2KREA

Solution structure of e4b/ufd2a u-box domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
GSHKFAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin conjugation factor E4 B
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kreA01
4GNEA 4I7BA 3ZNIA 4IC2A 4YADA 3LQJA 4LADB 2M85A 2MA5A 5G04B 2CT2A 4GB0A 3C5KA 2D8SA 5C13A 4WA6A 1MM2A 1Z2QA 1BORA 2PUYA 4FO9A 4I7CA 1HYIA 4PPEA 3U5NA 3U5MA 3FL2A 4CA1A 5D1MB 2LQ6A 4GNGA 2KWOA 2CSYA 3O36A 1RMDA 2KFTA 2L75A 5FB1A 2KWJA 2LXPC 2C2VS 3GL6A 2HYED 4YBTA 2RSDA 2VJEB 2YHOA 2M1RA 5AITA 2ZETC 5EYAF 2F42A 3L1XA 4V3KC 2K17A 2YREA 3U5OA 3VK6A 2YHNA 1X4IA 2YSMA 2YYRA 1V87A 2YUCA 1WEOA 4WZ2A 5H1VA 2YSJA 2L0BA 2EGPA 2QJ0A 2MD8C 4TKPB 1VFYA 5B8DA 2KE1A 2ECTA 4C9ZA 5AIUA 5D1LB 3V43A 4V3LC 2MIQA 1WEMA 5LKZA 2QIZA 1X4UA 3N9NA 5I3LA 4QF3A 2Y1MA 1MM3A 2MD7B 4O64A 3ZVYA 2LGGA 2ECIA 3ZTGA 4YATA 3N9LA 1U6GB 2CKLB 2CSZA 2G6QA 2JMJA 3O33A 2YU4A 1WEWA 3KQIA 5LKUA 3ZPVE 4BBQA 3PHDA 1FP0A 2JMDA 2VPGA 3QZVA 1Z60A 3L1ZB 2PNXA 4NN2A 2KU3A 2UZGA 2K1JA 3EB5A 1K2FA 3N9OA 2FUUA 2KGGA 4P5OB 5J3XA 5B78A 3HCUA 2H0DA 4X3GA 1VD4A 1JM7A 2LGKA 4S3OC 3RTRB 2KYUA 4W4UA 4L7XA 2LN0A 1WE9A 4ZDTA 2ECGA 5G05B 4GNDA 2K4DA 5KH7A 5TDWA 4LJNA 1WEPA 4WZ3B 2VPDA 3HTKC 3U5PA 2E6RA 2JMIA 2QICA 2CKLA 4WZ0A 4XI1A 2LGVA 4GNFA 4YABA 2FSAA 3ZYQA 3O70A 3MHHA 4AVXA 2MT5A 4LK9A 4YC9A 3PUQA 4F52B 2F6NA 1XWHA 4I7DA 3O35A 4IC3A 5LKXA 2EA6A 4ZQLA 1JOCA 4UP0A 2H0DB 1JM7B 2M3HA 4YBMA 4QF2A 3M62A 2KGIA 1WEUA 2ECNA 4S3OB 5H1TA 2KWNA 5B75A 1FBVA 4AP4A 5TABA 5FB0A 2FUIA 2L80A 2E6SA 5DINA 2L43A 2Y43A 3ZVZB 2LDRA 4MSXA 3DPLR 4B7YC 5FEYA 2IDAA 4N3WA 3NG2A 2MA6A 2NAAA 3PURA 3T7LA 3MHSA 4UP5A 3M99A 2VPBA 3LQIA 3SHBA 4R8PK 4Q6FA 2EODA 2L5UA 2RI7A 3DQVR 3SOWA 4AYCA 5KH9A 2MNYA 4A4BA 3LRQA 4R2YA 5DKAA 2MNZA 4PTBA 5B77A 1IYMA 1WEVA 5TDRA 1WIMA 2YURA 1DVPA 5TRBA 1WESA 2BAYA 4LKAA 2M6MA 4A4CA 5G0FA 2MUMA 2I50A 2XEUA 2KREA 3RPGC 2C2LA 2VP7A 2HDPA 4YAXA 2JRJA 4AUQB 3O34A 3N9PA 5B76A 2KR4A 5D1KB 4B86C 1HYJA 4BHWA 1G25A 4A0CD 2Y1NA 1CHCA 2LGLA 3HCSA 5H9MA 1E4UA 5TBNA 2KIZA 3HCTA 1WEQA 3N9MA 4FIPA 1ZBDB 2YQMA 4CCGX 3KNVA 2VJFA 1X4JA 3L11A 2XB1A 3GV4A 4UI9B 4AYCB 1WGMA 4R7EA 3N9QA 3IHPA 2YQLA 4ZUXU 3SOXA 5B79A 4N4FA 5JG6A 3O7AA 3SOUA 2ECJA 2ECWA 4YBSA 2K16A 5LCWB 3RPGB 3EB6A 4L58A 4FK5A 1WEEA 1VYXA 2VNFA 1T1HA 1WENA 2AN6A 1Z6UA 1N87A 4FJCA 3KV6A 2LV9A 5FERA 2YT5A 4A49A 3O37A 5KH3A 2YW8A 3KV5A 4LLBA 4MVTA 2F6JA 2KWKA 5LKTA 1LDKC 5H1UA 3LQHA 2OXQC 1F62A 3M63A 3ZPV1 3C6WA 1WFKA 1WILA 2DX8A 2VJFB 2VJEA 5C11A 2G43A 3ASLA 3T6RA 2LXHC 2G45A 2LRIC 3I2DA 2VPEA 2ECVA 1LDJB
chains in the Genus database with same CATH superfamily
4GNEA 4I7BA 3ZNIA 4IC2A 4YADA 3LQJA 4LADB 2M85A 2MA5A 5G04B 2CT2A 4GB0A 3FANA 4H9DA 2JUNA 3C5KA 2RR4A 2D8SA 5C13A 4WA6A 1MM2A 1Z2QA 3LDYA 1BORA 2PUYA 4FO9A 4I7CA 1HYIA 4PPEA 3U5NA 3U5MA 2DJAA 3FL2A 4CA1A 5D1MB 4F1PA 2LQ6A 3DWDA 4GNGA 2KWOA 3O47A 2CSYA 3O36A 1RMDA 2XOCA 2XOZA 2KFTA 2L75A 5FB1A 2KKXA 2KWJA 2LXPC 2C2VS 3GL6A 2HYED 2DSMA 4YBTA 2RSDA 2VJEB 2YHOA 3FEHA 2M1RA 5AITA 2ZETC 5EYAF 2F42A 3L1XA 4V3KC 2K17A 2YREA 3U5OA 3VK6A 3FM8C 2YHNA 1X4IA 2YSMA 3DDTA 2E61A 2YYRA 1V87A 2YUCA 1WEOA 4OGCA 2CRWA 4WZ2A 5H1VA 2YSJA 2L0BA 3LJUX 2EGPA 2QJ0A 2MD8C 4TKPB 1VFYA 5B8DA 2KE1A 2IQJA 2ECTA 4C9ZA 5AIUA 5D1LB 3V43A 4V3LC 2MIQA 1WEMA 5LKZA 2QIZA 1X4UA 3N9NA 5I3LA 4QF3A 2Y1MA 2EGMA 1MM3A 2MD7B 4O64A 3ZVYA 2LGGA 4Z0RA 2B0OE 2ECIA 5SVYA 3ZTGA 4YATA 3N9LA 1U6GB 2CKLB 2CSZA 2G6QA 2JMJA 3O33A 2EXUA 2YU4A 1WEWA 3KQIA 2CRRA 2YVRA 3ZPVE 4BBQA 5LKUA 3PHDA 1FP0A 2JMDA 3PLWA 3Q1DA 2VPGA 3QZVA 1Z60A 3L1ZB 2PNXA 4NN2A 2JM3A 2KU3A 2UZGA 2K1JA 3EB5A 1K2FA 3N9OA 2FUUA 2KGGA 4P5OB 5J3XA 5B78A 3KDEC 3HCUA 2H0DA 4X3GA 1VD4A 1JM7A 2LGKA 4S3OC 3RTRB 2KYUA 4W4UA 4L7XA 2P57A 2LN0A 1WE9A 4ZDTA 2ECGA 1MBMA 5G05B 4GNDA 2K4DA 5KH7A 5TDWA 4LJNA 5SVIA 1WEPA 4WZ3B 2VPDA 3HTKC 3U5PA 2E6RA 2JMIA 2QICA 4QQ4A 2CKLA 4WZ0A 4XI1A 2LGVA 4GNFA 2OWAA 4YABA 2FSAA 3ZYQA 3E2DA 3O70A 3MHHA 4AVXA 2MT5A 2L7PA 4LK9A 4YC9A 3PUQA 4F52B 2F6NA 1XWHA 4I7DA 3O35A 4IC3A 5LKXA 2EA6A 4ZQLA 1JOCA 4UP0A 2H0DB 1JM7B 2M3HA 2XOYA 4YBMA 4QF2A 3M62A 2KGIA 1WEUA 2ECNA 4S3OB 3MDBC 5H1TA 2KWNA 5B75A 1FBVA 4AP4A 5TABA 5FB0A 2FUIA 2L80A 2E6SA 5DINA 2L43A 2Y43A 3ZVZB 2LDRA 4MSXA 5SVIB 2MKEA 3DPLR 4B7YC 5FEYA 2IDAA 4N3WA 3NG2A 2MA6A 2NAAA 3PURA 3T7LA 3MHSA 2LAUA 4UP5A 3M99A 2VPBA 3LQIA 3SHBA 4R8PK 4Q6FA 2EODA 2L5UA 2RI7A 3DQVR 3SOWA 4AYCA 5KH9A 2MNYA 4A4BA 3LRQA 4R2YA 5DKAA 2MNZA 4PTBA 4OGEA 5B77A 2XP0A 1IYMA 1WEVA 5TDRA 1WIMA 2YURA 1DVPA 5TRBA 3LVRE 1WESA 2BAYA 4LKAA 2M6MA 4A4CA 5G0FA 2MUMA 2I50A 2XEUA 2KREA 3RPGC 2C2LA 2D8UA 2VP7A 2HDPA 4YAXA 2JRJA 4AUQB 3O34A 3N9PA 5B76A 2KR4A 5D1KB 4B86C 3FAOA 1HYJA 4BHWA 1G25A 4A0CD 2M13A 2Y1NA 1CHCA 2LGLA 3HCSA 5H9MA 1E4UA 5TBNA 2KIZA 3HCTA 2CONA 1WEQA 3N9MA 4FIPA 1ZBDB 2YQMA 4CCGX 3KNVA 2VJFA 1X4JA 3L11A 2XB1A 3GV4A 4UI9B 4AYCB 1WGMA 4O62A 5SVXA 2CSVA 4R7EA 3N9QA 3IHPA 2YQLA 4ZUXU 3SOXA 5B79A 4N4FA 5JG6A 2FD4A 3O7AA 2FFWA 3SOUA 2ECJA 2ECWA 3LVQE 4YBSA 2K16A 5LCWB 3RPGB 3M7KA 3EB6A 4L58A 3T9KA 4FK5A 1WEEA 3JUEA 1VYXA 5K3QA 2VNFA 1T1HA 1WENA 1DCQA 2AN6A 1Z6UA 1N87A 4FJCA 3KV6A 2LV9A 5FERA 3H7HA 2YT5A 4A49A 3O37A 5KH3A 2YW8A 3KV5A 4LLBA 4MVTA 2F6JA 2KWKA 5LKTA 1LDKC 5H1UA 3LQHA 2OXQC 1F62A 3M63A 3ZPV1 3FJUB 3C6WA 1WFKA 1WILA 2DX8A 2VJFB 3SUBA 2VJEA 5C11A 2G43A 3ASLA 3T6RA 2LXHC 2G45A 2LRIC 2KKYA 3I2DA 4Z0OA 2VPEA 2ECVA 1LDJB
chains in the Genus database with same CATH topology
4GNEA 4I7BA 3ZNIA 4IC2A 4YADA 3LQJA 4LADB 2M85A 2MA5A 5G04B 2CT2A 4GB0A 3C5KA 2D8SA 5C13A 4WA6A 1MM2A 1Z2QA 1BORA 2PUYA 4FO9A 4I7CA 1HYIA 4PPEA 3U5NA 3U5MA 3FL2A 4CA1A 5D1MB 2LQ6A 4GNGA 2KWOA 2CSYA 3O36A 1RMDA 2KFTA 2L75A 5FB1A 2KWJA 2LXPC 2C2VS 3GL6A 2HYED 4YBTA 2RSDA 2VJEB 2YHOA 2M1RA 5AITA 2ZETC 5EYAF 2F42A 3L1XA 4V3KC 2K17A 2YREA 3U5OA 3VK6A 2YHNA 1X4IA 2YSMA 2YYRA 1V87A 2YUCA 1WEOA 4WZ2A 5H1VA 2YSJA 2L0BA 2EGPA 2QJ0A 2MD8C 4TKPB 1VFYA 5B8DA 2KE1A 2ECTA 4C9ZA 5AIUA 5D1LB 3V43A 4V3LC 2MIQA 1WEMA 5LKZA 2QIZA 1X4UA 3N9NA 5I3LA 4QF3A 2Y1MA 1MM3A 2MD7B 4O64A 3ZVYA 2LGGA 2ECIA 3ZTGA 4YATA 3N9LA 1U6GB 2CKLB 2CSZA 2G6QA 2JMJA 3O33A 2YU4A 1WEWA 3KQIA 5LKUA 3ZPVE 4BBQA 3PHDA 1FP0A 2JMDA 2VPGA 3QZVA 1Z60A 3L1ZB 2PNXA 4NN2A 2KU3A 2UZGA 2K1JA 3EB5A 1K2FA 3N9OA 2FUUA 2KGGA 4P5OB 5J3XA 5B78A 3HCUA 2H0DA 4X3GA 1VD4A 1JM7A 2LGKA 4S3OC 3RTRB 2KYUA 4W4UA 4L7XA 2LN0A 1WE9A 4ZDTA 2ECGA 5G05B 4GNDA 2K4DA 5KH7A 5TDWA 4LJNA 1WEPA 4WZ3B 2VPDA 3HTKC 3U5PA 2E6RA 2JMIA 2QICA 2CKLA 4WZ0A 4XI1A 2LGVA 4GNFA 4YABA 2FSAA 3ZYQA 3O70A 3MHHA 4AVXA 2MT5A 4LK9A 4YC9A 3PUQA 4F52B 2F6NA 1XWHA 4I7DA 3O35A 4IC3A 5LKXA 2EA6A 4ZQLA 1JOCA 4UP0A 2H0DB 1JM7B 2M3HA 4YBMA 4QF2A 3M62A 2KGIA 1WEUA 2ECNA 4S3OB 5H1TA 2KWNA 5B75A 1FBVA 4AP4A 5TABA 5FB0A 2FUIA 2L80A 2E6SA 5DINA 2L43A 2Y43A 3ZVZB 2LDRA 4MSXA 3DPLR 4B7YC 5FEYA 2IDAA 4N3WA 3NG2A 2MA6A 2NAAA 3PURA 3T7LA 3MHSA 4UP5A 3M99A 2VPBA 3LQIA 3SHBA 4R8PK 4Q6FA 2EODA 2L5UA 2RI7A 3DQVR 3SOWA 4AYCA 5KH9A 2MNYA 4A4BA 3LRQA 4R2YA 5DKAA 2MNZA 4PTBA 5B77A 1IYMA 1WEVA 5TDRA 1WIMA 2YURA 1DVPA 5TRBA 1WESA 2BAYA 4LKAA 2M6MA 4A4CA 5G0FA 2MUMA 2I50A 2XEUA 2KREA 3RPGC 2C2LA 2VP7A 2HDPA 4YAXA 2JRJA 4AUQB 3O34A 3N9PA 5B76A 2KR4A 5D1KB 4B86C 1HYJA 4BHWA 1G25A 4A0CD 2Y1NA 1CHCA 2LGLA 3HCSA 5H9MA 1E4UA 5TBNA 2KIZA 3HCTA 1WEQA 3N9MA 4FIPA 1ZBDB 2YQMA 4CCGX 3KNVA 2VJFA 1X4JA 3L11A 2XB1A 3GV4A 4UI9B 4AYCB 1WGMA 4R7EA 3N9QA 3IHPA 2YQLA 4ZUXU 3SOXA 5B79A 4N4FA 5JG6A 3O7AA 3SOUA 2ECJA 2ECWA 4YBSA 2K16A 5LCWB 3RPGB 3EB6A 4L58A 4FK5A 1WEEA 1VYXA 2VNFA 1T1HA 1WENA 2AN6A 1Z6UA 1N87A 4FJCA 3KV6A 2LV9A 5FERA 2YT5A 4A49A 3O37A 5KH3A 2YW8A 3KV5A 4LLBA 4MVTA 2F6JA 2KWKA 5LKTA 1LDKC 5H1UA 3LQHA 2OXQC 1F62A 3M63A 3ZPV1 3C6WA 1WFKA 1WILA 2DX8A 2VJFB 2VJEA 5C11A 2G43A 3ASLA 3T6RA 2LXHC 2G45A 2LRIC 3I2DA 2VPEA 2ECVA 1LDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNE A;  4I7B A;  3ZNI A;  4IC2 A;  4YAD A;  3LQJ A;  4LAD B;  2M85 A;  2MA5 A;  5G04 B;  2CT2 A;  4GB0 A;  3C5K A;  2D8S A;  5C13 A;  4WA6 A;  1MM2 A;  1Z2Q A;  1BOR A;  2PUY A;  4FO9 A;  4I7C A;  1HYI A;  4PPE A;  3U5N A;  3U5M A;  3FL2 A;  4CA1 A;  5D1M B;  2LQ6 A;  4GNG A;  2KWO A;  2CSY A;  3O36 A;  1RMD A;  2KFT A;  2L75 A;  5FB1 A;  2KWJ A;  2LXP C;  2C2V S;  3GL6 A;  2HYE D;  4YBT A;  2RSD A;  2VJE B;  2YHO A;  2M1R A;  5AIT A;  2ZET C;  5EYA F;  2F42 A;  3L1X A;  4V3K C;  2K17 A;  2YRE A;  3U5O A;  3VK6 A;  2YHN A;  1X4I A;  2YSM A;  2YYR A;  1V87 A;  2YUC A;  1WEO A;  4WZ2 A;  5H1V A;  2YSJ A;  2L0B A;  2EGP A;  2QJ0 A;  2MD8 C;  4TKP B;  1VFY A;  5B8D A;  2KE1 A;  2ECT A;  4C9Z A;  5AIU A;  5D1L B;  3V43 A;  4V3L C;  2MIQ A;  1WEM A;  5LKZ A;  2QIZ A;  1X4U A;  3N9N A;  5I3L A;  4QF3 A;  2Y1M A;  1MM3 A;  2MD7 B;  4O64 A;  3ZVY A;  2LGG A;  2ECI A;  3ZTG A;  4YAT A;  3N9L A;  1U6G B;  2CKL B;  2CSZ A;  2G6Q A;  2JMJ A;  3O33 A;  2YU4 A;  1WEW A;  3KQI A;  5LKU A;  3ZPV E;  4BBQ A;  3PHD A;  1FP0 A;  2JMD A;  2VPG A;  3QZV A;  1Z60 A;  3L1Z B;  2PNX A;  4NN2 A;  2KU3 A;  2UZG A;  2K1J A;  3EB5 A;  1K2F A;  3N9O A;  2FUU A;  2KGG A;  4P5O B;  5J3X A;  5B78 A;  3HCU A;  2H0D A;  4X3G A;  1VD4 A;  1JM7 A;  2LGK A;  4S3O C;  3RTR B;  2KYU A;  4W4U A;  4L7X A;  2LN0 A;  1WE9 A;  4ZDT A;  2ECG A;  5G05 B;  4GND A;  2K4D A;  5KH7 A;  5TDW A;  4LJN A;  1WEP A;  4WZ3 B;  2VPD A;  3HTK C;  3U5P A;  2E6R A;  2JMI A;  2QIC A;  2CKL A;  4WZ0 A;  4XI1 A;  2LGV A;  4GNF A;  4YAB A;  2FSA A;  3ZYQ A;  3O70 A;  3MHH A;  4AVX A;  2MT5 A;  4LK9 A;  4YC9 A;  3PUQ A;  4F52 B;  2F6N A;  1XWH A;  4I7D A;  3O35 A;  4IC3 A;  5LKX A;  2EA6 A;  4ZQL A;  1JOC A;  4UP0 A;  2H0D B;  1JM7 B;  2M3H A;  4YBM A;  4QF2 A;  3M62 A;  2KGI A;  1WEU A;  2ECN A;  4S3O B;  5H1T A;  2KWN A;  5B75 A;  1FBV A;  4AP4 A;  5TAB A;  5FB0 A;  2FUI A;  2L80 A;  2E6S A;  5DIN A;  2L43 A;  2Y43 A;  3ZVZ B;  2LDR A;  4MSX A;  3DPL R;  4B7Y C;  5FEY A;  2IDA A;  4N3W A;  3NG2 A;  2MA6 A;  2NAA A;  3PUR A;  3T7L A;  3MHS A;  4UP5 A;  3M99 A;  2VPB A;  3LQI A;  3SHB A;  4R8P K;  4Q6F A;  2EOD A;  2L5U A;  2RI7 A;  3DQV R;  3SOW A;  4AYC A;  5KH9 A;  2MNY A;  4A4B A;  3LRQ A;  4R2Y A;  5DKA A;  2MNZ A;  4PTB A;  5B77 A;  1IYM A;  1WEV A;  5TDR A;  1WIM A;  2YUR A;  1DVP A;  5TRB A;  1WES A;  2BAY A;  4LKA A;  2M6M A;  4A4C A;  5G0F A;  2MUM A;  2I50 A;  2XEU A;  2KRE A;  3RPG C;  2C2L A;  2VP7 A;  2HDP A;  4YAX A;  2JRJ A;  4AUQ B;  3O34 A;  3N9P A;  5B76 A;  2KR4 A;  5D1K B;  4B86 C;  1HYJ A;  4BHW A;  1G25 A;  4A0C D;  2Y1N A;  1CHC A;  2LGL A;  3HCS A;  5H9M A;  1E4U A;  5TBN A;  2KIZ A;  3HCT A;  1WEQ A;  3N9M A;  4FIP A;  1ZBD B;  2YQM A;  4CCG X;  3KNV A;  2VJF A;  1X4J A;  3L11 A;  2XB1 A;  3GV4 A;  4UI9 B;  4AYC B;  1WGM A;  4R7E A;  3N9Q A;  3IHP A;  2YQL A;  4ZUX U;  3SOX A;  5B79 A;  4N4F A;  5JG6 A;  3O7A A;  3SOU A;  2ECJ A;  2ECW A;  4YBS A;  2K16 A;  5LCW B;  3RPG B;  3EB6 A;  4L58 A;  4FK5 A;  1WEE A;  1VYX A;  2VNF A;  1T1H A;  1WEN A;  2AN6 A;  1Z6U A;  1N87 A;  4FJC A;  3KV6 A;  2LV9 A;  5FER A;  2YT5 A;  4A49 A;  3O37 A;  5KH3 A;  2YW8 A;  3KV5 A;  4LLB A;  4MVT A;  2F6J A;  2KWK A;  5LKT A;  1LDK C;  5H1U A;  3LQH A;  2OXQ C;  1F62 A;  3M63 A;  3ZPV 1;  3C6W A;  1WFK A;  1WIL A;  2DX8 A;  2VJF B;  2VJE A;  5C11 A;  2G43 A;  3ASL A;  3T6R A;  2LXH C;  2G45 A;  2LRI C;  3I2D A;  2VPE A;  2ECV A;  1LDJ B; 
#chains in the Genus database with same CATH topology
 4GNE A;  4I7B A;  3ZNI A;  4IC2 A;  4YAD A;  3LQJ A;  4LAD B;  2M85 A;  2MA5 A;  5G04 B;  2CT2 A;  4GB0 A;  3FAN A;  4H9D A;  2JUN A;  3C5K A;  2RR4 A;  2D8S A;  5C13 A;  4WA6 A;  1MM2 A;  1Z2Q A;  3LDY A;  1BOR A;  2PUY A;  4FO9 A;  4I7C A;  1HYI A;  4PPE A;  3U5N A;  3U5M A;  2DJA A;  3FL2 A;  4CA1 A;  5D1M B;  4F1P A;  2LQ6 A;  3DWD A;  4GNG A;  2KWO A;  3O47 A;  2CSY A;  3O36 A;  1RMD A;  2XOC A;  2XOZ A;  2KFT A;  2L75 A;  5FB1 A;  2KKX A;  2KWJ A;  2LXP C;  2C2V S;  3GL6 A;  2HYE D;  2DSM A;  4YBT A;  2RSD A;  2VJE B;  2YHO A;  3FEH A;  2M1R A;  5AIT A;  2ZET C;  5EYA F;  2F42 A;  3L1X A;  4V3K C;  2K17 A;  2YRE A;  3U5O A;  3VK6 A;  3FM8 C;  2YHN A;  1X4I A;  2YSM A;  3DDT A;  2E61 A;  2YYR A;  1V87 A;  2YUC A;  1WEO A;  4OGC A;  2CRW A;  4WZ2 A;  5H1V A;  2YSJ A;  2L0B A;  3LJU X;  2EGP A;  2QJ0 A;  2MD8 C;  4TKP B;  1VFY A;  5B8D A;  2KE1 A;  2IQJ A;  2ECT A;  4C9Z A;  5AIU A;  5D1L B;  3V43 A;  4V3L C;  2MIQ A;  1WEM A;  5LKZ A;  2QIZ A;  1X4U A;  3N9N A;  5I3L A;  4QF3 A;  2Y1M A;  2EGM A;  1MM3 A;  2MD7 B;  4O64 A;  3ZVY A;  2LGG A;  4Z0R A;  2B0O E;  2ECI A;  5SVY A;  3ZTG A;  4YAT A;  3N9L A;  1U6G B;  2CKL B;  2CSZ A;  2G6Q A;  2JMJ A;  3O33 A;  2EXU A;  2YU4 A;  1WEW A;  3KQI A;  2CRR A;  2YVR A;  3ZPV E;  4BBQ A;  5LKU A;  3PHD A;  1FP0 A;  2JMD A;  3PLW A;  3Q1D A;  2VPG A;  3QZV A;  1Z60 A;  3L1Z B;  2PNX A;  4NN2 A;  2JM3 A;  2KU3 A;  2UZG A;  2K1J A;  3EB5 A;  1K2F A;  3N9O A;  2FUU A;  2KGG A;  4P5O B;  5J3X A;  5B78 A;  3KDE C;  3HCU A;  2H0D A;  4X3G A;  1VD4 A;  1JM7 A;  2LGK A;  4S3O C;  3RTR B;  2KYU A;  4W4U A;  4L7X A;  2P57 A;  2LN0 A;  1WE9 A;  4ZDT A;  2ECG A;  1MBM A;  5G05 B;  4GND A;  2K4D A;  5KH7 A;  5TDW A;  4LJN A;  5SVI A;  1WEP A;  4WZ3 B;  2VPD A;  3HTK C;  3U5P A;  2E6R A;  2JMI A;  2QIC A;  4QQ4 A;  2CKL A;  4WZ0 A;  4XI1 A;  2LGV A;  4GNF A;  2OWA A;  4YAB A;  2FSA A;  3ZYQ A;  3E2D A;  3O70 A;  3MHH A;  4AVX A;  2MT5 A;  2L7P A;  4LK9 A;  4YC9 A;  3PUQ A;  4F52 B;  2F6N A;  1XWH A;  4I7D A;  3O35 A;  4IC3 A;  5LKX A;  2EA6 A;  4ZQL A;  1JOC A;  4UP0 A;  2H0D B;  1JM7 B;  2M3H A;  2XOY A;  4YBM A;  4QF2 A;  3M62 A;  2KGI A;  1WEU A;  2ECN A;  4S3O B;  3MDB C;  5H1T A;  2KWN A;  5B75 A;  1FBV A;  4AP4 A;  5TAB A;  5FB0 A;  2FUI A;  2L80 A;  2E6S A;  5DIN A;  2L43 A;  2Y43 A;  3ZVZ B;  2LDR A;  4MSX A;  5SVI B;  2MKE A;  3DPL R;  4B7Y C;  5FEY A;  2IDA A;  4N3W A;  3NG2 A;  2MA6 A;  2NAA A;  3PUR A;  3T7L A;  3MHS A;  2LAU A;  4UP5 A;  3M99 A;  2VPB A;  3LQI A;  3SHB A;  4R8P K;  4Q6F A;  2EOD A;  2L5U A;  2RI7 A;  3DQV R;  3SOW A;  4AYC A;  5KH9 A;  2MNY A;  4A4B A;  3LRQ A;  4R2Y A;  5DKA A;  2MNZ A;  4PTB A;  4OGE A;  5B77 A;  2XP0 A;  1IYM A;  1WEV A;  5TDR A;  1WIM A;  2YUR A;  1DVP A;  5TRB A;  3LVR E;  1WES A;  2BAY A;  4LKA A;  2M6M A;  4A4C A;  5G0F A;  2MUM A;  2I50 A;  2XEU A;  2KRE A;  3RPG C;  2C2L A;  2D8U A;  2VP7 A;  2HDP A;  4YAX A;  2JRJ A;  4AUQ B;  3O34 A;  3N9P A;  5B76 A;  2KR4 A;  5D1K B;  4B86 C;  3FAO A;  1HYJ A;  4BHW A;  1G25 A;  4A0C D;  2M13 A;  2Y1N A;  1CHC A;  2LGL A;  3HCS A;  5H9M A;  1E4U A;  5TBN A;  2KIZ A;  3HCT A;  2CON A;  1WEQ A;  3N9M A;  4FIP A;  1ZBD B;  2YQM A;  4CCG X;  3KNV A;  2VJF A;  1X4J A;  3L11 A;  2XB1 A;  3GV4 A;  4UI9 B;  4AYC B;  1WGM A;  4O62 A;  5SVX A;  2CSV A;  4R7E A;  3N9Q A;  3IHP A;  2YQL A;  4ZUX U;  3SOX A;  5B79 A;  4N4F A;  5JG6 A;  2FD4 A;  3O7A A;  2FFW A;  3SOU A;  2ECJ A;  2ECW A;  3LVQ E;  4YBS A;  2K16 A;  5LCW B;  3RPG B;  3M7K A;  3EB6 A;  4L58 A;  3T9K A;  4FK5 A;  1WEE A;  3JUE A;  1VYX A;  5K3Q A;  2VNF A;  1T1H A;  1WEN A;  1DCQ A;  2AN6 A;  1Z6U A;  1N87 A;  4FJC A;  3KV6 A;  2LV9 A;  5FER A;  3H7H A;  2YT5 A;  4A49 A;  3O37 A;  5KH3 A;  2YW8 A;  3KV5 A;  4LLB A;  4MVT A;  2F6J A;  2KWK A;  5LKT A;  1LDK C;  5H1U A;  3LQH A;  2OXQ C;  1F62 A;  3M63 A;  3ZPV 1;  3FJU B;  3C6W A;  1WFK A;  1WIL A;  2DX8 A;  2VJF B;  3SUB A;  2VJE A;  5C11 A;  2G43 A;  3ASL A;  3T6R A;  2LXH C;  2G45 A;  2LRI C;  2KKY A;  3I2D A;  4Z0O A;  2VPE A;  2ECV A;  1LDJ B; 
#chains in the Genus database with same CATH homology
 4GNE A;  4I7B A;  3ZNI A;  4IC2 A;  4YAD A;  3LQJ A;  4LAD B;  2M85 A;  2MA5 A;  5G04 B;  2CT2 A;  4GB0 A;  3C5K A;  2D8S A;  5C13 A;  4WA6 A;  1MM2 A;  1Z2Q A;  1BOR A;  2PUY A;  4FO9 A;  4I7C A;  1HYI A;  4PPE A;  3U5N A;  3U5M A;  3FL2 A;  4CA1 A;  5D1M B;  2LQ6 A;  4GNG A;  2KWO A;  2CSY A;  3O36 A;  1RMD A;  2KFT A;  2L75 A;  5FB1 A;  2KWJ A;  2LXP C;  2C2V S;  3GL6 A;  2HYE D;  4YBT A;  2RSD A;  2VJE B;  2YHO A;  2M1R A;  5AIT A;  2ZET C;  5EYA F;  2F42 A;  3L1X A;  4V3K C;  2K17 A;  2YRE A;  3U5O A;  3VK6 A;  2YHN A;  1X4I A;  2YSM A;  2YYR A;  1V87 A;  2YUC A;  1WEO A;  4WZ2 A;  5H1V A;  2YSJ A;  2L0B A;  2EGP A;  2QJ0 A;  2MD8 C;  4TKP B;  1VFY A;  5B8D A;  2KE1 A;  2ECT A;  4C9Z A;  5AIU A;  5D1L B;  3V43 A;  4V3L C;  2MIQ A;  1WEM A;  5LKZ A;  2QIZ A;  1X4U A;  3N9N A;  5I3L A;  4QF3 A;  2Y1M A;  1MM3 A;  2MD7 B;  4O64 A;  3ZVY A;  2LGG A;  2ECI A;  3ZTG A;  4YAT A;  3N9L A;  1U6G B;  2CKL B;  2CSZ A;  2G6Q A;  2JMJ A;  3O33 A;  2YU4 A;  1WEW A;  3KQI A;  5LKU A;  3ZPV E;  4BBQ A;  3PHD A;  1FP0 A;  2JMD A;  2VPG A;  3QZV A;  1Z60 A;  3L1Z B;  2PNX A;  4NN2 A;  2KU3 A;  2UZG A;  2K1J A;  3EB5 A;  1K2F A;  3N9O A;  2FUU A;  2KGG A;  4P5O B;  5J3X A;  5B78 A;  3HCU A;  2H0D A;  4X3G A;  1VD4 A;  1JM7 A;  2LGK A;  4S3O C;  3RTR B;  2KYU A;  4W4U A;  4L7X A;  2LN0 A;  1WE9 A;  4ZDT A;  2ECG A;  5G05 B;  4GND A;  2K4D A;  5KH7 A;  5TDW A;  4LJN A;  1WEP A;  4WZ3 B;  2VPD A;  3HTK C;  3U5P A;  2E6R A;  2JMI A;  2QIC A;  2CKL A;  4WZ0 A;  4XI1 A;  2LGV A;  4GNF A;  4YAB A;  2FSA A;  3ZYQ A;  3O70 A;  3MHH A;  4AVX A;  2MT5 A;  4LK9 A;  4YC9 A;  3PUQ A;  4F52 B;  2F6N A;  1XWH A;  4I7D A;  3O35 A;  4IC3 A;  5LKX A;  2EA6 A;  4ZQL A;  1JOC A;  4UP0 A;  2H0D B;  1JM7 B;  2M3H A;  4YBM A;  4QF2 A;  3M62 A;  2KGI A;  1WEU A;  2ECN A;  4S3O B;  5H1T A;  2KWN A;  5B75 A;  1FBV A;  4AP4 A;  5TAB A;  5FB0 A;  2FUI A;  2L80 A;  2E6S A;  5DIN A;  2L43 A;  2Y43 A;  3ZVZ B;  2LDR A;  4MSX A;  3DPL R;  4B7Y C;  5FEY A;  2IDA A;  4N3W A;  3NG2 A;  2MA6 A;  2NAA A;  3PUR A;  3T7L A;  3MHS A;  4UP5 A;  3M99 A;  2VPB A;  3LQI A;  3SHB A;  4R8P K;  4Q6F A;  2EOD A;  2L5U A;  2RI7 A;  3DQV R;  3SOW A;  4AYC A;  5KH9 A;  2MNY A;  4A4B A;  3LRQ A;  4R2Y A;  5DKA A;  2MNZ A;  4PTB A;  5B77 A;  1IYM A;  1WEV A;  5TDR A;  1WIM A;  2YUR A;  1DVP A;  5TRB A;  1WES A;  2BAY A;  4LKA A;  2M6M A;  4A4C A;  5G0F A;  2MUM A;  2I50 A;  2XEU A;  2KRE A;  3RPG C;  2C2L A;  2VP7 A;  2HDP A;  4YAX A;  2JRJ A;  4AUQ B;  3O34 A;  3N9P A;  5B76 A;  2KR4 A;  5D1K B;  4B86 C;  1HYJ A;  4BHW A;  1G25 A;  4A0C D;  2Y1N A;  1CHC A;  2LGL A;  3HCS A;  5H9M A;  1E4U A;  5TBN A;  2KIZ A;  3HCT A;  1WEQ A;  3N9M A;  4FIP A;  1ZBD B;  2YQM A;  4CCG X;  3KNV A;  2VJF A;  1X4J A;  3L11 A;  2XB1 A;  3GV4 A;  4UI9 B;  4AYC B;  1WGM A;  4R7E A;  3N9Q A;  3IHP A;  2YQL A;  4ZUX U;  3SOX A;  5B79 A;  4N4F A;  5JG6 A;  3O7A A;  3SOU A;  2ECJ A;  2ECW A;  4YBS A;  2K16 A;  5LCW B;  3RPG B;  3EB6 A;  4L58 A;  4FK5 A;  1WEE A;  1VYX A;  2VNF A;  1T1H A;  1WEN A;  2AN6 A;  1Z6U A;  1N87 A;  4FJC A;  3KV6 A;  2LV9 A;  5FER A;  2YT5 A;  4A49 A;  3O37 A;  5KH3 A;  2YW8 A;  3KV5 A;  4LLB A;  4MVT A;  2F6J A;  2KWK A;  5LKT A;  1LDK C;  5H1U A;  3LQH A;  2OXQ C;  1F62 A;  3M63 A;  3ZPV 1;  3C6W A;  1WFK A;  1WIL A;  2DX8 A;  2VJF B;  2VJE A;  5C11 A;  2G43 A;  3ASL A;  3T6R A;  2LXH C;  2G45 A;  2LRI C;  3I2D A;  2VPE A;  2ECV A;  1LDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...