3FJUB 4A4CA 4UP0A 2QJ0A 3N9OA 1WEUA 5EYAF 4LADB 3O35A 2ECVA 3SOUA 4PPEA 3LQHA 2LGKA 2KKYA 1DVPA 4PTBA 2KFTA 4L7XA 2LGLA 2ECNA 4N3WA 2KGGA 1WE9A 3NG2A 3MDBC 3LVRE 1DCQA 4YBMA 4ZUXU 3RTRB 3O70A 2CONA 2VJEB 2JMJA 4QF2A 3L1ZB 2K1JA 3O36A 2VPGA 3KQIA 2K16A 3L1XA 2L43A 1RMDA 1FBVA 3LQJA 2JMDA 4R8PK 4C9ZA 2L0BA 2M6MA 4AUQB 1JM7B 3U5NA 3JUEA 2KYUA 3ZVZB 5LKUA 2VJFA 4ZQLA 1HYJA 1Z2QA 4Z0RA 4AYCA 5B76A 2I50A 2BAYA 2KR4A 4L58A 2YQMA 2VPBA 1JM7A 5G0FA 3DPLR 4MVTA 4GNEA 2RR4A 2CSVA 5LKXA 3QZVA 1E4UA 3M63A 1LDKC 3O33A 4AP4A 4UI9B 2LQ6A 2G45A 4A49A 2CKLB 5H9MA 3HCUA 4H9DA 2YREA 3KV5A 5SVIB 3LQIA 1V87A 3PHDA 2RI7A 1WEEA 4Z0OA 4GNFA 2FUUA 2MIQA 4FO9A 5SVIA 2OXQC 2LV9A 2M13A 1K2FA 2D8UA 4IC3A 2IQJA 3FAOA 2YUCA 3HTKC 4OGCA 2MA5A 4YBSA 3I2DA 2PUYA 2D8SA 1Z6UA 3C5KA 5H1UA 2XOZA 1HYIA 2OWAA 1VD4A 2DSMA 3SHBA 3HCSA 2ECGA 5B79A 4YABA 5LKZA 2Y43A 2KWOA 4B86C 3N9PA 2FFWA 2NAAA 4Q6FA 5SVXA 3N9LA 3T6RA 2XOCA 2YHOA 2XB1A 4V3LC 2FSAA 5D1KB 3ASLA 2G6QA 1WILA 2H0DB 5B75A 2PNXA 4N4FA 4NN2A 3SOXA 3N9MA 3U5PA 2L75A 2RSDA 4GB0A 4FIPA 3EB6A 1IYMA 5B78A 2YW8A 2Y1NA 5DKAA 4GNGA 2CRWA 2KWKA 4A4BA 3E2DA 3U5MA 1MM3A 2E6RA 2ECTA 3U5OA 2H0DA 3FANA 4LLBA 2LXPC 2MUMA 2YU4A 5DINA 3ZPV1 3ZPVE 4OGEA 2CSYA 1Z60A 2M3HA 1BORA 2VJEA 2VPDA 4BBQA 2Y1MA 2LXHC 2UZGA 2LN0A 5AITA 5LKTA 2C2VS 4WA6A 2VPEA 3T7LA 2AN6A 4UP5A 2FD4A 1MM2A 3M99A 3H7HA 2EXUA 2QIZA 2YSMA 2YVRA 2LAUA 2DJAA 5SVYA 2L5UA 5B8DA 2EA6A 5FB0A 2FUIA 5TDWA 1WEOA 3ZVYA 2JMIA 4S3OB 2F42A 3SUBA 2KREA 2C2LA 3KNVA 4S3OC 2MKEA 3DDTA 5TRBA 3GV4A 4A0CD 2E6SA 2JUNA 5J3XA 3VK6A 4QF3A 5TDRA 1XWHA 3PUQA 2CKLA 2HDPA 4MSXA 1LDJB 4WZ0A 4I7DA 2KWJA 1WEMA 2MT5A 2HYED 3SOWA 5TBNA 4AVXA 2F6NA 4O64A 3ZTGA 3LVQE 4CA1A 4TKPB 2IDAA 4FK5A 1MBMA 4X3GA 3HCTA 3M7KA 2LGGA 2YSJA 4CCGX 5JG6A 2L80A 4FJCA 2K17A 1WENA 2YQLA 3PLWA 5KH9A 5FB1A 4GNDA 3RPGB 4O62A 2E61A 4W4UA 3RPGC 3FM8C 3LJUX 2F6JA 3O34A 2G43A 3C6WA 5FEYA 1VYXA 5D1LB 5I3LA 2XEUA 1WESA 2MD8C 4BHWA 4P5OB 2XOYA
chains in the Genus database with same CATH topology
4B7YC 1X4JA 2ECJA 1WEVA 2YT5A 2MD7B 4ZDTA 3MHHA 3LRQA 2EGPA 1WEWA 1ZBDB 1T1HA 1JOCA 4I7CA 1WEQA 2EODA 2YHNA 3GL6A 2LRIC 5G05B 2M85A 4LJNA 3O37A 2QICA 3FL2A 2MA6A 5FERA 2K4DA 2VJFB 2JRJA 3DQVR 4AYCB 3V43A 5AIUA 1WFKA 2CT2A 3L11A 4I7BA 2DX8A 2VNFA 3ZNIA 3IHPA 1FP0A 4IC2A 2YURA 2CSZA 4YAXA 4V3KC 2VP7A 2KGIA 5LCWB 2MNYA 2KU3A 3KV6A 2KWNA 2ZETC 1WEPA 3ZYQA 4YATA 3N9QA 1G25A 2M1RA 5KH7A 2ECIA 4XI1A 2LDRA 1VFYA 2LGVA 3PURA 5TABA 5H1VA 1WGMA 4LK9A 1CHCA 3MHSA 5G04B 3M62A 2MNZA 5D1MB 5C11A 1N87A 2ECWA 4YADA 4YBTA 1F62A 4WZ2A 2KIZA 5C13A 1X4IA 5H1TA 1X4UA 3EB5A 1U6GB 4R2YA 4R7EA 4F52B 3N9NA 5KH3A 4LKAA 4YC9A 2KE1A 2YYRA 1WIMA 5B77A 4WZ3B 3O7AA 4A4CA 4UP0A 2QJ0A 3N9OA 1WEUA 5EYAF 4LADB 3O35A 2ECVA 3SOUA 4PPEA 3LQHA 2LGKA 1DVPA 4PTBA 2KFTA 4L7XA 2LGLA 2ECNA 4N3WA 2KGGA 1WE9A 3NG2A 4YBMA 4ZUXU 3RTRB 3O70A 2VJEB 2JMJA 4QF2A 3L1ZB 2K1JA 3O36A 2VPGA 3KQIA 2K16A 3L1XA 2L43A 1RMDA 1FBVA 3LQJA 2JMDA 4R8PK 4C9ZA 2L0BA 2M6MA 4AUQB 1JM7B 3U5NA 2KYUA 3ZVZB 5LKUA 2VJFA 4ZQLA 1HYJA 1Z2QA 4AYCA 5B76A 2I50A 2BAYA 2KR4A 4L58A 2YQMA 2VPBA 1JM7A 5G0FA 3DPLR 4MVTA 4GNEA 5LKXA 3QZVA 1E4UA 3M63A 1LDKC 3O33A 4AP4A 4UI9B 2LQ6A 2G45A 4A49A 2CKLB 5H9MA 3HCUA 2YREA 3KV5A 3LQIA 1V87A 3PHDA 2RI7A 1WEEA 4GNFA 2FUUA 2MIQA 4FO9A 2OXQC 2LV9A 1K2FA 4IC3A 2YUCA 3HTKC 2MA5A 4YBSA 3I2DA 2PUYA 2D8SA 1Z6UA 3C5KA 5H1UA 1HYIA 1VD4A 3SHBA 3HCSA 2ECGA 5B79A 4YABA 5LKZA 2Y43A 2KWOA 4B86C 3N9PA 2NAAA 4Q6FA 3N9LA 3T6RA 2YHOA 2XB1A 4V3LC 2FSAA 5D1KB 3ASLA 2G6QA 1WILA 2H0DB 5B75A 2PNXA 4N4FA 4NN2A 3SOXA 3N9MA 3U5PA 2L75A 2RSDA 4GB0A 4FIPA 3EB6A 1IYMA 5B78A 2YW8A 2Y1NA 5DKAA 4GNGA 2KWKA 4A4BA 3U5MA 1MM3A 2E6RA 2ECTA 3U5OA 2H0DA 4LLBA 2LXPC 2MUMA 2YU4A 5DINA 3ZPV1 3ZPVE 2CSYA 1Z60A 2M3HA 1BORA 2VJEA 2VPDA 4BBQA 2Y1MA 2LXHC 2UZGA 2LN0A 5AITA 5LKTA 2C2VS 4WA6A 2VPEA 3T7LA 2AN6A 4UP5A 1MM2A 3M99A 2YSMA 2QIZA 2L5UA 5B8DA 2EA6A 5FB0A 2FUIA 5TDWA 1WEOA 3ZVYA 2JMIA 4S3OB 2F42A 2KREA 2C2LA 3KNVA 4S3OC 5TRBA 3GV4A 4A0CD 2E6SA 5J3XA 3VK6A 4QF3A 5TDRA 1XWHA 3PUQA 2CKLA 2HDPA 4MSXA 1LDJB 4WZ0A 4I7DA 2KWJA 1WEMA 2MT5A 2HYED 3SOWA 5TBNA 4AVXA 2F6NA 4O64A 3ZTGA 4CA1A 4TKPB 2IDAA 4FK5A 4X3GA 3HCTA 2LGGA 2YSJA 4CCGX 5JG6A 2L80A 4FJCA 2K17A 1WENA 2YQLA 5KH9A 5FB1A 4GNDA 3RPGB 4W4UA 3RPGC 2F6JA 3O34A 2G43A 3C6WA 5FEYA 1VYXA 5D1LB 5I3LA 2XEUA 1WESA 2MD8C 4BHWA 4P5OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B7Y C;  1X4J A;  2ECJ A;  1WEV A;  2YT5 A;  2MD7 B;  4ZDT A;  3MHH A;  3LRQ A;  2EGP A;  1WEW A;  1ZBD B;  1T1H A;  1JOC A;  4I7C A;  1WEQ A;  2EOD A;  2YHN A;  3GL6 A;  2LRI C;  5G05 B;  2M85 A;  4LJN A;  3O37 A;  2QIC A;  3FL2 A;  2MA6 A;  5FER A;  2K4D A;  2VJF B;  2JRJ A;  3DQV R;  4AYC B;  3V43 A;  5AIU A;  1WFK A;  2CT2 A;  3L11 A;  4I7B A;  2DX8 A;  2VNF A;  3ZNI A;  3IHP A;  1FP0 A;  4IC2 A;  2YUR A;  2CSZ A;  4YAX A;  4V3K C;  2VP7 A;  2KGI A;  5LCW B;  2MNY A;  2KU3 A;  3KV6 A;  2KWN A;  2ZET C;  1WEP A;  3ZYQ A;  4YAT A;  3N9Q A;  1G25 A;  2M1R A;  5KH7 A;  2ECI A;  4XI1 A;  2LDR A;  1VFY A;  2LGV A;  3PUR A;  5TAB A;  5H1V A;  1WGM A;  4LK9 A;  1CHC A;  3MHS A;  5G04 B;  3M62 A;  2MNZ A;  5D1M B;  5C11 A;  1N87 A;  2ECW A;  4YAD A;  4YBT A;  1F62 A;  4WZ2 A;  2KIZ A;  5C13 A;  1X4I A;  5H1T A;  1X4U A;  3EB5 A;  1U6G B;  4R2Y A;  4R7E A;  4F52 B;  3N9N A;  5KH3 A;  4LKA A;  4YC9 A;  2KE1 A;  2YYR A;  1WIM A;  5B77 A;  4WZ3 B;  3O7A A;  4A4C A;  4UP0 A;  2QJ0 A;  3N9O A;  1WEU A;  5EYA F;  4LAD B;  3O35 A;  2ECV A;  3SOU A;  4PPE A;  3LQH A;  2LGK A;  1DVP A;  4PTB A;  2KFT A;  4L7X A;  2LGL A;  2ECN A;  4N3W A;  2KGG A;  1WE9 A;  3NG2 A;  4YBM A;  4ZUX U;  3RTR B;  3O70 A;  2VJE B;  2JMJ A;  4QF2 A;  3L1Z B;  2K1J A;  3O36 A;  2VPG A;  3KQI A;  2K16 A;  3L1X A;  2L43 A;  1RMD A;  1FBV A;  3LQJ A;  2JMD A;  4R8P K;  4C9Z A;  2L0B A;  2M6M A;  4AUQ B;  1JM7 B;  3U5N A;  2KYU A;  3ZVZ B;  5LKU A;  2VJF A;  4ZQL A;  1HYJ A;  1Z2Q A;  4AYC A;  5B76 A;  2I50 A;  2BAY A;  2KR4 A;  4L58 A;  2YQM A;  2VPB A;  1JM7 A;  5G0F A;  3DPL R;  4MVT A;  4GNE A;  5LKX A;  3QZV A;  1E4U A;  3M63 A;  1LDK C;  3O33 A;  4AP4 A;  4UI9 B;  2LQ6 A;  2G45 A;  4A49 A;  2CKL B;  5H9M A;  3HCU A;  2YRE A;  3KV5 A;  3LQI A;  1V87 A;  3PHD A;  2RI7 A;  1WEE A;  4GNF A;  2FUU A;  2MIQ A;  4FO9 A;  2OXQ C;  2LV9 A;  1K2F A;  4IC3 A;  2YUC A;  3HTK C;  2MA5 A;  4YBS A;  3I2D A;  2PUY A;  2D8S A;  1Z6U A;  3C5K A;  5H1U A;  1HYI A;  1VD4 A;  3SHB A;  3HCS A;  2ECG A;  5B79 A;  4YAB A;  5LKZ A;  2Y43 A;  2KWO A;  4B86 C;  3N9P A;  2NAA A;  4Q6F A;  3N9L A;  3T6R A;  2YHO A;  2XB1 A;  4V3L C;  2FSA A;  5D1K B;  3ASL A;  2G6Q A;  1WIL A;  2H0D B;  5B75 A;  2PNX A;  4N4F A;  4NN2 A;  3SOX A;  3N9M A;  3U5P A;  2L75 A;  2RSD A;  4GB0 A;  4FIP A;  3EB6 A;  1IYM A;  5B78 A;  2YW8 A;  2Y1N A;  5DKA A;  4GNG A;  2KWK A;  4A4B A;  3U5M A;  1MM3 A;  2E6R A;  2ECT A;  3U5O A;  2H0D A;  4LLB A;  2LXP C;  2MUM A;  2YU4 A;  5DIN A;  3ZPV 1;  3ZPV E;  2CSY A;  1Z60 A;  2M3H A;  1BOR A;  2VJE A;  2VPD A;  4BBQ A;  2Y1M A;  2LXH C;  2UZG A;  2LN0 A;  5AIT A;  5LKT A;  2C2V S;  4WA6 A;  2VPE A;  3T7L A;  2AN6 A;  4UP5 A;  1MM2 A;  3M99 A;  2YSM A;  2QIZ A;  2L5U A;  5B8D A;  2EA6 A;  5FB0 A;  2FUI A;  5TDW A;  1WEO A;  3ZVY A;  2JMI A;  4S3O B;  2F42 A;  2KRE A;  2C2L A;  3KNV A;  4S3O C;  5TRB A;  3GV4 A;  4A0C D;  2E6S A;  5J3X A;  3VK6 A;  4QF3 A;  5TDR A;  1XWH A;  3PUQ A;  2CKL A;  2HDP A;  4MSX A;  1LDJ B;  4WZ0 A;  4I7D A;  2KWJ A;  1WEM A;  2MT5 A;  2HYE D;  3SOW A;  5TBN A;  4AVX A;  2F6N A;  4O64 A;  3ZTG A;  4CA1 A;  4TKP B;  2IDA A;  4FK5 A;  4X3G A;  3HCT A;  2LGG A;  2YSJ A;  4CCG X;  5JG6 A;  2L80 A;  4FJC A;  2K17 A;  1WEN A;  2YQL A;  5KH9 A;  5FB1 A;  4GND A;  3RPG B;  4W4U A;  3RPG C;  2F6J A;  3O34 A;  2G43 A;  3C6W A;  5FEY A;  1VYX A;  5D1L B;  5I3L A;  2XEU A;  1WES A;  2MD8 C;  4BHW A;  4P5O B; 
#chains in the Genus database with same CATH topology
 4B7Y C;  1X4J A;  2ECJ A;  3T9K A;  1WEV A;  2YT5 A;  2MD7 B;  4ZDT A;  3MHH A;  2JM3 A;  3LDY A;  3LRQ A;  2EGP A;  1WEW A;  1ZBD B;  1T1H A;  1JOC A;  4I7C A;  1WEQ A;  2EOD A;  2YHN A;  3GL6 A;  2LRI C;  5G05 B;  2M85 A;  4LJN A;  3O37 A;  2QIC A;  3FL2 A;  2MA6 A;  5FER A;  2K4D A;  2VJF B;  2JRJ A;  3DQV R;  4AYC B;  2B0O E;  4F1P A;  3DWD A;  3V43 A;  5AIU A;  1WFK A;  2CT2 A;  3L11 A;  3FEH A;  4I7B A;  2DX8 A;  2VNF A;  3ZNI A;  3IHP A;  1FP0 A;  4IC2 A;  2YUR A;  2P57 A;  2CSZ A;  4YAX A;  4V3K C;  2L7P A;  2VP7 A;  2KGI A;  5LCW B;  2MNY A;  2KU3 A;  3Q1D A;  2KKX A;  3KV6 A;  2KWN A;  2ZET C;  1WEP A;  3ZYQ A;  3KDE C;  4YAT A;  3N9Q A;  1G25 A;  2M1R A;  5KH7 A;  2ECI A;  4XI1 A;  2LDR A;  1VFY A;  2LGV A;  3PUR A;  5TAB A;  5H1V A;  1WGM A;  4LK9 A;  1CHC A;  3MHS A;  5G04 B;  4QQ4 A;  3M62 A;  5K3Q A;  2MNZ A;  5D1M B;  2XP0 A;  5C11 A;  1N87 A;  2ECW A;  4YAD A;  4YBT A;  3O47 A;  4WZ2 A;  2CRR A;  2KIZ A;  5C13 A;  1X4I A;  1F62 A;  5H1T A;  1X4U A;  3EB5 A;  1U6G B;  4R2Y A;  4R7E A;  4F52 B;  3N9N A;  5KH3 A;  4LKA A;  4YC9 A;  2EGM A;  2KE1 A;  2YYR A;  1WIM A;  5B77 A;  4WZ3 B;  3O7A A;  3FJU B;  4A4C A;  4UP0 A;  2QJ0 A;  3N9O A;  1WEU A;  5EYA F;  4LAD B;  3O35 A;  2ECV A;  3SOU A;  4PPE A;  3LQH A;  2LGK A;  2KKY A;  1DVP A;  4PTB A;  2KFT A;  4L7X A;  2LGL A;  2ECN A;  4N3W A;  2KGG A;  1WE9 A;  3NG2 A;  3MDB C;  3LVR E;  1DCQ A;  4YBM A;  4ZUX U;  3RTR B;  3O70 A;  2CON A;  2VJE B;  2JMJ A;  4QF2 A;  3L1Z B;  2K1J A;  3O36 A;  2VPG A;  3KQI A;  2K16 A;  3L1X A;  2L43 A;  1RMD A;  1FBV A;  3LQJ A;  2JMD A;  4R8P K;  4C9Z A;  2L0B A;  2M6M A;  4AUQ B;  1JM7 B;  3U5N A;  3JUE A;  2KYU A;  3ZVZ B;  5LKU A;  2VJF A;  4ZQL A;  1HYJ A;  1Z2Q A;  4Z0R A;  4AYC A;  5B76 A;  2I50 A;  2BAY A;  2KR4 A;  4L58 A;  2YQM A;  2VPB A;  1JM7 A;  5G0F A;  3DPL R;  4MVT A;  4GNE A;  2RR4 A;  2CSV A;  5LKX A;  3QZV A;  1E4U A;  3M63 A;  1LDK C;  3O33 A;  4AP4 A;  4UI9 B;  2LQ6 A;  2G45 A;  4A49 A;  2CKL B;  5H9M A;  3HCU A;  4H9D A;  2YRE A;  3KV5 A;  5SVI B;  3LQI A;  1V87 A;  3PHD A;  2RI7 A;  1WEE A;  4Z0O A;  4GNF A;  2FUU A;  2MIQ A;  4FO9 A;  5SVI A;  2OXQ C;  2LV9 A;  2M13 A;  1K2F A;  2D8U A;  4IC3 A;  2IQJ A;  3FAO A;  2YUC A;  3HTK C;  4OGC A;  2MA5 A;  4YBS A;  3I2D A;  2PUY A;  2D8S A;  1Z6U A;  3C5K A;  5H1U A;  2XOZ A;  1HYI A;  2OWA A;  1VD4 A;  2DSM A;  3SHB A;  3HCS A;  2ECG A;  5B79 A;  4YAB A;  5LKZ A;  2Y43 A;  2KWO A;  4B86 C;  3N9P A;  2FFW A;  2NAA A;  4Q6F A;  5SVX A;  3N9L A;  3T6R A;  2XOC A;  2YHO A;  2XB1 A;  4V3L C;  2FSA A;  5D1K B;  3ASL A;  2G6Q A;  1WIL A;  2H0D B;  5B75 A;  2PNX A;  4N4F A;  4NN2 A;  3SOX A;  3N9M A;  3U5P A;  2L75 A;  2RSD A;  4GB0 A;  4FIP A;  3EB6 A;  1IYM A;  5B78 A;  2YW8 A;  2Y1N A;  5DKA A;  4GNG A;  2CRW A;  2KWK A;  4A4B A;  3E2D A;  3U5M A;  1MM3 A;  2E6R A;  2ECT A;  3U5O A;  2H0D A;  3FAN A;  4LLB A;  2LXP C;  2MUM A;  2YU4 A;  5DIN A;  3ZPV 1;  3ZPV E;  4OGE A;  2CSY A;  1Z60 A;  2M3H A;  1BOR A;  2VJE A;  2VPD A;  4BBQ A;  2Y1M A;  2LXH C;  2UZG A;  2LN0 A;  5AIT A;  5LKT A;  2C2V S;  4WA6 A;  2VPE A;  3T7L A;  2AN6 A;  4UP5 A;  2FD4 A;  1MM2 A;  3M99 A;  3H7H A;  2EXU A;  2QIZ A;  2YSM A;  2YVR A;  2LAU A;  2DJA A;  5SVY A;  2L5U A;  5B8D A;  2EA6 A;  5FB0 A;  2FUI A;  5TDW A;  1WEO A;  3ZVY A;  2JMI A;  4S3O B;  2F42 A;  3SUB A;  2KRE A;  2C2L A;  3KNV A;  4S3O C;  2MKE A;  3DDT A;  5TRB A;  3GV4 A;  4A0C D;  2E6S A;  2JUN A;  5J3X A;  3VK6 A;  4QF3 A;  5TDR A;  1XWH A;  3PUQ A;  2CKL A;  2HDP A;  4MSX A;  1LDJ B;  4WZ0 A;  4I7D A;  2KWJ A;  1WEM A;  2MT5 A;  2HYE D;  3SOW A;  5TBN A;  4AVX A;  2F6N A;  4O64 A;  3ZTG A;  3LVQ E;  4CA1 A;  4TKP B;  2IDA A;  4FK5 A;  1MBM A;  4X3G A;  3HCT A;  3M7K A;  2LGG A;  2YSJ A;  4CCG X;  5JG6 A;  2L80 A;  4FJC A;  2K17 A;  1WEN A;  2YQL A;  3PLW A;  5KH9 A;  5FB1 A;  4GND A;  3RPG B;  4O62 A;  2E61 A;  4W4U A;  3RPG C;  3FM8 C;  3LJU X;  2F6J A;  3O34 A;  2G43 A;  3C6W A;  5FEY A;  1VYX A;  5D1L B;  5I3L A;  2XEU A;  1WES A;  2MD8 C;  4BHW A;  4P5O B;  2XOY A; 
#chains in the Genus database with same CATH homology
 4B7Y C;  1X4J A;  2ECJ A;  1WEV A;  2YT5 A;  2MD7 B;  4ZDT A;  3MHH A;  3LRQ A;  2EGP A;  1WEW A;  1ZBD B;  1T1H A;  1JOC A;  4I7C A;  1WEQ A;  2EOD A;  2YHN A;  3GL6 A;  2LRI C;  5G05 B;  2M85 A;  4LJN A;  3O37 A;  2QIC A;  3FL2 A;  2MA6 A;  5FER A;  2K4D A;  2VJF B;  2JRJ A;  3DQV R;  4AYC B;  3V43 A;  5AIU A;  1WFK A;  2CT2 A;  3L11 A;  4I7B A;  2DX8 A;  2VNF A;  3ZNI A;  3IHP A;  1FP0 A;  4IC2 A;  2YUR A;  2CSZ A;  4YAX A;  4V3K C;  2VP7 A;  2KGI A;  5LCW B;  2MNY A;  2KU3 A;  3KV6 A;  2KWN A;  2ZET C;  1WEP A;  3ZYQ A;  4YAT A;  3N9Q A;  1G25 A;  2M1R A;  5KH7 A;  2ECI A;  4XI1 A;  2LDR A;  1VFY A;  2LGV A;  3PUR A;  5TAB A;  5H1V A;  1WGM A;  4LK9 A;  1CHC A;  3MHS A;  5G04 B;  3M62 A;  2MNZ A;  5D1M B;  5C11 A;  1N87 A;  2ECW A;  4YAD A;  4YBT A;  1F62 A;  4WZ2 A;  2KIZ A;  5C13 A;  1X4I A;  5H1T A;  1X4U A;  3EB5 A;  1U6G B;  4R2Y A;  4R7E A;  4F52 B;  3N9N A;  5KH3 A;  4LKA A;  4YC9 A;  2KE1 A;  2YYR A;  1WIM A;  5B77 A;  4WZ3 B;  3O7A A;  4A4C A;  4UP0 A;  2QJ0 A;  3N9O A;  1WEU A;  5EYA F;  4LAD B;  3O35 A;  2ECV A;  3SOU A;  4PPE A;  3LQH A;  2LGK A;  1DVP A;  4PTB A;  2KFT A;  4L7X A;  2LGL A;  2ECN A;  4N3W A;  2KGG A;  1WE9 A;  3NG2 A;  4YBM A;  4ZUX U;  3RTR B;  3O70 A;  2VJE B;  2JMJ A;  4QF2 A;  3L1Z B;  2K1J A;  3O36 A;  2VPG A;  3KQI A;  2K16 A;  3L1X A;  2L43 A;  1RMD A;  1FBV A;  3LQJ A;  2JMD A;  4R8P K;  4C9Z A;  2L0B A;  2M6M A;  4AUQ B;  1JM7 B;  3U5N A;  2KYU A;  3ZVZ B;  5LKU A;  2VJF A;  4ZQL A;  1HYJ A;  1Z2Q A;  4AYC A;  5B76 A;  2I50 A;  2BAY A;  2KR4 A;  4L58 A;  2YQM A;  2VPB A;  1JM7 A;  5G0F A;  3DPL R;  4MVT A;  4GNE A;  5LKX A;  3QZV A;  1E4U A;  3M63 A;  1LDK C;  3O33 A;  4AP4 A;  4UI9 B;  2LQ6 A;  2G45 A;  4A49 A;  2CKL B;  5H9M A;  3HCU A;  2YRE A;  3KV5 A;  3LQI A;  1V87 A;  3PHD A;  2RI7 A;  1WEE A;  4GNF A;  2FUU A;  2MIQ A;  4FO9 A;  2OXQ C;  2LV9 A;  1K2F A;  4IC3 A;  2YUC A;  3HTK C;  2MA5 A;  4YBS A;  3I2D A;  2PUY A;  2D8S A;  1Z6U A;  3C5K A;  5H1U A;  1HYI A;  1VD4 A;  3SHB A;  3HCS A;  2ECG A;  5B79 A;  4YAB A;  5LKZ A;  2Y43 A;  2KWO A;  4B86 C;  3N9P A;  2NAA A;  4Q6F A;  3N9L A;  3T6R A;  2YHO A;  2XB1 A;  4V3L C;  2FSA A;  5D1K B;  3ASL A;  2G6Q A;  1WIL A;  2H0D B;  5B75 A;  2PNX A;  4N4F A;  4NN2 A;  3SOX A;  3N9M A;  3U5P A;  2L75 A;  2RSD A;  4GB0 A;  4FIP A;  3EB6 A;  1IYM A;  5B78 A;  2YW8 A;  2Y1N A;  5DKA A;  4GNG A;  2KWK A;  4A4B A;  3U5M A;  1MM3 A;  2E6R A;  2ECT A;  3U5O A;  2H0D A;  4LLB A;  2LXP C;  2MUM A;  2YU4 A;  5DIN A;  3ZPV 1;  3ZPV E;  2CSY A;  1Z60 A;  2M3H A;  1BOR A;  2VJE A;  2VPD A;  4BBQ A;  2Y1M A;  2LXH C;  2UZG A;  2LN0 A;  5AIT A;  5LKT A;  2C2V S;  4WA6 A;  2VPE A;  3T7L A;  2AN6 A;  4UP5 A;  1MM2 A;  3M99 A;  2YSM A;  2QIZ A;  2L5U A;  5B8D A;  2EA6 A;  5FB0 A;  2FUI A;  5TDW A;  1WEO A;  3ZVY A;  2JMI A;  4S3O B;  2F42 A;  2KRE A;  2C2L A;  3KNV A;  4S3O C;  5TRB A;  3GV4 A;  4A0C D;  2E6S A;  5J3X A;  3VK6 A;  4QF3 A;  5TDR A;  1XWH A;  3PUQ A;  2CKL A;  2HDP A;  4MSX A;  1LDJ B;  4WZ0 A;  4I7D A;  2KWJ A;  1WEM A;  2MT5 A;  2HYE D;  3SOW A;  5TBN A;  4AVX A;  2F6N A;  4O64 A;  3ZTG A;  4CA1 A;  4TKP B;  2IDA A;  4FK5 A;  4X3G A;  3HCT A;  2LGG A;  2YSJ A;  4CCG X;  5JG6 A;  2L80 A;  4FJC A;  2K17 A;  1WEN A;  2YQL A;  5KH9 A;  5FB1 A;  4GND A;  3RPG B;  4W4U A;  3RPG C;  2F6J A;  3O34 A;  2G43 A;  3C6W A;  5FEY A;  1VYX A;  5D1L B;  5I3L A;  2XEU A;  1WES A;  2MD8 C;  4BHW A;  4P5O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...