1WENA

Solution structure of phd domain in ing1-like protein bac25079
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
b'GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inhibitor of growth family, member 4; ING1-like protein
publication title Solution structure of PHD domain in ING1-like protein BAC25079
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 4
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wenA00
2YU4A 4Q6FA 4BBQA 3N9LA 4I7DA 5B77A 2C2LA 5LCWB 4GNFA 3ZYQA 2K16A 1X4IA 3N9OA 3L1XA 2L0BA 4GNGA 4YC9A 1WEOA 2ECNA 2VP7A 3I2DA 2YHNA 2QJ0A 1X4UA 2JMJA 4FK5A 2CT2A 5J3XA 4AYCB 3O37A 5B76A 3O33A 1ZBDB 5KH7A 5D1MB 2MT5A 2LXHC 2Y1NA 1WENA 2CKLA 2EODA 1VD4A 2HDPA 2XEUA 4GB0A 3L11A 2KGGA 2YT5A 3N9QA 3ZVYA 3PURA 2G45A 2PNXA 3ZNIA 2K1JA 1FBVA 2YSMA 4BHWA 2LGVA 5LKXA 3O7AA 3KQIA 4O64A 2VNFA 1WE9A 4A0CD 5JG6A 1K2FA 5TDRA 3PHDA 2KE1A 4F52B 4W4UA 3V43A 2L5UA 3EB5A 2E6RA 4I7CA 2LV9A 2KGIA 2M1RA 3O35A 1WEEA 2EA6A 2MA5A 3T6RA 4TKPB 3IHPA 3HCTA 1IYMA 2XB1A 1WEQA 1Z2QA 2IDAA 1CHCA 3U5OA 2H0DA 3PUQA 1V87A 2LGKA 4A4BA 5DKAA 4QF2A 2VPDA 5G04B 5LKTA 1N87A 2LXPC 2RI7A 2VPBA 5H1UA 2L75A 3SOXA 5H1VA 2Y43A 4L7XA 4I7BA 1WGMA 5LKUA 5FERA 2NAAA 2VJFB 2JRJA 4MSXA 5FB0A 4ZUXU 2JMIA 2KFTA 4LJNA 1RMDA 5LKZA 4FJCA 3HCSA 4A49A 2L80A 4AP4A 2M85A 4X3GA 4S3OB 1FP0A 3VK6A 1F62A 2FSAA 2ECVA 2YREA 4A4CA 3KV6A 3ASLA 4LK9A 2QIZA 1WEUA 2FUUA 4ZDTA 4YBTA 4S3OC 2VPEA 5DINA 4B7YC 2G6QA 5AITA 2VJEB 1T1HA 3U5MA 1DVPA 1VYXA 2ECTA 2YURA 1JM7B 2ECIA 4R2YA 2OXQC 3O70A 3N9PA 5TRBA 3M63A 4LKAA 2CKLB 4CA1A 2MUMA 4IC3A 1MM3A 5C11A 4XI1A 1Z60A 3SOUA 5KH3A 2QICA 2LQ6A 4UP5A 3O34A 2L43A 3HCUA 5B78A 4IC2A 1G25A 2K17A 2KU3A 3LQHA 2MNYA 3GL6A 2YSJA 3O36A 5H1TA 3LQIA 2KWNA 2KWJA 2M6MA 4V3LC 5FB1A 5G05B 1JOCA 2YYRA 2C2VS 4AUQB 3M99A 4R7EA 1LDJB 2ECJA 4L58A 3DQVR 5AIUA 4YATA 2KWOA 1WEVA 4R8PK 4WA6A 3MHHA 3HTKC 2F6NA 1WEPA 5H9MA 2K4DA 2FUIA 4UP0A 5B75A 1HYJA 2MNZA 4FO9A 2PUYA 2RSDA 2EGPA 2CSYA 4NN2A 1WILA 4LLBA 2KIZA 1Z6UA 1XWHA 5EYAF 3ZTGA 5B79A 3KNVA 3MHSA 2MD7B 4AYCA 2KREA 3ZVZB 2Y1MA 1HYIA 4YAXA 5FEYA 2LN0A 3LRQA 2YHOA 4B86C 3NG2A 4YADA 2E6SA 2JMDA 4YABA 3ZPV1 4LADB 1WFKA 4PTBA 1BORA 3QZVA 2YQLA 4AVXA 4WZ0A 2VJEA 3KV5A 4N4FA 4WZ3B 4MVTA 5TABA 1JM7A 1LDKC 3DPLR 3SHBA 4WZ2A 2LGGA 5KH9A 3U5NA 3T7LA 1VFYA 2I50A 2ECGA 4V3KC 2YQMA 3LQJA 4N3WA 2LRIC 3RPGB 5I3LA 4CCGX 2D8SA 4YBSA 2ZETC 3N9NA 5C13A 2UZGA 3M62A 3RPGC 4PPEA 2F42A 2ECWA 2AN6A 2KWKA 4ZQLA 4UI9B 2MD8C 2G43A 3N9MA 4FIPA 2DX8A 4YBMA 5D1LB 2LDRA 3C5KA 1WEMA 3SOWA 5TBNA 1X4JA 2MIQA 1WESA 1WEWA 5D1KB 2YUCA 3ZPVE 2KYUA 4GNDA 3C6WA 2VPGA 2CSZA 3RTRB 4C9ZA 5B8DA 5TDWA 2H0DB 3U5PA 1MM2A 4QF3A 4GNEA 2LGLA 2M3HA 2YW8A 2VJFA 2BAYA 3FL2A 3GV4A 1E4UA 2HYED 3L1ZB 4P5OB 2KR4A 2F6JA 3EB6A 1U6GB 5G0FA 2MA6A 1WIMA
chains in the Genus database with same CATH superfamily
2YU4A 4Q6FA 4BBQA 3N9LA 4I7DA 5B77A 2C2LA 5LCWB 4GNFA 2RR4A 2E61A 3ZYQA 2K16A 1X4IA 3N9OA 3L1XA 2L0BA 3FEHA 4GNGA 4YC9A 2JM3A 1WEOA 2ECNA 4OGEA 3T9KA 2VP7A 3I2DA 2YHNA 2QJ0A 1X4UA 2JMJA 4FK5A 2CT2A 5J3XA 4AYCB 2CRWA 3O37A 5B76A 3FAOA 3O33A 1ZBDB 5KH7A 5D1MB 2MT5A 2LXHC 2Y1NA 1WENA 2CKLA 2EODA 1VD4A 2HDPA 4H9DA 2XEUA 4GB0A 3L11A 2KGGA 2YT5A 3N9QA 3ZVYA 3PURA 2G45A 2PNXA 3ZNIA 2K1JA 1FBVA 2YSMA 4BHWA 2LGVA 5LKXA 3O7AA 3KQIA 4O64A 2VNFA 3JUEA 1WE9A 4A0CD 5JG6A 1K2FA 5TDRA 3PHDA 2KE1A 4F52B 4W4UA 4F1PA 3V43A 2L5UA 3E2DA 3EB5A 3Q1DA 2E6RA 4I7CA 2LV9A 2KGIA 2M1RA 3O35A 1WEEA 2EA6A 2MA5A 2LAUA 3T6RA 4TKPB 3IHPA 3HCTA 1IYMA 2XB1A 1WEQA 1Z2QA 2IDAA 1CHCA 3U5OA 4O62A 2H0DA 3PUQA 2B0OE 1V87A 2LGKA 4A4BA 5DKAA 2CSVA 4QF2A 2VPDA 5G04B 5LKTA 1N87A 3LVRE 2LXPC 2RI7A 3M7KA 2VPBA 5H1UA 2L75A 3SOXA 5H1VA 2XOZA 2Y43A 3FJUB 2FD4A 4L7XA 2JUNA 4I7BA 2P57A 1WGMA 5LKUA 3LDYA 5FERA 2NAAA 2VJFB 2JRJA 4MSXA 2L7PA 4Z0RA 5FB0A 3SUBA 4ZUXU 4Z0OA 2XOCA 2JMIA 4OGCA 2KFTA 4LJNA 1RMDA 5LKZA 4FJCA 3HCSA 4A49A 2L80A 4AP4A 2M85A 4X3GA 3FM8C 4S3OB 1FP0A 3VK6A 1F62A 2FSAA 2ECVA 2YREA 4A4CA 2DJAA 3KV6A 3ASLA 4LK9A 2QIZA 1WEUA 2FUUA 4ZDTA 4YBTA 4S3OC 2VPEA 5DINA 4B7YC 2G6QA 5AITA 5K3QA 2VJEB 1T1HA 3U5MA 1DVPA 1VYXA 2ECTA 2YURA 1JM7B 2ECIA 4R2YA 2OXQC 3O70A 3N9PA 5TRBA 3LVQE 3M63A 4LKAA 2CKLB 4CA1A 2MUMA 4IC3A 1MM3A 5C11A 4XI1A 2M13A 1Z60A 3SOUA 5KH3A 2QICA 2LQ6A 4UP5A 3O34A 2FFWA 2L43A 3HCUA 5B78A 4IC2A 1G25A 2K17A 2KU3A 3LQHA 2MNYA 3GL6A 2YSJA 3O36A 5H1TA 3LQIA 3MDBC 2KWNA 2KWJA 2M6MA 4V3LC 3DDTA 5FB1A 5G05B 1JOCA 2YYRA 2C2VS 4AUQB 3M99A 4R7EA 1LDJB 2ECJA 4L58A 3DQVR 5AIUA 4YATA 2KWOA 1WEVA 4R8PK 4WA6A 3MHHA 3DWDA 3HTKC 2F6NA 1WEPA 5H9MA 5SVIB 2K4DA 2FUIA 4UP0A 5B75A 1DCQA 1HYJA 2MNZA 3LJUX 4FO9A 2PUYA 2RSDA 2EGPA 2CSYA 2EXUA 4NN2A 5SVXA 1WILA 4LLBA 2KIZA 1Z6UA 1XWHA 5EYAF 3ZTGA 5B79A 3KNVA 3MHSA 2MD7B 4AYCA 2KREA 3KDEC 3ZVZB 2Y1MA 1HYIA 4YAXA 5FEYA 2LN0A 3O47A 3LRQA 2YHOA 4B86C 3NG2A 4YADA 2E6SA 2JMDA 4YABA 3ZPV1 4LADB 1WFKA 4PTBA 1BORA 3QZVA 2YQLA 4AVXA 4WZ0A 2VJEA 3KV5A 4N4FA 4WZ3B 2KKXA 4MVTA 5TABA 5SVYA 1JM7A 1LDKC 3DPLR 3SHBA 4WZ2A 2KKYA 2LGGA 5KH9A 3U5NA 3T7LA 1VFYA 2I50A 2CONA 2ECGA 4V3KC 2YQMA 3LQJA 4N3WA 2LRIC 2DSMA 3RPGB 2XP0A 2EGMA 5I3LA 4CCGX 2D8SA 4YBSA 4QQ4A 2ZETC 3N9NA 5C13A 2XOYA 2OWAA 2UZGA 3M62A 3RPGC 4PPEA 2F42A 2ECWA 2AN6A 2KWKA 4ZQLA 4UI9B 2MD8C 2G43A 3N9MA 4FIPA 2DX8A 4YBMA 5D1LB 2LDRA 3C5KA 2CRRA 2YVRA 1WEMA 3SOWA 5TBNA 3PLWA 1X4JA 2MIQA 1WESA 1WEWA 5D1KB 2YUCA 3ZPVE 2IQJA 2KYUA 4GNDA 3C6WA 2VPGA 2CSZA 3RTRB 4C9ZA 3H7HA 5B8DA 3FANA 5TDWA 2H0DB 1MBMA 3U5PA 1MM2A 4QF3A 4GNEA 2LGLA 2MKEA 2M3HA 2YW8A 2VJFA 5SVIA 2BAYA 3FL2A 3GV4A 1E4UA 2D8UA 2HYED 3L1ZB 4P5OB 2KR4A 2F6JA 3EB6A 1U6GB 5G0FA 2MA6A 1WIMA
chains in the Genus database with same CATH topology
2YU4A 4Q6FA 4BBQA 3N9LA 4I7DA 5B77A 2C2LA 5LCWB 4GNFA 3ZYQA 2K16A 1X4IA 3N9OA 3L1XA 2L0BA 4GNGA 4YC9A 1WEOA 2ECNA 2VP7A 3I2DA 2YHNA 2QJ0A 1X4UA 2JMJA 4FK5A 2CT2A 5J3XA 4AYCB 3O37A 5B76A 3O33A 1ZBDB 5KH7A 5D1MB 2MT5A 2LXHC 2Y1NA 1WENA 2CKLA 2EODA 1VD4A 2HDPA 2XEUA 4GB0A 3L11A 2KGGA 2YT5A 3N9QA 3ZVYA 3PURA 2G45A 2PNXA 3ZNIA 2K1JA 1FBVA 2YSMA 4BHWA 2LGVA 5LKXA 3O7AA 3KQIA 4O64A 2VNFA 1WE9A 4A0CD 5JG6A 1K2FA 5TDRA 3PHDA 2KE1A 4F52B 4W4UA 3V43A 2L5UA 3EB5A 2E6RA 4I7CA 2LV9A 2KGIA 2M1RA 3O35A 1WEEA 2EA6A 2MA5A 3T6RA 4TKPB 3IHPA 3HCTA 1IYMA 2XB1A 1WEQA 1Z2QA 2IDAA 1CHCA 3U5OA 2H0DA 3PUQA 1V87A 2LGKA 4A4BA 5DKAA 4QF2A 2VPDA 5G04B 5LKTA 1N87A 2LXPC 2RI7A 2VPBA 5H1UA 2L75A 3SOXA 5H1VA 2Y43A 4L7XA 4I7BA 1WGMA 5LKUA 5FERA 2NAAA 2VJFB 2JRJA 4MSXA 5FB0A 4ZUXU 2JMIA 2KFTA 4LJNA 1RMDA 5LKZA 4FJCA 3HCSA 4A49A 2L80A 4AP4A 2M85A 4X3GA 4S3OB 1FP0A 3VK6A 1F62A 2FSAA 2ECVA 2YREA 4A4CA 3KV6A 3ASLA 4LK9A 2QIZA 1WEUA 2FUUA 4ZDTA 4YBTA 4S3OC 2VPEA 5DINA 4B7YC 2G6QA 5AITA 2VJEB 1T1HA 3U5MA 1DVPA 1VYXA 2ECTA 2YURA 1JM7B 2ECIA 4R2YA 2OXQC 3O70A 3N9PA 5TRBA 3M63A 4LKAA 2CKLB 4CA1A 2MUMA 4IC3A 1MM3A 5C11A 4XI1A 1Z60A 3SOUA 5KH3A 2QICA 2LQ6A 4UP5A 3O34A 2L43A 3HCUA 5B78A 4IC2A 1G25A 2K17A 2KU3A 3LQHA 2MNYA 3GL6A 2YSJA 3O36A 5H1TA 3LQIA 2KWNA 2KWJA 2M6MA 4V3LC 5FB1A 5G05B 1JOCA 2YYRA 2C2VS 4AUQB 3M99A 4R7EA 1LDJB 2ECJA 4L58A 3DQVR 5AIUA 4YATA 2KWOA 1WEVA 4R8PK 4WA6A 3MHHA 3HTKC 2F6NA 1WEPA 5H9MA 2K4DA 2FUIA 4UP0A 5B75A 1HYJA 2MNZA 4FO9A 2PUYA 2RSDA 2EGPA 2CSYA 4NN2A 1WILA 4LLBA 2KIZA 1Z6UA 1XWHA 5EYAF 3ZTGA 5B79A 3KNVA 3MHSA 2MD7B 4AYCA 2KREA 3ZVZB 2Y1MA 1HYIA 4YAXA 5FEYA 2LN0A 3LRQA 2YHOA 4B86C 3NG2A 4YADA 2E6SA 2JMDA 4YABA 3ZPV1 4LADB 1WFKA 4PTBA 1BORA 3QZVA 2YQLA 4AVXA 4WZ0A 2VJEA 3KV5A 4N4FA 4WZ3B 4MVTA 5TABA 1JM7A 1LDKC 3DPLR 3SHBA 4WZ2A 2LGGA 5KH9A 3U5NA 3T7LA 1VFYA 2I50A 2ECGA 4V3KC 2YQMA 3LQJA 4N3WA 2LRIC 3RPGB 5I3LA 4CCGX 2D8SA 4YBSA 2ZETC 3N9NA 5C13A 2UZGA 3M62A 3RPGC 4PPEA 2F42A 2ECWA 2AN6A 2KWKA 4ZQLA 4UI9B 2MD8C 2G43A 3N9MA 4FIPA 2DX8A 4YBMA 5D1LB 2LDRA 3C5KA 1WEMA 3SOWA 5TBNA 1X4JA 2MIQA 1WESA 1WEWA 5D1KB 2YUCA 3ZPVE 2KYUA 4GNDA 3C6WA 2VPGA 2CSZA 3RTRB 4C9ZA 5B8DA 5TDWA 2H0DB 3U5PA 1MM2A 4QF3A 4GNEA 2LGLA 2M3HA 2YW8A 2VJFA 2BAYA 3FL2A 3GV4A 1E4UA 2HYED 3L1ZB 4P5OB 2KR4A 2F6JA 3EB6A 1U6GB 5G0FA 2MA6A 1WIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU4 A;  4Q6F A;  4BBQ A;  3N9L A;  4I7D A;  5B77 A;  2C2L A;  5LCW B;  4GNF A;  3ZYQ A;  2K16 A;  1X4I A;  3N9O A;  3L1X A;  2L0B A;  4GNG A;  4YC9 A;  1WEO A;  2ECN A;  2VP7 A;  3I2D A;  2YHN A;  2QJ0 A;  1X4U A;  2JMJ A;  4FK5 A;  2CT2 A;  5J3X A;  4AYC B;  3O37 A;  5B76 A;  3O33 A;  1ZBD B;  5KH7 A;  5D1M B;  2MT5 A;  2LXH C;  2Y1N A;  1WEN A;  2CKL A;  2EOD A;  1VD4 A;  2HDP A;  2XEU A;  4GB0 A;  3L11 A;  2KGG A;  2YT5 A;  3N9Q A;  3ZVY A;  3PUR A;  2G45 A;  2PNX A;  3ZNI A;  2K1J A;  1FBV A;  2YSM A;  4BHW A;  2LGV A;  5LKX A;  3O7A A;  3KQI A;  4O64 A;  2VNF A;  1WE9 A;  4A0C D;  5JG6 A;  1K2F A;  5TDR A;  3PHD A;  2KE1 A;  4F52 B;  4W4U A;  3V43 A;  2L5U A;  3EB5 A;  2E6R A;  4I7C A;  2LV9 A;  2KGI A;  2M1R A;  3O35 A;  1WEE A;  2EA6 A;  2MA5 A;  3T6R A;  4TKP B;  3IHP A;  3HCT A;  1IYM A;  2XB1 A;  1WEQ A;  1Z2Q A;  2IDA A;  1CHC A;  3U5O A;  2H0D A;  3PUQ A;  1V87 A;  2LGK A;  4A4B A;  5DKA A;  4QF2 A;  2VPD A;  5G04 B;  5LKT A;  1N87 A;  2LXP C;  2RI7 A;  2VPB A;  5H1U A;  2L75 A;  3SOX A;  5H1V A;  2Y43 A;  4L7X A;  4I7B A;  1WGM A;  5LKU A;  5FER A;  2NAA A;  2VJF B;  2JRJ A;  4MSX A;  5FB0 A;  4ZUX U;  2JMI A;  2KFT A;  4LJN A;  1RMD A;  5LKZ A;  4FJC A;  3HCS A;  4A49 A;  2L80 A;  4AP4 A;  2M85 A;  4X3G A;  4S3O B;  1FP0 A;  3VK6 A;  1F62 A;  2FSA A;  2ECV A;  2YRE A;  4A4C A;  3KV6 A;  3ASL A;  4LK9 A;  2QIZ A;  1WEU A;  2FUU A;  4ZDT A;  4YBT A;  4S3O C;  2VPE A;  5DIN A;  4B7Y C;  2G6Q A;  5AIT A;  2VJE B;  1T1H A;  3U5M A;  1DVP A;  1VYX A;  2ECT A;  2YUR A;  1JM7 B;  2ECI A;  4R2Y A;  2OXQ C;  3O70 A;  3N9P A;  5TRB A;  3M63 A;  4LKA A;  2CKL B;  4CA1 A;  2MUM A;  4IC3 A;  1MM3 A;  5C11 A;  4XI1 A;  1Z60 A;  3SOU A;  5KH3 A;  2QIC A;  2LQ6 A;  4UP5 A;  3O34 A;  2L43 A;  3HCU A;  5B78 A;  4IC2 A;  1G25 A;  2K17 A;  2KU3 A;  3LQH A;  2MNY A;  3GL6 A;  2YSJ A;  3O36 A;  5H1T A;  3LQI A;  2KWN A;  2KWJ A;  2M6M A;  4V3L C;  5FB1 A;  5G05 B;  1JOC A;  2YYR A;  2C2V S;  4AUQ B;  3M99 A;  4R7E A;  1LDJ B;  2ECJ A;  4L58 A;  3DQV R;  5AIU A;  4YAT A;  2KWO A;  1WEV A;  4R8P K;  4WA6 A;  3MHH A;  3HTK C;  2F6N A;  1WEP A;  5H9M A;  2K4D A;  2FUI A;  4UP0 A;  5B75 A;  1HYJ A;  2MNZ A;  4FO9 A;  2PUY A;  2RSD A;  2EGP A;  2CSY A;  4NN2 A;  1WIL A;  4LLB A;  2KIZ A;  1Z6U A;  1XWH A;  5EYA F;  3ZTG A;  5B79 A;  3KNV A;  3MHS A;  2MD7 B;  4AYC A;  2KRE A;  3ZVZ B;  2Y1M A;  1HYI A;  4YAX A;  5FEY A;  2LN0 A;  3LRQ A;  2YHO A;  4B86 C;  3NG2 A;  4YAD A;  2E6S A;  2JMD A;  4YAB A;  3ZPV 1;  4LAD B;  1WFK A;  4PTB A;  1BOR A;  3QZV A;  2YQL A;  4AVX A;  4WZ0 A;  2VJE A;  3KV5 A;  4N4F A;  4WZ3 B;  4MVT A;  5TAB A;  1JM7 A;  1LDK C;  3DPL R;  3SHB A;  4WZ2 A;  2LGG A;  5KH9 A;  3U5N A;  3T7L A;  1VFY A;  2I50 A;  2ECG A;  4V3K C;  2YQM A;  3LQJ A;  4N3W A;  2LRI C;  3RPG B;  5I3L A;  4CCG X;  2D8S A;  4YBS A;  2ZET C;  3N9N A;  5C13 A;  2UZG A;  3M62 A;  3RPG C;  4PPE A;  2F42 A;  2ECW A;  2AN6 A;  2KWK A;  4ZQL A;  4UI9 B;  2MD8 C;  2G43 A;  3N9M A;  4FIP A;  2DX8 A;  4YBM A;  5D1L B;  2LDR A;  3C5K A;  1WEM A;  3SOW A;  5TBN A;  1X4J A;  2MIQ A;  1WES A;  1WEW A;  5D1K B;  2YUC A;  3ZPV E;  2KYU A;  4GND A;  3C6W A;  2VPG A;  2CSZ A;  3RTR B;  4C9Z A;  5B8D A;  5TDW A;  2H0D B;  3U5P A;  1MM2 A;  4QF3 A;  4GNE A;  2LGL A;  2M3H A;  2YW8 A;  2VJF A;  2BAY A;  3FL2 A;  3GV4 A;  1E4U A;  2HYE D;  3L1Z B;  4P5O B;  2KR4 A;  2F6J A;  3EB6 A;  1U6G B;  5G0F A;  2MA6 A;  1WIM A; 
#chains in the Genus database with same CATH topology
 2YU4 A;  4Q6F A;  4BBQ A;  3N9L A;  4I7D A;  5B77 A;  2C2L A;  5LCW B;  4GNF A;  2RR4 A;  2E61 A;  3ZYQ A;  2K16 A;  1X4I A;  3N9O A;  3L1X A;  2L0B A;  3FEH A;  4GNG A;  4YC9 A;  2JM3 A;  1WEO A;  2ECN A;  4OGE A;  3T9K A;  2VP7 A;  3I2D A;  2YHN A;  2QJ0 A;  1X4U A;  2JMJ A;  4FK5 A;  2CT2 A;  5J3X A;  4AYC B;  2CRW A;  3O37 A;  5B76 A;  3FAO A;  3O33 A;  1ZBD B;  5KH7 A;  5D1M B;  2MT5 A;  2LXH C;  2Y1N A;  1WEN A;  2CKL A;  2EOD A;  1VD4 A;  2HDP A;  4H9D A;  2XEU A;  4GB0 A;  3L11 A;  2KGG A;  2YT5 A;  3N9Q A;  3ZVY A;  3PUR A;  2G45 A;  2PNX A;  3ZNI A;  2K1J A;  1FBV A;  2YSM A;  4BHW A;  2LGV A;  5LKX A;  3O7A A;  3KQI A;  4O64 A;  2VNF A;  3JUE A;  1WE9 A;  4A0C D;  5JG6 A;  1K2F A;  5TDR A;  3PHD A;  2KE1 A;  4F52 B;  4W4U A;  4F1P A;  3V43 A;  2L5U A;  3E2D A;  3EB5 A;  3Q1D A;  2E6R A;  4I7C A;  2LV9 A;  2KGI A;  2M1R A;  3O35 A;  1WEE A;  2EA6 A;  2MA5 A;  2LAU A;  3T6R A;  4TKP B;  3IHP A;  3HCT A;  1IYM A;  2XB1 A;  1WEQ A;  1Z2Q A;  2IDA A;  1CHC A;  3U5O A;  4O62 A;  2H0D A;  3PUQ A;  2B0O E;  1V87 A;  2LGK A;  4A4B A;  5DKA A;  2CSV A;  4QF2 A;  2VPD A;  5G04 B;  5LKT A;  1N87 A;  3LVR E;  2LXP C;  2RI7 A;  3M7K A;  2VPB A;  5H1U A;  2L75 A;  3SOX A;  5H1V A;  2XOZ A;  2Y43 A;  3FJU B;  2FD4 A;  4L7X A;  2JUN A;  4I7B A;  2P57 A;  1WGM A;  5LKU A;  3LDY A;  5FER A;  2NAA A;  2VJF B;  2JRJ A;  4MSX A;  2L7P A;  4Z0R A;  5FB0 A;  3SUB A;  4ZUX U;  4Z0O A;  2XOC A;  2JMI A;  4OGC A;  2KFT A;  4LJN A;  1RMD A;  5LKZ A;  4FJC A;  3HCS A;  4A49 A;  2L80 A;  4AP4 A;  2M85 A;  4X3G A;  3FM8 C;  4S3O B;  1FP0 A;  3VK6 A;  1F62 A;  2FSA A;  2ECV A;  2YRE A;  4A4C A;  2DJA A;  3KV6 A;  3ASL A;  4LK9 A;  2QIZ A;  1WEU A;  2FUU A;  4ZDT A;  4YBT A;  4S3O C;  2VPE A;  5DIN A;  4B7Y C;  2G6Q A;  5AIT A;  5K3Q A;  2VJE B;  1T1H A;  3U5M A;  1DVP A;  1VYX A;  2ECT A;  2YUR A;  1JM7 B;  2ECI A;  4R2Y A;  2OXQ C;  3O70 A;  3N9P A;  5TRB A;  3LVQ E;  3M63 A;  4LKA A;  2CKL B;  4CA1 A;  2MUM A;  4IC3 A;  1MM3 A;  5C11 A;  4XI1 A;  2M13 A;  1Z60 A;  3SOU A;  5KH3 A;  2QIC A;  2LQ6 A;  4UP5 A;  3O34 A;  2FFW A;  2L43 A;  3HCU A;  5B78 A;  4IC2 A;  1G25 A;  2K17 A;  2KU3 A;  3LQH A;  2MNY A;  3GL6 A;  2YSJ A;  3O36 A;  5H1T A;  3LQI A;  3MDB C;  2KWN A;  2KWJ A;  2M6M A;  4V3L C;  3DDT A;  5FB1 A;  5G05 B;  1JOC A;  2YYR A;  2C2V S;  4AUQ B;  3M99 A;  4R7E A;  1LDJ B;  2ECJ A;  4L58 A;  3DQV R;  5AIU A;  4YAT A;  2KWO A;  1WEV A;  4R8P K;  4WA6 A;  3MHH A;  3DWD A;  3HTK C;  2F6N A;  1WEP A;  5H9M A;  5SVI B;  2K4D A;  2FUI A;  4UP0 A;  5B75 A;  1DCQ A;  1HYJ A;  2MNZ A;  3LJU X;  4FO9 A;  2PUY A;  2RSD A;  2EGP A;  2CSY A;  2EXU A;  4NN2 A;  5SVX A;  1WIL A;  4LLB A;  2KIZ A;  1Z6U A;  1XWH A;  5EYA F;  3ZTG A;  5B79 A;  3KNV A;  3MHS A;  2MD7 B;  4AYC A;  2KRE A;  3KDE C;  3ZVZ B;  2Y1M A;  1HYI A;  4YAX A;  5FEY A;  2LN0 A;  3O47 A;  3LRQ A;  2YHO A;  4B86 C;  3NG2 A;  4YAD A;  2E6S A;  2JMD A;  4YAB A;  3ZPV 1;  4LAD B;  1WFK A;  4PTB A;  1BOR A;  3QZV A;  2YQL A;  4AVX A;  4WZ0 A;  2VJE A;  3KV5 A;  4N4F A;  4WZ3 B;  2KKX A;  4MVT A;  5TAB A;  5SVY A;  1JM7 A;  1LDK C;  3DPL R;  3SHB A;  4WZ2 A;  2KKY A;  2LGG A;  5KH9 A;  3U5N A;  3T7L A;  1VFY A;  2I50 A;  2CON A;  2ECG A;  4V3K C;  2YQM A;  3LQJ A;  4N3W A;  2LRI C;  2DSM A;  3RPG B;  2XP0 A;  2EGM A;  5I3L A;  4CCG X;  2D8S A;  4YBS A;  4QQ4 A;  2ZET C;  3N9N A;  5C13 A;  2XOY A;  2OWA A;  2UZG A;  3M62 A;  3RPG C;  4PPE A;  2F42 A;  2ECW A;  2AN6 A;  2KWK A;  4ZQL A;  4UI9 B;  2MD8 C;  2G43 A;  3N9M A;  4FIP A;  2DX8 A;  4YBM A;  5D1L B;  2LDR A;  3C5K A;  2CRR A;  2YVR A;  1WEM A;  3SOW A;  5TBN A;  3PLW A;  1X4J A;  2MIQ A;  1WES A;  1WEW A;  5D1K B;  2YUC A;  3ZPV E;  2IQJ A;  2KYU A;  4GND A;  3C6W A;  2VPG A;  2CSZ A;  3RTR B;  4C9Z A;  3H7H A;  5B8D A;  3FAN A;  5TDW A;  2H0D B;  1MBM A;  3U5P A;  1MM2 A;  4QF3 A;  4GNE A;  2LGL A;  2MKE A;  2M3H A;  2YW8 A;  2VJF A;  5SVI A;  2BAY A;  3FL2 A;  3GV4 A;  1E4U A;  2D8U A;  2HYE D;  3L1Z B;  4P5O B;  2KR4 A;  2F6J A;  3EB6 A;  1U6G B;  5G0F A;  2MA6 A;  1WIM A; 
#chains in the Genus database with same CATH homology
 2YU4 A;  4Q6F A;  4BBQ A;  3N9L A;  4I7D A;  5B77 A;  2C2L A;  5LCW B;  4GNF A;  3ZYQ A;  2K16 A;  1X4I A;  3N9O A;  3L1X A;  2L0B A;  4GNG A;  4YC9 A;  1WEO A;  2ECN A;  2VP7 A;  3I2D A;  2YHN A;  2QJ0 A;  1X4U A;  2JMJ A;  4FK5 A;  2CT2 A;  5J3X A;  4AYC B;  3O37 A;  5B76 A;  3O33 A;  1ZBD B;  5KH7 A;  5D1M B;  2MT5 A;  2LXH C;  2Y1N A;  1WEN A;  2CKL A;  2EOD A;  1VD4 A;  2HDP A;  2XEU A;  4GB0 A;  3L11 A;  2KGG A;  2YT5 A;  3N9Q A;  3ZVY A;  3PUR A;  2G45 A;  2PNX A;  3ZNI A;  2K1J A;  1FBV A;  2YSM A;  4BHW A;  2LGV A;  5LKX A;  3O7A A;  3KQI A;  4O64 A;  2VNF A;  1WE9 A;  4A0C D;  5JG6 A;  1K2F A;  5TDR A;  3PHD A;  2KE1 A;  4F52 B;  4W4U A;  3V43 A;  2L5U A;  3EB5 A;  2E6R A;  4I7C A;  2LV9 A;  2KGI A;  2M1R A;  3O35 A;  1WEE A;  2EA6 A;  2MA5 A;  3T6R A;  4TKP B;  3IHP A;  3HCT A;  1IYM A;  2XB1 A;  1WEQ A;  1Z2Q A;  2IDA A;  1CHC A;  3U5O A;  2H0D A;  3PUQ A;  1V87 A;  2LGK A;  4A4B A;  5DKA A;  4QF2 A;  2VPD A;  5G04 B;  5LKT A;  1N87 A;  2LXP C;  2RI7 A;  2VPB A;  5H1U A;  2L75 A;  3SOX A;  5H1V A;  2Y43 A;  4L7X A;  4I7B A;  1WGM A;  5LKU A;  5FER A;  2NAA A;  2VJF B;  2JRJ A;  4MSX A;  5FB0 A;  4ZUX U;  2JMI A;  2KFT A;  4LJN A;  1RMD A;  5LKZ A;  4FJC A;  3HCS A;  4A49 A;  2L80 A;  4AP4 A;  2M85 A;  4X3G A;  4S3O B;  1FP0 A;  3VK6 A;  1F62 A;  2FSA A;  2ECV A;  2YRE A;  4A4C A;  3KV6 A;  3ASL A;  4LK9 A;  2QIZ A;  1WEU A;  2FUU A;  4ZDT A;  4YBT A;  4S3O C;  2VPE A;  5DIN A;  4B7Y C;  2G6Q A;  5AIT A;  2VJE B;  1T1H A;  3U5M A;  1DVP A;  1VYX A;  2ECT A;  2YUR A;  1JM7 B;  2ECI A;  4R2Y A;  2OXQ C;  3O70 A;  3N9P A;  5TRB A;  3M63 A;  4LKA A;  2CKL B;  4CA1 A;  2MUM A;  4IC3 A;  1MM3 A;  5C11 A;  4XI1 A;  1Z60 A;  3SOU A;  5KH3 A;  2QIC A;  2LQ6 A;  4UP5 A;  3O34 A;  2L43 A;  3HCU A;  5B78 A;  4IC2 A;  1G25 A;  2K17 A;  2KU3 A;  3LQH A;  2MNY A;  3GL6 A;  2YSJ A;  3O36 A;  5H1T A;  3LQI A;  2KWN A;  2KWJ A;  2M6M A;  4V3L C;  5FB1 A;  5G05 B;  1JOC A;  2YYR A;  2C2V S;  4AUQ B;  3M99 A;  4R7E A;  1LDJ B;  2ECJ A;  4L58 A;  3DQV R;  5AIU A;  4YAT A;  2KWO A;  1WEV A;  4R8P K;  4WA6 A;  3MHH A;  3HTK C;  2F6N A;  1WEP A;  5H9M A;  2K4D A;  2FUI A;  4UP0 A;  5B75 A;  1HYJ A;  2MNZ A;  4FO9 A;  2PUY A;  2RSD A;  2EGP A;  2CSY A;  4NN2 A;  1WIL A;  4LLB A;  2KIZ A;  1Z6U A;  1XWH A;  5EYA F;  3ZTG A;  5B79 A;  3KNV A;  3MHS A;  2MD7 B;  4AYC A;  2KRE A;  3ZVZ B;  2Y1M A;  1HYI A;  4YAX A;  5FEY A;  2LN0 A;  3LRQ A;  2YHO A;  4B86 C;  3NG2 A;  4YAD A;  2E6S A;  2JMD A;  4YAB A;  3ZPV 1;  4LAD B;  1WFK A;  4PTB A;  1BOR A;  3QZV A;  2YQL A;  4AVX A;  4WZ0 A;  2VJE A;  3KV5 A;  4N4F A;  4WZ3 B;  4MVT A;  5TAB A;  1JM7 A;  1LDK C;  3DPL R;  3SHB A;  4WZ2 A;  2LGG A;  5KH9 A;  3U5N A;  3T7L A;  1VFY A;  2I50 A;  2ECG A;  4V3K C;  2YQM A;  3LQJ A;  4N3W A;  2LRI C;  3RPG B;  5I3L A;  4CCG X;  2D8S A;  4YBS A;  2ZET C;  3N9N A;  5C13 A;  2UZG A;  3M62 A;  3RPG C;  4PPE A;  2F42 A;  2ECW A;  2AN6 A;  2KWK A;  4ZQL A;  4UI9 B;  2MD8 C;  2G43 A;  3N9M A;  4FIP A;  2DX8 A;  4YBM A;  5D1L B;  2LDR A;  3C5K A;  1WEM A;  3SOW A;  5TBN A;  1X4J A;  2MIQ A;  1WES A;  1WEW A;  5D1K B;  2YUC A;  3ZPV E;  2KYU A;  4GND A;  3C6W A;  2VPG A;  2CSZ A;  3RTR B;  4C9Z A;  5B8D A;  5TDW A;  2H0D B;  3U5P A;  1MM2 A;  4QF3 A;  4GNE A;  2LGL A;  2M3H A;  2YW8 A;  2VJF A;  2BAY A;  3FL2 A;  3GV4 A;  1E4U A;  2HYE D;  3L1Z B;  4P5O B;  2KR4 A;  2F6J A;  3EB6 A;  1U6G B;  5G0F A;  2MA6 A;  1WIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...