1WENA

Solution structure of phd domain in ing1-like protein bac25079
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inhibitor of growth family, member 4; ING1-like protein
publication title Solution structure of PHD domain in ING1-like protein BAC25079
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 4
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wenA00
2Y43A 4X3GA 3ZVYA 2CSYA 4QF2A 4N3WA 3ASLA 5H1TA 2L43A 1F62A 2I50A 4A0CD 3HCTA 5J3XA 5KH9A 3U5MA 3T6RA 1FBVA 2VPEA 2KR4A 2MNYA 5FB0A 3MHSA 3SOWA 4PTBA 2PNXA 5LKZA 4FO9A 5H1UA 4F52B 5FERA 3KV6A 3U5NA 3C6WA 2KYUA 4R2YA 5C13A 4IC2A 1WEQA 1RMDA 3O7AA 5LKXA 3IHPA 4GNEA 2YUCA 4PPEA 2LRIC 4V3LC 4GB0A 2EGPA 1Z6UA 2LN0A 2Y1MA 3QZVA 2M6MA 2M3HA 5LCWB 3LQIA 4UI9B 2ECNA 1WEUA 1WEMA 3U5OA 2FUUA 4FIPA 2G43A 3MHHA 3KV5A 2JRJA 3NG2A 4TKPB 1X4IA 2ECVA 4CA1A 4C9ZA 2LDRA 5TBNA 3RPGC 2YSMA 3N9NA 3L1ZB 2LQ6A 3M99A 3LRQA 4YABA 2KIZA 4B86C 2MA6A 4AP4A 3L1XA 4AYCB 1WEEA 4A4BA 3O70A 2YHNA 4YC9A 2RSDA 5B78A 3DQVR 2VPGA 3HCSA 5I3LA 2OXQC 2ECWA 2NAAA 4GNFA 4YATA 1JM7B 4A4CA 4GNDA 2LGVA 3SOUA 4LK9A 1LDJB 2ECIA 2UZGA 5B79A 5LKUA 1WFKA 4I7DA 4S3OC 1G25A 5C11A 1Z2QA 2E6RA 2VJFB 3LQJA 1K2FA 1JOCA 4FK5A 4MSXA 2VJEB 2YHOA 4WZ2A 3SHBA 4YAXA 3EB6A 3LQHA 2Y1NA 4N4FA 2ECTA 2F42A 5FB1A 5B75A 1VYXA 3DPLR 2L80A 2MD8C 5D1KB 1HYJA 2L75A 3EB5A 4NN2A 2L0BA 5H9MA 1BORA 3ZTGA 2KGGA 2JMDA 2H0DB 1U6GB 2LXPC 5EYAF 2E6SA 2QIZA 1IYMA 2KWJA 2CSZA 2MUMA 3N9LA 2AN6A 2LXHC 3N9MA 3ZVZB 4R8PK 2MNZA 2CKLB 3U5PA 2DX8A 3PHDA 2VPDA 1WILA 5KH7A 2YYRA 3KQIA 3V43A 2RI7A 2K1JA 2M1RA 1MM3A 1LDKC 1WIMA 4L7XA 2KE1A 2VP7A 2YURA 2ZETC 2HYED 3RTRB 2YSJA 4WZ0A 3O34A 3ZPV1 2MD7B 5B77A 4P5OB 2HDPA 4LKAA 2MA5A 2C2LA 2F6NA 4W4UA 2L5UA 1Z60A 5AITA 2YU4A 5D1LB 2PUYA 4WA6A 2KGIA 1XWHA 3C5KA 3HCUA 2KWOA 3O37A 1CHCA 4MVTA 4YBMA 1HYIA 4ZUXU 2ECJA 2KU3A 1E4UA 2VPBA 5LKTA 4Q6FA 2LGKA 4I7CA 1WGMA 2JMIA 5FEYA 5B76A 1WEVA 2FSAA 2K17A 5D1MB 2D8SA 4LJNA 3ZNIA 2FUIA 1T1HA 3ZYQA 3I2DA 4UP0A 2KFTA 3VK6A 1WEOA 2C2VS 2LGLA 2MIQA 4AYCA 2QICA 1WESA 2YREA 4GNGA 4IC3A 3N9QA 5B8DA 1VFYA 2LGGA 2QJ0A 3SOXA 3O35A 2XEUA 1JM7A 1WEWA 2EA6A 4ZQLA 3RPGB 1X4JA 4O64A 4L58A 3M62A 5DINA 5TDWA 1VD4A 2MT5A 3O36A 5G04B 2EODA 2VNFA 5TRBA 2BAYA 4B7YC 2IDAA 5G05B 3M63A 1WEPA 1WENA 5TABA 3O33A 2F6JA 2G45A 2JMJA 2VJFA 3FL2A 4I7BA 2KWKA 2XB1A 4R7EA 2VJEA 3N9OA 1V87A 2M85A 4V3KC 5JG6A 4AUQB 4WZ3B 3HTKC 3ZPVE 3GV4A 1MM2A 5AIUA 2LV9A 4BHWA 5G0FA 2G6QA 3L11A 5DKAA 2H0DA 2YW8A 5KH3A 5H1VA 4ZDTA 4S3OB 4CCGX 4YBSA 4LADB 1FP0A 2YQLA 4AVXA 4BBQA 3T7LA 3KNVA 3PUQA 2ECGA 1X4UA 2K4DA 2CKLA 4A49A 4UP5A 3PURA 4LLBA 2KWNA 4YBTA 4XI1A 1DVPA 1WE9A 4FJCA 2KREA 4YADA 2CT2A 1ZBDB 5TDRA 2YQMA 4QF3A 3N9PA 2YT5A 2K16A 3GL6A 1N87A
chains in the Genus database with same CATH superfamily
2Y43A 4X3GA 3ZVYA 2CSYA 4QF2A 2E61A 4N3WA 3ASLA 5SVXA 2L43A 5H1TA 1F62A 2I50A 3PLWA 4A0CD 3HCTA 5J3XA 2DJAA 5KH9A 3U5MA 3T6RA 1FBVA 2VPEA 2KR4A 2MNYA 2XOZA 3MHSA 5FB0A 3SOWA 4PTBA 3MDBC 2PNXA 5LKZA 4FO9A 5H1UA 4F52B 3H7HA 5FERA 3KV6A 3U5NA 3C6WA 2KYUA 4R2YA 5C13A 4IC2A 3KDEC 1WEQA 1RMDA 3O7AA 5LKXA 3IHPA 4GNEA 2YUCA 4PPEA 2P57A 2LRIC 4V3LC 4GB0A 3T9KA 2EGPA 1Z6UA 2LN0A 3QZVA 2Y1MA 3O47A 3FAOA 2M6MA 2M3HA 5LCWB 3JUEA 3LQIA 4UI9B 2ECNA 1WEUA 1WEMA 3U5OA 2FUUA 4FIPA 2IQJA 2G43A 3MHHA 3KV5A 2JRJA 3NG2A 4TKPB 1X4IA 2ECVA 4H9DA 4CA1A 4F1PA 4C9ZA 3FANA 2LDRA 5TBNA 3RPGC 2YSMA 3N9NA 3L1ZB 5SVIB 2LQ6A 3M99A 3LRQA 3FJUB 4YABA 2KIZA 4B86C 2MA6A 4AP4A 3L1XA 4AYCB 1WEEA 4A4BA 3E2DA 3O70A 2YHNA 4YC9A 1MBMA 2RSDA 5B78A 3DQVR 2VPGA 3HCSA 4OGEA 5I3LA 2OXQC 2ECWA 2NAAA 4GNFA 4YATA 4O62A 1JM7B 5SVYA 4A4CA 4GNDA 2LGVA 3SOUA 4LK9A 1LDJB 2ECIA 2UZGA 1DCQA 5B79A 5LKUA 2KKXA 1WFKA 4I7DA 4S3OC 2DSMA 1G25A 5C11A 1Z2QA 2E6RA 2CSVA 2LAUA 2VJFB 3M7KA 2XOCA 3LQJA 1K2FA 1JOCA 4FK5A 4MSXA 2VJEB 2YHOA 4WZ2A 3SHBA 4YAXA 3EB6A 3LQHA 2Y1NA 4N4FA 2ECTA 2F42A 5FB1A 5B75A 1VYXA 3DPLR 2L80A 2MD8C 5D1KB 1HYJA 2L75A 3EB5A 4NN2A 2L0BA 5H9MA 1BORA 3ZTGA 2KGGA 2JMDA 2H0DB 1U6GB 2D8UA 2LXPC 5EYAF 2E6SA 2QIZA 1IYMA 2KWJA 2CSZA 2MUMA 3N9LA 4Z0OA 2AN6A 2LXHC 3N9MA 3ZVZB 4R8PK 2L7PA 3LVRE 2MNZA 2CKLB 3U5PA 2DX8A 3PHDA 2VPDA 1WILA 5KH7A 2YYRA 3KQIA 3V43A 2RI7A 2K1JA 2M1RA 1MM3A 3DWDA 1LDKC 1WIMA 4L7XA 2KE1A 2VP7A 2XP0A 2YURA 2ZETC 2HYED 3RTRB 2YSJA 4WZ0A 3O34A 3ZPV1 2KKYA 2MD7B 5B77A 4P5OB 2HDPA 4LKAA 3SUBA 4OGCA 2MA5A 2C2LA 2F6NA 4W4UA 2L5UA 1Z60A 5AITA 2YU4A 3FM8C 5D1LB 2PUYA 4WA6A 2KGIA 1XWHA 3C5KA 3HCUA 2KWOA 3LVQE 3O37A 1CHCA 4MVTA 4YBMA 1HYIA 4ZUXU 2ECJA 2KU3A 1E4UA 2VPBA 5LKTA 4Q6FA 2LGKA 2JUNA 4I7CA 1WGMA 2JMIA 5FEYA 5B76A 3LDYA 1WEVA 2FSAA 2JM3A 2K17A 5D1MB 2D8SA 4LJNA 3ZNIA 2FUIA 1T1HA 3ZYQA 5SVIA 3I2DA 2FD4A 4UP0A 2KFTA 3VK6A 1WEOA 2C2VS 2RR4A 2LGLA 2MIQA 4AYCA 4Z0RA 2QICA 2MKEA 1WESA 2YREA 4GNGA 5K3QA 3LJUX 4IC3A 3N9QA 5B8DA 1VFYA 2LGGA 2QJ0A 3SOXA 3O35A 2XEUA 1JM7A 2CRWA 1WEWA 2EA6A 4ZQLA 2B0OE 3RPGB 1X4JA 4O64A 4L58A 3M62A 5DINA 5TDWA 1VD4A 2MT5A 3O36A 5G04B 2EGMA 2EODA 2VNFA 5TRBA 2BAYA 4B7YC 2IDAA 5G05B 3M63A 1WEPA 2YVRA 1WENA 5TABA 3O33A 2F6JA 2G45A 2JMJA 2VJFA 3FL2A 4I7BA 2KWKA 2XB1A 4R7EA 2VJEA 3N9OA 1V87A 2M85A 4V3KC 2EXUA 5JG6A 4AUQB 4WZ3B 3HTKC 3ZPVE 3GV4A 1MM2A 5AIUA 2LV9A 4BHWA 4QQ4A 5G0FA 2G6QA 3L11A 5DKAA 3DDTA 2CRRA 2H0DA 2YW8A 5KH3A 5H1VA 4ZDTA 4S3OB 2FFWA 2OWAA 4CCGX 4YBSA 4LADB 1FP0A 2YQLA 4AVXA 4BBQA 3T7LA 3KNVA 3PUQA 2CONA 2ECGA 1X4UA 2K4DA 2CKLA 4A49A 4UP5A 3PURA 4LLBA 2KWNA 4YBTA 3FEHA 4XI1A 1DVPA 1WE9A 2XOYA 4FJCA 2KREA 4YADA 2CT2A 1ZBDB 5TDRA 3Q1DA 2YQMA 4QF3A 3N9PA 2M13A 2YT5A 2K16A 3GL6A 1N87A
chains in the Genus database with same CATH topology
2Y43A 4X3GA 3ZVYA 2CSYA 4QF2A 4N3WA 3ASLA 5H1TA 2L43A 1F62A 2I50A 4A0CD 3HCTA 5J3XA 5KH9A 3U5MA 3T6RA 1FBVA 2VPEA 2KR4A 2MNYA 5FB0A 3MHSA 3SOWA 4PTBA 2PNXA 5LKZA 4FO9A 5H1UA 4F52B 5FERA 3KV6A 3U5NA 3C6WA 2KYUA 4R2YA 5C13A 4IC2A 1WEQA 1RMDA 3O7AA 5LKXA 3IHPA 4GNEA 2YUCA 4PPEA 2LRIC 4V3LC 4GB0A 2EGPA 1Z6UA 2LN0A 2Y1MA 3QZVA 2M6MA 2M3HA 5LCWB 3LQIA 4UI9B 2ECNA 1WEUA 1WEMA 3U5OA 2FUUA 4FIPA 2G43A 3MHHA 3KV5A 2JRJA 3NG2A 4TKPB 1X4IA 2ECVA 4CA1A 4C9ZA 2LDRA 5TBNA 3RPGC 2YSMA 3N9NA 3L1ZB 2LQ6A 3M99A 3LRQA 4YABA 2KIZA 4B86C 2MA6A 4AP4A 3L1XA 4AYCB 1WEEA 4A4BA 3O70A 2YHNA 4YC9A 2RSDA 5B78A 3DQVR 2VPGA 3HCSA 5I3LA 2OXQC 2ECWA 2NAAA 4GNFA 4YATA 1JM7B 4A4CA 4GNDA 2LGVA 3SOUA 4LK9A 1LDJB 2ECIA 2UZGA 5B79A 5LKUA 1WFKA 4I7DA 4S3OC 1G25A 5C11A 1Z2QA 2E6RA 2VJFB 3LQJA 1K2FA 1JOCA 4FK5A 4MSXA 2VJEB 2YHOA 4WZ2A 3SHBA 4YAXA 3EB6A 3LQHA 2Y1NA 4N4FA 2ECTA 2F42A 5FB1A 5B75A 1VYXA 3DPLR 2L80A 2MD8C 5D1KB 1HYJA 2L75A 3EB5A 4NN2A 2L0BA 5H9MA 1BORA 3ZTGA 2KGGA 2JMDA 2H0DB 1U6GB 2LXPC 5EYAF 2E6SA 2QIZA 1IYMA 2KWJA 2CSZA 2MUMA 3N9LA 2AN6A 2LXHC 3N9MA 3ZVZB 4R8PK 2MNZA 2CKLB 3U5PA 2DX8A 3PHDA 2VPDA 1WILA 5KH7A 2YYRA 3KQIA 3V43A 2RI7A 2K1JA 2M1RA 1MM3A 1LDKC 1WIMA 4L7XA 2KE1A 2VP7A 2YURA 2ZETC 2HYED 3RTRB 2YSJA 4WZ0A 3O34A 3ZPV1 2MD7B 5B77A 4P5OB 2HDPA 4LKAA 2MA5A 2C2LA 2F6NA 4W4UA 2L5UA 1Z60A 5AITA 2YU4A 5D1LB 2PUYA 4WA6A 2KGIA 1XWHA 3C5KA 3HCUA 2KWOA 3O37A 1CHCA 4MVTA 4YBMA 1HYIA 4ZUXU 2ECJA 2KU3A 1E4UA 2VPBA 5LKTA 4Q6FA 2LGKA 4I7CA 1WGMA 2JMIA 5FEYA 5B76A 1WEVA 2FSAA 2K17A 5D1MB 2D8SA 4LJNA 3ZNIA 2FUIA 1T1HA 3ZYQA 3I2DA 4UP0A 2KFTA 3VK6A 1WEOA 2C2VS 2LGLA 2MIQA 4AYCA 2QICA 1WESA 2YREA 4GNGA 4IC3A 3N9QA 5B8DA 1VFYA 2LGGA 2QJ0A 3SOXA 3O35A 2XEUA 1JM7A 1WEWA 2EA6A 4ZQLA 3RPGB 1X4JA 4O64A 4L58A 3M62A 5DINA 5TDWA 1VD4A 2MT5A 3O36A 5G04B 2EODA 2VNFA 5TRBA 2BAYA 4B7YC 2IDAA 5G05B 3M63A 1WEPA 1WENA 5TABA 3O33A 2F6JA 2G45A 2JMJA 2VJFA 3FL2A 4I7BA 2KWKA 2XB1A 4R7EA 2VJEA 3N9OA 1V87A 2M85A 4V3KC 5JG6A 4AUQB 4WZ3B 3HTKC 3ZPVE 3GV4A 1MM2A 5AIUA 2LV9A 4BHWA 5G0FA 2G6QA 3L11A 5DKAA 2H0DA 2YW8A 5KH3A 5H1VA 4ZDTA 4S3OB 4CCGX 4YBSA 4LADB 1FP0A 2YQLA 4AVXA 4BBQA 3T7LA 3KNVA 3PUQA 2ECGA 1X4UA 2K4DA 2CKLA 4A49A 4UP5A 3PURA 4LLBA 2KWNA 4YBTA 4XI1A 1DVPA 1WE9A 4FJCA 2KREA 4YADA 2CT2A 1ZBDB 5TDRA 2YQMA 4QF3A 3N9PA 2YT5A 2K16A 3GL6A 1N87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y43 A;  4X3G A;  3ZVY A;  2CSY A;  4QF2 A;  4N3W A;  3ASL A;  5H1T A;  2L43 A;  1F62 A;  2I50 A;  4A0C D;  3HCT A;  5J3X A;  5KH9 A;  3U5M A;  3T6R A;  1FBV A;  2VPE A;  2KR4 A;  2MNY A;  5FB0 A;  3MHS A;  3SOW A;  4PTB A;  2PNX A;  5LKZ A;  4FO9 A;  5H1U A;  4F52 B;  5FER A;  3KV6 A;  3U5N A;  3C6W A;  2KYU A;  4R2Y A;  5C13 A;  4IC2 A;  1WEQ A;  1RMD A;  3O7A A;  5LKX A;  3IHP A;  4GNE A;  2YUC A;  4PPE A;  2LRI C;  4V3L C;  4GB0 A;  2EGP A;  1Z6U A;  2LN0 A;  2Y1M A;  3QZV A;  2M6M A;  2M3H A;  5LCW B;  3LQI A;  4UI9 B;  2ECN A;  1WEU A;  1WEM A;  3U5O A;  2FUU A;  4FIP A;  2G43 A;  3MHH A;  3KV5 A;  2JRJ A;  3NG2 A;  4TKP B;  1X4I A;  2ECV A;  4CA1 A;  4C9Z A;  2LDR A;  5TBN A;  3RPG C;  2YSM A;  3N9N A;  3L1Z B;  2LQ6 A;  3M99 A;  3LRQ A;  4YAB A;  2KIZ A;  4B86 C;  2MA6 A;  4AP4 A;  3L1X A;  4AYC B;  1WEE A;  4A4B A;  3O70 A;  2YHN A;  4YC9 A;  2RSD A;  5B78 A;  3DQV R;  2VPG A;  3HCS A;  5I3L A;  2OXQ C;  2ECW A;  2NAA A;  4GNF A;  4YAT A;  1JM7 B;  4A4C A;  4GND A;  2LGV A;  3SOU A;  4LK9 A;  1LDJ B;  2ECI A;  2UZG A;  5B79 A;  5LKU A;  1WFK A;  4I7D A;  4S3O C;  1G25 A;  5C11 A;  1Z2Q A;  2E6R A;  2VJF B;  3LQJ A;  1K2F A;  1JOC A;  4FK5 A;  4MSX A;  2VJE B;  2YHO A;  4WZ2 A;  3SHB A;  4YAX A;  3EB6 A;  3LQH A;  2Y1N A;  4N4F A;  2ECT A;  2F42 A;  5FB1 A;  5B75 A;  1VYX A;  3DPL R;  2L80 A;  2MD8 C;  5D1K B;  1HYJ A;  2L75 A;  3EB5 A;  4NN2 A;  2L0B A;  5H9M A;  1BOR A;  3ZTG A;  2KGG A;  2JMD A;  2H0D B;  1U6G B;  2LXP C;  5EYA F;  2E6S A;  2QIZ A;  1IYM A;  2KWJ A;  2CSZ A;  2MUM A;  3N9L A;  2AN6 A;  2LXH C;  3N9M A;  3ZVZ B;  4R8P K;  2MNZ A;  2CKL B;  3U5P A;  2DX8 A;  3PHD A;  2VPD A;  1WIL A;  5KH7 A;  2YYR A;  3KQI A;  3V43 A;  2RI7 A;  2K1J A;  2M1R A;  1MM3 A;  1LDK C;  1WIM A;  4L7X A;  2KE1 A;  2VP7 A;  2YUR A;  2ZET C;  2HYE D;  3RTR B;  2YSJ A;  4WZ0 A;  3O34 A;  3ZPV 1;  2MD7 B;  5B77 A;  4P5O B;  2HDP A;  4LKA A;  2MA5 A;  2C2L A;  2F6N A;  4W4U A;  2L5U A;  1Z60 A;  5AIT A;  2YU4 A;  5D1L B;  2PUY A;  4WA6 A;  2KGI A;  1XWH A;  3C5K A;  3HCU A;  2KWO A;  3O37 A;  1CHC A;  4MVT A;  4YBM A;  1HYI A;  4ZUX U;  2ECJ A;  2KU3 A;  1E4U A;  2VPB A;  5LKT A;  4Q6F A;  2LGK A;  4I7C A;  1WGM A;  2JMI A;  5FEY A;  5B76 A;  1WEV A;  2FSA A;  2K17 A;  5D1M B;  2D8S A;  4LJN A;  3ZNI A;  2FUI A;  1T1H A;  3ZYQ A;  3I2D A;  4UP0 A;  2KFT A;  3VK6 A;  1WEO A;  2C2V S;  2LGL A;  2MIQ A;  4AYC A;  2QIC A;  1WES A;  2YRE A;  4GNG A;  4IC3 A;  3N9Q A;  5B8D A;  1VFY A;  2LGG A;  2QJ0 A;  3SOX A;  3O35 A;  2XEU A;  1JM7 A;  1WEW A;  2EA6 A;  4ZQL A;  3RPG B;  1X4J A;  4O64 A;  4L58 A;  3M62 A;  5DIN A;  5TDW A;  1VD4 A;  2MT5 A;  3O36 A;  5G04 B;  2EOD A;  2VNF A;  5TRB A;  2BAY A;  4B7Y C;  2IDA A;  5G05 B;  3M63 A;  1WEP A;  1WEN A;  5TAB A;  3O33 A;  2F6J A;  2G45 A;  2JMJ A;  2VJF A;  3FL2 A;  4I7B A;  2KWK A;  2XB1 A;  4R7E A;  2VJE A;  3N9O A;  1V87 A;  2M85 A;  4V3K C;  5JG6 A;  4AUQ B;  4WZ3 B;  3HTK C;  3ZPV E;  3GV4 A;  1MM2 A;  5AIU A;  2LV9 A;  4BHW A;  5G0F A;  2G6Q A;  3L11 A;  5DKA A;  2H0D A;  2YW8 A;  5KH3 A;  5H1V A;  4ZDT A;  4S3O B;  4CCG X;  4YBS A;  4LAD B;  1FP0 A;  2YQL A;  4AVX A;  4BBQ A;  3T7L A;  3KNV A;  3PUQ A;  2ECG A;  1X4U A;  2K4D A;  2CKL A;  4A49 A;  4UP5 A;  3PUR A;  4LLB A;  2KWN A;  4YBT A;  4XI1 A;  1DVP A;  1WE9 A;  4FJC A;  2KRE A;  4YAD A;  2CT2 A;  1ZBD B;  5TDR A;  2YQM A;  4QF3 A;  3N9P A;  2YT5 A;  2K16 A;  3GL6 A;  1N87 A; 
#chains in the Genus database with same CATH topology
 2Y43 A;  4X3G A;  3ZVY A;  2CSY A;  4QF2 A;  2E61 A;  4N3W A;  3ASL A;  5SVX A;  2L43 A;  5H1T A;  1F62 A;  2I50 A;  3PLW A;  4A0C D;  3HCT A;  5J3X A;  2DJA A;  5KH9 A;  3U5M A;  3T6R A;  1FBV A;  2VPE A;  2KR4 A;  2MNY A;  2XOZ A;  3MHS A;  5FB0 A;  3SOW A;  4PTB A;  3MDB C;  2PNX A;  5LKZ A;  4FO9 A;  5H1U A;  4F52 B;  3H7H A;  5FER A;  3KV6 A;  3U5N A;  3C6W A;  2KYU A;  4R2Y A;  5C13 A;  4IC2 A;  3KDE C;  1WEQ A;  1RMD A;  3O7A A;  5LKX A;  3IHP A;  4GNE A;  2YUC A;  4PPE A;  2P57 A;  2LRI C;  4V3L C;  4GB0 A;  3T9K A;  2EGP A;  1Z6U A;  2LN0 A;  3QZV A;  2Y1M A;  3O47 A;  3FAO A;  2M6M A;  2M3H A;  5LCW B;  3JUE A;  3LQI A;  4UI9 B;  2ECN A;  1WEU A;  1WEM A;  3U5O A;  2FUU A;  4FIP A;  2IQJ A;  2G43 A;  3MHH A;  3KV5 A;  2JRJ A;  3NG2 A;  4TKP B;  1X4I A;  2ECV A;  4H9D A;  4CA1 A;  4F1P A;  4C9Z A;  3FAN A;  2LDR A;  5TBN A;  3RPG C;  2YSM A;  3N9N A;  3L1Z B;  5SVI B;  2LQ6 A;  3M99 A;  3LRQ A;  3FJU B;  4YAB A;  2KIZ A;  4B86 C;  2MA6 A;  4AP4 A;  3L1X A;  4AYC B;  1WEE A;  4A4B A;  3E2D A;  3O70 A;  2YHN A;  4YC9 A;  1MBM A;  2RSD A;  5B78 A;  3DQV R;  2VPG A;  3HCS A;  4OGE A;  5I3L A;  2OXQ C;  2ECW A;  2NAA A;  4GNF A;  4YAT A;  4O62 A;  1JM7 B;  5SVY A;  4A4C A;  4GND A;  2LGV A;  3SOU A;  4LK9 A;  1LDJ B;  2ECI A;  2UZG A;  1DCQ A;  5B79 A;  5LKU A;  2KKX A;  1WFK A;  4I7D A;  4S3O C;  2DSM A;  1G25 A;  5C11 A;  1Z2Q A;  2E6R A;  2CSV A;  2LAU A;  2VJF B;  3M7K A;  2XOC A;  3LQJ A;  1K2F A;  1JOC A;  4FK5 A;  4MSX A;  2VJE B;  2YHO A;  4WZ2 A;  3SHB A;  4YAX A;  3EB6 A;  3LQH A;  2Y1N A;  4N4F A;  2ECT A;  2F42 A;  5FB1 A;  5B75 A;  1VYX A;  3DPL R;  2L80 A;  2MD8 C;  5D1K B;  1HYJ A;  2L75 A;  3EB5 A;  4NN2 A;  2L0B A;  5H9M A;  1BOR A;  3ZTG A;  2KGG A;  2JMD A;  2H0D B;  1U6G B;  2D8U A;  2LXP C;  5EYA F;  2E6S A;  2QIZ A;  1IYM A;  2KWJ A;  2CSZ A;  2MUM A;  3N9L A;  4Z0O A;  2AN6 A;  2LXH C;  3N9M A;  3ZVZ B;  4R8P K;  2L7P A;  3LVR E;  2MNZ A;  2CKL B;  3U5P A;  2DX8 A;  3PHD A;  2VPD A;  1WIL A;  5KH7 A;  2YYR A;  3KQI A;  3V43 A;  2RI7 A;  2K1J A;  2M1R A;  1MM3 A;  3DWD A;  1LDK C;  1WIM A;  4L7X A;  2KE1 A;  2VP7 A;  2XP0 A;  2YUR A;  2ZET C;  2HYE D;  3RTR B;  2YSJ A;  4WZ0 A;  3O34 A;  3ZPV 1;  2KKY A;  2MD7 B;  5B77 A;  4P5O B;  2HDP A;  4LKA A;  3SUB A;  4OGC A;  2MA5 A;  2C2L A;  2F6N A;  4W4U A;  2L5U A;  1Z60 A;  5AIT A;  2YU4 A;  3FM8 C;  5D1L B;  2PUY A;  4WA6 A;  2KGI A;  1XWH A;  3C5K A;  3HCU A;  2KWO A;  3LVQ E;  3O37 A;  1CHC A;  4MVT A;  4YBM A;  1HYI A;  4ZUX U;  2ECJ A;  2KU3 A;  1E4U A;  2VPB A;  5LKT A;  4Q6F A;  2LGK A;  2JUN A;  4I7C A;  1WGM A;  2JMI A;  5FEY A;  5B76 A;  3LDY A;  1WEV A;  2FSA A;  2JM3 A;  2K17 A;  5D1M B;  2D8S A;  4LJN A;  3ZNI A;  2FUI A;  1T1H A;  3ZYQ A;  5SVI A;  3I2D A;  2FD4 A;  4UP0 A;  2KFT A;  3VK6 A;  1WEO A;  2C2V S;  2RR4 A;  2LGL A;  2MIQ A;  4AYC A;  4Z0R A;  2QIC A;  2MKE A;  1WES A;  2YRE A;  4GNG A;  5K3Q A;  3LJU X;  4IC3 A;  3N9Q A;  5B8D A;  1VFY A;  2LGG A;  2QJ0 A;  3SOX A;  3O35 A;  2XEU A;  1JM7 A;  2CRW A;  1WEW A;  2EA6 A;  4ZQL A;  2B0O E;  3RPG B;  1X4J A;  4O64 A;  4L58 A;  3M62 A;  5DIN A;  5TDW A;  1VD4 A;  2MT5 A;  3O36 A;  5G04 B;  2EGM A;  2EOD A;  2VNF A;  5TRB A;  2BAY A;  4B7Y C;  2IDA A;  5G05 B;  3M63 A;  1WEP A;  2YVR A;  1WEN A;  5TAB A;  3O33 A;  2F6J A;  2G45 A;  2JMJ A;  2VJF A;  3FL2 A;  4I7B A;  2KWK A;  2XB1 A;  4R7E A;  2VJE A;  3N9O A;  1V87 A;  2M85 A;  4V3K C;  2EXU A;  5JG6 A;  4AUQ B;  4WZ3 B;  3HTK C;  3ZPV E;  3GV4 A;  1MM2 A;  5AIU A;  2LV9 A;  4BHW A;  4QQ4 A;  5G0F A;  2G6Q A;  3L11 A;  5DKA A;  3DDT A;  2CRR A;  2H0D A;  2YW8 A;  5KH3 A;  5H1V A;  4ZDT A;  4S3O B;  2FFW A;  2OWA A;  4CCG X;  4YBS A;  4LAD B;  1FP0 A;  2YQL A;  4AVX A;  4BBQ A;  3T7L A;  3KNV A;  3PUQ A;  2CON A;  2ECG A;  1X4U A;  2K4D A;  2CKL A;  4A49 A;  4UP5 A;  3PUR A;  4LLB A;  2KWN A;  4YBT A;  3FEH A;  4XI1 A;  1DVP A;  1WE9 A;  2XOY A;  4FJC A;  2KRE A;  4YAD A;  2CT2 A;  1ZBD B;  5TDR A;  3Q1D A;  2YQM A;  4QF3 A;  3N9P A;  2M13 A;  2YT5 A;  2K16 A;  3GL6 A;  1N87 A; 
#chains in the Genus database with same CATH homology
 2Y43 A;  4X3G A;  3ZVY A;  2CSY A;  4QF2 A;  4N3W A;  3ASL A;  5H1T A;  2L43 A;  1F62 A;  2I50 A;  4A0C D;  3HCT A;  5J3X A;  5KH9 A;  3U5M A;  3T6R A;  1FBV A;  2VPE A;  2KR4 A;  2MNY A;  5FB0 A;  3MHS A;  3SOW A;  4PTB A;  2PNX A;  5LKZ A;  4FO9 A;  5H1U A;  4F52 B;  5FER A;  3KV6 A;  3U5N A;  3C6W A;  2KYU A;  4R2Y A;  5C13 A;  4IC2 A;  1WEQ A;  1RMD A;  3O7A A;  5LKX A;  3IHP A;  4GNE A;  2YUC A;  4PPE A;  2LRI C;  4V3L C;  4GB0 A;  2EGP A;  1Z6U A;  2LN0 A;  2Y1M A;  3QZV A;  2M6M A;  2M3H A;  5LCW B;  3LQI A;  4UI9 B;  2ECN A;  1WEU A;  1WEM A;  3U5O A;  2FUU A;  4FIP A;  2G43 A;  3MHH A;  3KV5 A;  2JRJ A;  3NG2 A;  4TKP B;  1X4I A;  2ECV A;  4CA1 A;  4C9Z A;  2LDR A;  5TBN A;  3RPG C;  2YSM A;  3N9N A;  3L1Z B;  2LQ6 A;  3M99 A;  3LRQ A;  4YAB A;  2KIZ A;  4B86 C;  2MA6 A;  4AP4 A;  3L1X A;  4AYC B;  1WEE A;  4A4B A;  3O70 A;  2YHN A;  4YC9 A;  2RSD A;  5B78 A;  3DQV R;  2VPG A;  3HCS A;  5I3L A;  2OXQ C;  2ECW A;  2NAA A;  4GNF A;  4YAT A;  1JM7 B;  4A4C A;  4GND A;  2LGV A;  3SOU A;  4LK9 A;  1LDJ B;  2ECI A;  2UZG A;  5B79 A;  5LKU A;  1WFK A;  4I7D A;  4S3O C;  1G25 A;  5C11 A;  1Z2Q A;  2E6R A;  2VJF B;  3LQJ A;  1K2F A;  1JOC A;  4FK5 A;  4MSX A;  2VJE B;  2YHO A;  4WZ2 A;  3SHB A;  4YAX A;  3EB6 A;  3LQH A;  2Y1N A;  4N4F A;  2ECT A;  2F42 A;  5FB1 A;  5B75 A;  1VYX A;  3DPL R;  2L80 A;  2MD8 C;  5D1K B;  1HYJ A;  2L75 A;  3EB5 A;  4NN2 A;  2L0B A;  5H9M A;  1BOR A;  3ZTG A;  2KGG A;  2JMD A;  2H0D B;  1U6G B;  2LXP C;  5EYA F;  2E6S A;  2QIZ A;  1IYM A;  2KWJ A;  2CSZ A;  2MUM A;  3N9L A;  2AN6 A;  2LXH C;  3N9M A;  3ZVZ B;  4R8P K;  2MNZ A;  2CKL B;  3U5P A;  2DX8 A;  3PHD A;  2VPD A;  1WIL A;  5KH7 A;  2YYR A;  3KQI A;  3V43 A;  2RI7 A;  2K1J A;  2M1R A;  1MM3 A;  1LDK C;  1WIM A;  4L7X A;  2KE1 A;  2VP7 A;  2YUR A;  2ZET C;  2HYE D;  3RTR B;  2YSJ A;  4WZ0 A;  3O34 A;  3ZPV 1;  2MD7 B;  5B77 A;  4P5O B;  2HDP A;  4LKA A;  2MA5 A;  2C2L A;  2F6N A;  4W4U A;  2L5U A;  1Z60 A;  5AIT A;  2YU4 A;  5D1L B;  2PUY A;  4WA6 A;  2KGI A;  1XWH A;  3C5K A;  3HCU A;  2KWO A;  3O37 A;  1CHC A;  4MVT A;  4YBM A;  1HYI A;  4ZUX U;  2ECJ A;  2KU3 A;  1E4U A;  2VPB A;  5LKT A;  4Q6F A;  2LGK A;  4I7C A;  1WGM A;  2JMI A;  5FEY A;  5B76 A;  1WEV A;  2FSA A;  2K17 A;  5D1M B;  2D8S A;  4LJN A;  3ZNI A;  2FUI A;  1T1H A;  3ZYQ A;  3I2D A;  4UP0 A;  2KFT A;  3VK6 A;  1WEO A;  2C2V S;  2LGL A;  2MIQ A;  4AYC A;  2QIC A;  1WES A;  2YRE A;  4GNG A;  4IC3 A;  3N9Q A;  5B8D A;  1VFY A;  2LGG A;  2QJ0 A;  3SOX A;  3O35 A;  2XEU A;  1JM7 A;  1WEW A;  2EA6 A;  4ZQL A;  3RPG B;  1X4J A;  4O64 A;  4L58 A;  3M62 A;  5DIN A;  5TDW A;  1VD4 A;  2MT5 A;  3O36 A;  5G04 B;  2EOD A;  2VNF A;  5TRB A;  2BAY A;  4B7Y C;  2IDA A;  5G05 B;  3M63 A;  1WEP A;  1WEN A;  5TAB A;  3O33 A;  2F6J A;  2G45 A;  2JMJ A;  2VJF A;  3FL2 A;  4I7B A;  2KWK A;  2XB1 A;  4R7E A;  2VJE A;  3N9O A;  1V87 A;  2M85 A;  4V3K C;  5JG6 A;  4AUQ B;  4WZ3 B;  3HTK C;  3ZPV E;  3GV4 A;  1MM2 A;  5AIU A;  2LV9 A;  4BHW A;  5G0F A;  2G6Q A;  3L11 A;  5DKA A;  2H0D A;  2YW8 A;  5KH3 A;  5H1V A;  4ZDT A;  4S3O B;  4CCG X;  4YBS A;  4LAD B;  1FP0 A;  2YQL A;  4AVX A;  4BBQ A;  3T7L A;  3KNV A;  3PUQ A;  2ECG A;  1X4U A;  2K4D A;  2CKL A;  4A49 A;  4UP5 A;  3PUR A;  4LLB A;  2KWN A;  4YBT A;  4XI1 A;  1DVP A;  1WE9 A;  4FJC A;  2KRE A;  4YAD A;  2CT2 A;  1ZBD B;  5TDR A;  2YQM A;  4QF3 A;  3N9P A;  2YT5 A;  2K16 A;  3GL6 A;  1N87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...