1WENA

Solution structure of phd domain in ing1-like protein bac25079
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords inhibitor of growth family, member 4; ING1-like protein
publication title Solution structure of PHD domain in ING1-like protein BAC25079
rcsb
source organism Mus musculus
total genus 4
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wenA00
3RPGC 2KE1A 5TDRA 4TKPB 5C13A 3LRQA 5JG6A 2YHOA 4IC2A 4CCGX 3FL2A 4GNGA 4YBSA 2ECJA 2YT5A 3N9LA 3GV4A 2G43A 2CKLB 3PHDA 5J3XA 2LN0A 4C9ZA 2VPGA 3LQJA 3C5KA 2F42A 5G0FA 3O36A 2M6MA 3I2DA 3O70A 1MM3A 3O34A 4X3GA 4GB0A 5B79A 2LGGA 4A4BA 2RI7A 1JM7A 2KREA 5LKUA 2PUYA 3ZPVE 3SOWA 1WEUA 2E6SA 2MA6A 5DKAA 1WEEA 3T6RA 1WEMA 5AITA 2QIZA 4BBQA 2IDAA 1Z2QA 2G45A 1VFYA 2HDPA 2C2LA 5KH9A 2YHNA 1VD4A 2H0DB 3LQIA 5AIUA 2LGVA 3T7LA 2ECTA 3N9OA 1WEWA 3VK6A 2QICA 3LQHA 4O64A 2JMDA 1WGMA 1N87A 4YC9A 1IYMA 2VP7A 4NN2A 1FBVA 1T1HA 5LKTA 2E6RA 3V43A 2MA5A 2MT5A 5D1KB 3RTRB 1XWHA 1Z6UA 2KWJA 4QF2A 1WILA 2VNFA 3N9QA 2KWOA 2M1RA 2M3HA 2LGKA 1V87A 4AP4A 3ASLA 3IHPA 2RSDA 2YW8A 5C11A 2ECVA 2ECNA 4IC3A 2BAYA 2CT2A 2YURA 5H1VA 2YREA 1BORA 1RMDA 4WA6A 1E4UA 4L7XA 2KIZA 4AUQB 4A4CA 2K1JA 5B8DA 5TDWA 2VJEA 4UP0A 1WESA 4LKAA 5H9MA 3L11A 2CKLA 1X4UA 3ZNIA 3HCUA 5FB1A 1HYJA 3O7AA 2KWNA 3EB6A 3PURA 3KNVA 4B7YC 2NAAA 2KR4A 2KFTA 4I7CA 3C6WA 2F6NA 4L58A 2MNZA 2Y43A 5H1TA 4GNFA 3MHHA 4R2YA 1WEVA 4YAXA 4ZDTA 2F6JA 2YU4A 2M85A 4N3WA 1K2FA 3U5OA 2UZGA 4YATA 2MUMA 2YSJA 4MVTA 4GNEA 5FEYA 4FIPA 3NG2A 4LADB 2LGLA 5DINA 2VPBA 1HYIA 1JOCA 3SOUA 5H1UA 4AYCA 2JMIA 4BHWA 2MIQA 3L1XA 2H0DA 2D8SA 1DVPA 2CSYA 3KV5A 2YQMA 1JM7B 2KYUA 3O37A 2YQLA 1G25A 3U5NA 4R7EA 4FO9A 2L75A 5LKXA 3QZVA 2VPDA 1Z60A 2MNYA 2MD8C 5TBNA 4A49A 2FSAA 4YABA 2FUUA 5D1LB 5TRBA 2YSMA 2K17A 2LRIC 3KV6A 2OXQC 4GNDA 4YBMA 5FERA 2VJFA 3N9NA 2FUIA 3SOXA 3HCTA 2ZETC 2KU3A 2XEUA 2YYRA 1MM2A 2XB1A 2QJ0A 3SHBA 2EODA 3M63A 4QF3A 2AN6A 4N4FA 3PUQA 4YADA 2KGIA 2LXHC 1WENA 2LQ6A 4WZ0A 5FB0A 4PPEA 1WEOA 1WIMA 4Q6FA 2LDRA 1F62A 3HCSA 3U5PA 2C2VS 2G6QA 2HYED 2KGGA 3ZTGA 3DPLR 2VJEB 1WEQA 4UI9B 2ECWA 2ECGA 2YUCA 4UP5A 3DQVR 2L0BA 5G04B 2Y1NA 3ZVYA 3ZYQA 4ZQLA 3M62A 1WFKA 1X4JA 4MSXA 2MD7B 4FK5A 2JRJA 3ZPV1 4CA1A 1WEPA 2CSZA 4LJNA 2ECIA 3HTKC 3O33A 1X4IA 4LK9A 4WZ2A 2LV9A 4V3KC 4I7BA 1CHCA 5B75A 1LDJB 5LCWB 1ZBDB 1LDKC 5KH7A 2JMJA 2L5UA 2PNXA 4I7DA 4AYCB 1VYXA 5LKZA 2LXPC 1FP0A 4P5OB 5G05B 4A0CD 2EA6A 4LLBA 2KWKA 4R8PK 2EGPA 4S3OB 3N9MA 3ZVZB 3U5MA 3EB5A 4ZUXU 3M99A 4PTBA 3N9PA 5D1MB 3KQIA 4B86C 5B78A 4S3OC 4AVXA 5B76A 2K4DA 4W4UA 4YBTA 2L80A 1WE9A 2Y1MA 3O35A 2I50A 4F52B 5B77A 4V3LC 1U6GB 5KH3A 2DX8A 2VPEA 3RPGB 2VJFB 2K16A 3MHSA 5TABA 4FJCA 3L1ZB 4WZ3B 5EYAF 2L43A 4XI1A 3GL6A 5I3LA
chains in the Genus database with same CATH superfamily
3RPGC 2KE1A 5TDRA 4TKPB 5C13A 1MBMA 3LRQA 5JG6A 2YHOA 3O47A 4IC2A 4CCGX 3FL2A 4GNGA 4YBSA 2ECJA 4F1PA 3FANA 2YT5A 3N9LA 2EGMA 3GV4A 2G43A 2CKLB 3PHDA 5J3XA 2LN0A 5SVXA 4C9ZA 2VPGA 3LDYA 3LQJA 3C5KA 2F42A 5G0FA 3O36A 2M6MA 3I2DA 3O70A 1MM3A 3O34A 2IQJA 4X3GA 4GB0A 5B79A 2RR4A 2XOYA 2LGGA 4A4BA 2RI7A 1JM7A 2CONA 2KREA 5LKUA 2PUYA 3ZPVE 3MDBC 3SOWA 1WEUA 2E6SA 2MA6A 5DKAA 1WEEA 3T6RA 2FD4A 1WEMA 5AITA 2QIZA 4BBQA 2IDAA 1Z2QA 2G45A 1VFYA 2C2LA 2HDPA 2DJAA 5KH9A 2YHNA 2OWAA 1VD4A 2H0DB 3LQIA 5AIUA 2LGVA 3T7LA 2ECTA 3N9OA 1WEWA 3VK6A 1DCQA 2QICA 3LQHA 4O64A 2CRRA 2JMDA 1WGMA 1N87A 4YC9A 1IYMA 2VP7A 4NN2A 1FBVA 1T1HA 5LKTA 2E6RA 3V43A 2MA5A 2MT5A 5D1KB 3RTRB 1XWHA 1Z6UA 2KWJA 4QF2A 1WILA 2VNFA 3N9QA 2KWOA 2M1RA 2M3HA 2LGKA 1V87A 4AP4A 3ASLA 3IHPA 2RSDA 2YW8A 5C11A 2ECVA 2ECNA 2B0OE 2BAYA 4IC3A 2CT2A 2YURA 5H1VA 2YREA 1BORA 2YVRA 1RMDA 2LAUA 4WA6A 1E4UA 2P57A 4L7XA 2KIZA 3KDEC 4AUQB 4A4CA 2K1JA 5B8DA 5TDWA 2VJEA 4UP0A 1WESA 2M13A 4LKAA 5H9MA 2CRWA 3L11A 2CKLA 2KKXA 1X4UA 3ZNIA 3HCUA 5FB1A 1HYJA 3O7AA 2KWNA 3EB6A 3PURA 4OGCA 3KNVA 4B7YC 2NAAA 2KR4A 2KFTA 4I7CA 3C6WA 3M7KA 2F6NA 4L58A 2MNZA 2Y43A 5H1TA 4GNFA 3SUBA 3MHHA 4R2YA 1WEVA 4YAXA 4ZDTA 2F6JA 2YU4A 2M85A 4N3WA 1K2FA 3U5OA 2UZGA 3E2DA 3Q1DA 4YATA 2EXUA 2MUMA 2YSJA 4MVTA 4GNEA 5FEYA 4FIPA 4OGEA 3NG2A 4LADB 2LGLA 2FFWA 5DINA 2VPBA 1HYIA 4O62A 1JOCA 3DWDA 3SOUA 5H1UA 4AYCA 2JMIA 3FAOA 4BHWA 2MIQA 3L1XA 2D8SA 2H0DA 2JUNA 1DVPA 2CSYA 5SVIB 3KV5A 2YQMA 1JM7B 2DSMA 2KYUA 3O37A 2YQLA 1G25A 3U5NA 4R7EA 4FO9A 2L75A 5LKXA 3QZVA 2VPDA 1Z60A 2MNYA 2MD8C 5TBNA 4A49A 2FSAA 4YABA 2FUUA 5D1LB 5TRBA 2YSMA 2K17A 2LRIC 3KV6A 2OXQC 4GNDA 4YBMA 5FERA 2VJFA 3N9NA 2FUIA 3SOXA 3HCTA 2ZETC 2KU3A 3PLWA 2XEUA 2YYRA 2E61A 1MM2A 2XB1A 3FEHA 2QJ0A 3SHBA 3JUEA 2EODA 4QQ4A 3M63A 3LVQE 4QF3A 4Z0OA 2AN6A 3H7HA 4N4FA 3DDTA 3PUQA 4YADA 2KGIA 2LXHC 1WENA 4H9DA 2LQ6A 4WZ0A 5FB0A 4PPEA 1WEOA 1WIMA 4Q6FA 2LDRA 1F62A 3HCSA 3U5PA 2C2VS 2G6QA 2HYED 3T9KA 2KGGA 4Z0RA 2XOZA 3ZTGA 3DPLR 2CSVA 2VJEB 1WEQA 4UI9B 2ECWA 3LJUX 2ECGA 2YUCA 5SVYA 2JM3A 4UP5A 3DQVR 2L0BA 5G04B 2Y1NA 3ZVYA 3ZYQA 4ZQLA 3M62A 1WFKA 1X4JA 4MSXA 2MD7B 4FK5A 2JRJA 3ZPV1 4CA1A 1WEPA 2XP0A 2KKYA 2CSZA 4LJNA 2ECIA 5SVIA 5K3QA 3HTKC 3O33A 1X4IA 4LK9A 4WZ2A 2LV9A 4V3KC 4I7BA 1CHCA 5B75A 1LDJB 2L7PA 5LCWB 1ZBDB 1LDKC 5KH7A 2JMJA 3FM8C 2L5UA 2PNXA 4I7DA 4AYCB 1VYXA 5LKZA 2LXPC 1FP0A 4P5OB 5G05B 4A0CD 2EA6A 4LLBA 2KWKA 4R8PK 2EGPA 4S3OB 3N9MA 3ZVZB 3U5MA 3EB5A 4ZUXU 3M99A 4PTBA 3N9PA 5D1MB 3KQIA 4B86C 5B78A 4S3OC 4AVXA 5B76A 2K4DA 4W4UA 4YBTA 2MKEA 2L80A 1WE9A 2Y1MA 3O35A 2I50A 3FJUB 4F52B 5B77A 4V3LC 1U6GB 5KH3A 2DX8A 2VPEA 3LVRE 3RPGB 2VJFB 2K16A 3MHSA 5TABA 2XOCA 4FJCA 3L1ZB 4WZ3B 2D8UA 5EYAF 2L43A 4XI1A 3GL6A 5I3LA
chains in the Genus database with same CATH topology
3RPGC 2KE1A 5TDRA 4TKPB 5C13A 3LRQA 5JG6A 2YHOA 4IC2A 4CCGX 3FL2A 4GNGA 4YBSA 2ECJA 2YT5A 3N9LA 3GV4A 2G43A 2CKLB 3PHDA 5J3XA 2LN0A 4C9ZA 2VPGA 3LQJA 3C5KA 2F42A 5G0FA 3O36A 2M6MA 3I2DA 3O70A 1MM3A 3O34A 4X3GA 4GB0A 5B79A 2LGGA 4A4BA 2RI7A 1JM7A 2KREA 5LKUA 2PUYA 3ZPVE 3SOWA 1WEUA 2E6SA 2MA6A 5DKAA 1WEEA 3T6RA 1WEMA 5AITA 2QIZA 4BBQA 2IDAA 1Z2QA 2G45A 1VFYA 2HDPA 2C2LA 5KH9A 2YHNA 1VD4A 2H0DB 3LQIA 5AIUA 2LGVA 3T7LA 2ECTA 3N9OA 1WEWA 3VK6A 2QICA 3LQHA 4O64A 2JMDA 1WGMA 1N87A 4YC9A 1IYMA 2VP7A 4NN2A 1FBVA 1T1HA 5LKTA 2E6RA 3V43A 2MA5A 2MT5A 5D1KB 3RTRB 1XWHA 1Z6UA 2KWJA 4QF2A 1WILA 2VNFA 3N9QA 2KWOA 2M1RA 2M3HA 2LGKA 1V87A 4AP4A 3ASLA 3IHPA 2RSDA 2YW8A 5C11A 2ECVA 2ECNA 4IC3A 2BAYA 2CT2A 2YURA 5H1VA 2YREA 1BORA 1RMDA 4WA6A 1E4UA 4L7XA 2KIZA 4AUQB 4A4CA 2K1JA 5B8DA 5TDWA 2VJEA 4UP0A 1WESA 4LKAA 5H9MA 3L11A 2CKLA 1X4UA 3ZNIA 3HCUA 5FB1A 1HYJA 3O7AA 2KWNA 3EB6A 3PURA 3KNVA 4B7YC 2NAAA 2KR4A 2KFTA 4I7CA 3C6WA 2F6NA 4L58A 2MNZA 2Y43A 5H1TA 4GNFA 3MHHA 4R2YA 1WEVA 4YAXA 4ZDTA 2F6JA 2YU4A 2M85A 4N3WA 1K2FA 3U5OA 2UZGA 4YATA 2MUMA 2YSJA 4MVTA 4GNEA 5FEYA 4FIPA 3NG2A 4LADB 2LGLA 5DINA 2VPBA 1HYIA 1JOCA 3SOUA 5H1UA 4AYCA 2JMIA 4BHWA 2MIQA 3L1XA 2H0DA 2D8SA 1DVPA 2CSYA 3KV5A 2YQMA 1JM7B 2KYUA 3O37A 2YQLA 1G25A 3U5NA 4R7EA 4FO9A 2L75A 5LKXA 3QZVA 2VPDA 1Z60A 2MNYA 2MD8C 5TBNA 4A49A 2FSAA 4YABA 2FUUA 5D1LB 5TRBA 2YSMA 2K17A 2LRIC 3KV6A 2OXQC 4GNDA 4YBMA 5FERA 2VJFA 3N9NA 2FUIA 3SOXA 3HCTA 2ZETC 2KU3A 2XEUA 2YYRA 1MM2A 2XB1A 2QJ0A 3SHBA 2EODA 3M63A 4QF3A 2AN6A 4N4FA 3PUQA 4YADA 2KGIA 2LXHC 1WENA 2LQ6A 4WZ0A 5FB0A 4PPEA 1WEOA 1WIMA 4Q6FA 2LDRA 1F62A 3HCSA 3U5PA 2C2VS 2G6QA 2HYED 2KGGA 3ZTGA 3DPLR 2VJEB 1WEQA 4UI9B 2ECWA 2ECGA 2YUCA 4UP5A 3DQVR 2L0BA 5G04B 2Y1NA 3ZVYA 3ZYQA 4ZQLA 3M62A 1WFKA 1X4JA 4MSXA 2MD7B 4FK5A 2JRJA 3ZPV1 4CA1A 1WEPA 2CSZA 4LJNA 2ECIA 3HTKC 3O33A 1X4IA 4LK9A 4WZ2A 2LV9A 4V3KC 4I7BA 1CHCA 5B75A 1LDJB 5LCWB 1ZBDB 1LDKC 5KH7A 2JMJA 2L5UA 2PNXA 4I7DA 4AYCB 1VYXA 5LKZA 2LXPC 1FP0A 4P5OB 5G05B 4A0CD 2EA6A 4LLBA 2KWKA 4R8PK 2EGPA 4S3OB 3N9MA 3ZVZB 3U5MA 3EB5A 4ZUXU 3M99A 4PTBA 3N9PA 5D1MB 3KQIA 4B86C 5B78A 4S3OC 4AVXA 5B76A 2K4DA 4W4UA 4YBTA 2L80A 1WE9A 2Y1MA 3O35A 2I50A 4F52B 5B77A 4V3LC 1U6GB 5KH3A 2DX8A 2VPEA 3RPGB 2VJFB 2K16A 3MHSA 5TABA 4FJCA 3L1ZB 4WZ3B 5EYAF 2L43A 4XI1A 3GL6A 5I3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPG C;  2KE1 A;  5TDR A;  4TKP B;  5C13 A;  3LRQ A;  5JG6 A;  2YHO A;  4IC2 A;  4CCG X;  3FL2 A;  4GNG A;  4YBS A;  2ECJ A;  2YT5 A;  3N9L A;  3GV4 A;  2G43 A;  2CKL B;  3PHD A;  5J3X A;  2LN0 A;  4C9Z A;  2VPG A;  3LQJ A;  3C5K A;  2F42 A;  5G0F A;  3O36 A;  2M6M A;  3I2D A;  3O70 A;  1MM3 A;  3O34 A;  4X3G A;  4GB0 A;  5B79 A;  2LGG A;  4A4B A;  2RI7 A;  1JM7 A;  2KRE A;  5LKU A;  2PUY A;  3ZPV E;  3SOW A;  1WEU A;  2E6S A;  2MA6 A;  5DKA A;  1WEE A;  3T6R A;  1WEM A;  5AIT A;  2QIZ A;  4BBQ A;  2IDA A;  1Z2Q A;  2G45 A;  1VFY A;  2HDP A;  2C2L A;  5KH9 A;  2YHN A;  1VD4 A;  2H0D B;  3LQI A;  5AIU A;  2LGV A;  3T7L A;  2ECT A;  3N9O A;  1WEW A;  3VK6 A;  2QIC A;  3LQH A;  4O64 A;  2JMD A;  1WGM A;  1N87 A;  4YC9 A;  1IYM A;  2VP7 A;  4NN2 A;  1FBV A;  1T1H A;  5LKT A;  2E6R A;  3V43 A;  2MA5 A;  2MT5 A;  5D1K B;  3RTR B;  1XWH A;  1Z6U A;  2KWJ A;  4QF2 A;  1WIL A;  2VNF A;  3N9Q A;  2KWO A;  2M1R A;  2M3H A;  2LGK A;  1V87 A;  4AP4 A;  3ASL A;  3IHP A;  2RSD A;  2YW8 A;  5C11 A;  2ECV A;  2ECN A;  4IC3 A;  2BAY A;  2CT2 A;  2YUR A;  5H1V A;  2YRE A;  1BOR A;  1RMD A;  4WA6 A;  1E4U A;  4L7X A;  2KIZ A;  4AUQ B;  4A4C A;  2K1J A;  5B8D A;  5TDW A;  2VJE A;  4UP0 A;  1WES A;  4LKA A;  5H9M A;  3L11 A;  2CKL A;  1X4U A;  3ZNI A;  3HCU A;  5FB1 A;  1HYJ A;  3O7A A;  2KWN A;  3EB6 A;  3PUR A;  3KNV A;  4B7Y C;  2NAA A;  2KR4 A;  2KFT A;  4I7C A;  3C6W A;  2F6N A;  4L58 A;  2MNZ A;  2Y43 A;  5H1T A;  4GNF A;  3MHH A;  4R2Y A;  1WEV A;  4YAX A;  4ZDT A;  2F6J A;  2YU4 A;  2M85 A;  4N3W A;  1K2F A;  3U5O A;  2UZG A;  4YAT A;  2MUM A;  2YSJ A;  4MVT A;  4GNE A;  5FEY A;  4FIP A;  3NG2 A;  4LAD B;  2LGL A;  5DIN A;  2VPB A;  1HYI A;  1JOC A;  3SOU A;  5H1U A;  4AYC A;  2JMI A;  4BHW A;  2MIQ A;  3L1X A;  2H0D A;  2D8S A;  1DVP A;  2CSY A;  3KV5 A;  2YQM A;  1JM7 B;  2KYU A;  3O37 A;  2YQL A;  1G25 A;  3U5N A;  4R7E A;  4FO9 A;  2L75 A;  5LKX A;  3QZV A;  2VPD A;  1Z60 A;  2MNY A;  2MD8 C;  5TBN A;  4A49 A;  2FSA A;  4YAB A;  2FUU A;  5D1L B;  5TRB A;  2YSM A;  2K17 A;  2LRI C;  3KV6 A;  2OXQ C;  4GND A;  4YBM A;  5FER A;  2VJF A;  3N9N A;  2FUI A;  3SOX A;  3HCT A;  2ZET C;  2KU3 A;  2XEU A;  2YYR A;  1MM2 A;  2XB1 A;  2QJ0 A;  3SHB A;  2EOD A;  3M63 A;  4QF3 A;  2AN6 A;  4N4F A;  3PUQ A;  4YAD A;  2KGI A;  2LXH C;  1WEN A;  2LQ6 A;  4WZ0 A;  5FB0 A;  4PPE A;  1WEO A;  1WIM A;  4Q6F A;  2LDR A;  1F62 A;  3HCS A;  3U5P A;  2C2V S;  2G6Q A;  2HYE D;  2KGG A;  3ZTG A;  3DPL R;  2VJE B;  1WEQ A;  4UI9 B;  2ECW A;  2ECG A;  2YUC A;  4UP5 A;  3DQV R;  2L0B A;  5G04 B;  2Y1N A;  3ZVY A;  3ZYQ A;  4ZQL A;  3M62 A;  1WFK A;  1X4J A;  4MSX A;  2MD7 B;  4FK5 A;  2JRJ A;  3ZPV 1;  4CA1 A;  1WEP A;  2CSZ A;  4LJN A;  2ECI A;  3HTK C;  3O33 A;  1X4I A;  4LK9 A;  4WZ2 A;  2LV9 A;  4V3K C;  4I7B A;  1CHC A;  5B75 A;  1LDJ B;  5LCW B;  1ZBD B;  1LDK C;  5KH7 A;  2JMJ A;  2L5U A;  2PNX A;  4I7D A;  4AYC B;  1VYX A;  5LKZ A;  2LXP C;  1FP0 A;  4P5O B;  5G05 B;  4A0C D;  2EA6 A;  4LLB A;  2KWK A;  4R8P K;  2EGP A;  4S3O B;  3N9M A;  3ZVZ B;  3U5M A;  3EB5 A;  4ZUX U;  3M99 A;  4PTB A;  3N9P A;  5D1M B;  3KQI A;  4B86 C;  5B78 A;  4S3O C;  4AVX A;  5B76 A;  2K4D A;  4W4U A;  4YBT A;  2L80 A;  1WE9 A;  2Y1M A;  3O35 A;  2I50 A;  4F52 B;  5B77 A;  4V3L C;  1U6G B;  5KH3 A;  2DX8 A;  2VPE A;  3RPG B;  2VJF B;  2K16 A;  3MHS A;  5TAB A;  4FJC A;  3L1Z B;  4WZ3 B;  5EYA F;  2L43 A;  4XI1 A;  3GL6 A;  5I3L A; 
#chains in the Genus database with same CATH topology
 3RPG C;  2KE1 A;  5TDR A;  4TKP B;  5C13 A;  1MBM A;  3LRQ A;  5JG6 A;  2YHO A;  3O47 A;  4IC2 A;  4CCG X;  3FL2 A;  4GNG A;  4YBS A;  2ECJ A;  4F1P A;  3FAN A;  2YT5 A;  3N9L A;  2EGM A;  3GV4 A;  2G43 A;  2CKL B;  3PHD A;  5J3X A;  2LN0 A;  5SVX A;  4C9Z A;  2VPG A;  3LDY A;  3LQJ A;  3C5K A;  2F42 A;  5G0F A;  3O36 A;  2M6M A;  3I2D A;  3O70 A;  1MM3 A;  3O34 A;  2IQJ A;  4X3G A;  4GB0 A;  5B79 A;  2RR4 A;  2XOY A;  2LGG A;  4A4B A;  2RI7 A;  1JM7 A;  2CON A;  2KRE A;  5LKU A;  2PUY A;  3ZPV E;  3MDB C;  3SOW A;  1WEU A;  2E6S A;  2MA6 A;  5DKA A;  1WEE A;  3T6R A;  2FD4 A;  1WEM A;  5AIT A;  2QIZ A;  4BBQ A;  2IDA A;  1Z2Q A;  2G45 A;  1VFY A;  2C2L A;  2HDP A;  2DJA A;  5KH9 A;  2YHN A;  2OWA A;  1VD4 A;  2H0D B;  3LQI A;  5AIU A;  2LGV A;  3T7L A;  2ECT A;  3N9O A;  1WEW A;  3VK6 A;  1DCQ A;  2QIC A;  3LQH A;  4O64 A;  2CRR A;  2JMD A;  1WGM A;  1N87 A;  4YC9 A;  1IYM A;  2VP7 A;  4NN2 A;  1FBV A;  1T1H A;  5LKT A;  2E6R A;  3V43 A;  2MA5 A;  2MT5 A;  5D1K B;  3RTR B;  1XWH A;  1Z6U A;  2KWJ A;  4QF2 A;  1WIL A;  2VNF A;  3N9Q A;  2KWO A;  2M1R A;  2M3H A;  2LGK A;  1V87 A;  4AP4 A;  3ASL A;  3IHP A;  2RSD A;  2YW8 A;  5C11 A;  2ECV A;  2ECN A;  2B0O E;  2BAY A;  4IC3 A;  2CT2 A;  2YUR A;  5H1V A;  2YRE A;  1BOR A;  2YVR A;  1RMD A;  2LAU A;  4WA6 A;  1E4U A;  2P57 A;  4L7X A;  2KIZ A;  3KDE C;  4AUQ B;  4A4C A;  2K1J A;  5B8D A;  5TDW A;  2VJE A;  4UP0 A;  1WES A;  2M13 A;  4LKA A;  5H9M A;  2CRW A;  3L11 A;  2CKL A;  2KKX A;  1X4U A;  3ZNI A;  3HCU A;  5FB1 A;  1HYJ A;  3O7A A;  2KWN A;  3EB6 A;  3PUR A;  4OGC A;  3KNV A;  4B7Y C;  2NAA A;  2KR4 A;  2KFT A;  4I7C A;  3C6W A;  3M7K A;  2F6N A;  4L58 A;  2MNZ A;  2Y43 A;  5H1T A;  4GNF A;  3SUB A;  3MHH A;  4R2Y A;  1WEV A;  4YAX A;  4ZDT A;  2F6J A;  2YU4 A;  2M85 A;  4N3W A;  1K2F A;  3U5O A;  2UZG A;  3E2D A;  3Q1D A;  4YAT A;  2EXU A;  2MUM A;  2YSJ A;  4MVT A;  4GNE A;  5FEY A;  4FIP A;  4OGE A;  3NG2 A;  4LAD B;  2LGL A;  2FFW A;  5DIN A;  2VPB A;  1HYI A;  4O62 A;  1JOC A;  3DWD A;  3SOU A;  5H1U A;  4AYC A;  2JMI A;  3FAO A;  4BHW A;  2MIQ A;  3L1X A;  2D8S A;  2H0D A;  2JUN A;  1DVP A;  2CSY A;  5SVI B;  3KV5 A;  2YQM A;  1JM7 B;  2DSM A;  2KYU A;  3O37 A;  2YQL A;  1G25 A;  3U5N A;  4R7E A;  4FO9 A;  2L75 A;  5LKX A;  3QZV A;  2VPD A;  1Z60 A;  2MNY A;  2MD8 C;  5TBN A;  4A49 A;  2FSA A;  4YAB A;  2FUU A;  5D1L B;  5TRB A;  2YSM A;  2K17 A;  2LRI C;  3KV6 A;  2OXQ C;  4GND A;  4YBM A;  5FER A;  2VJF A;  3N9N A;  2FUI A;  3SOX A;  3HCT A;  2ZET C;  2KU3 A;  3PLW A;  2XEU A;  2YYR A;  2E61 A;  1MM2 A;  2XB1 A;  3FEH A;  2QJ0 A;  3SHB A;  3JUE A;  2EOD A;  4QQ4 A;  3M63 A;  3LVQ E;  4QF3 A;  4Z0O A;  2AN6 A;  3H7H A;  4N4F A;  3DDT A;  3PUQ A;  4YAD A;  2KGI A;  2LXH C;  1WEN A;  4H9D A;  2LQ6 A;  4WZ0 A;  5FB0 A;  4PPE A;  1WEO A;  1WIM A;  4Q6F A;  2LDR A;  1F62 A;  3HCS A;  3U5P A;  2C2V S;  2G6Q A;  2HYE D;  3T9K A;  2KGG A;  4Z0R A;  2XOZ A;  3ZTG A;  3DPL R;  2CSV A;  2VJE B;  1WEQ A;  4UI9 B;  2ECW A;  3LJU X;  2ECG A;  2YUC A;  5SVY A;  2JM3 A;  4UP5 A;  3DQV R;  2L0B A;  5G04 B;  2Y1N A;  3ZVY A;  3ZYQ A;  4ZQL A;  3M62 A;  1WFK A;  1X4J A;  4MSX A;  2MD7 B;  4FK5 A;  2JRJ A;  3ZPV 1;  4CA1 A;  1WEP A;  2XP0 A;  2KKY A;  2CSZ A;  4LJN A;  2ECI A;  5SVI A;  5K3Q A;  3HTK C;  3O33 A;  1X4I A;  4LK9 A;  4WZ2 A;  2LV9 A;  4V3K C;  4I7B A;  1CHC A;  5B75 A;  1LDJ B;  2L7P A;  5LCW B;  1ZBD B;  1LDK C;  5KH7 A;  2JMJ A;  3FM8 C;  2L5U A;  2PNX A;  4I7D A;  4AYC B;  1VYX A;  5LKZ A;  2LXP C;  1FP0 A;  4P5O B;  5G05 B;  4A0C D;  2EA6 A;  4LLB A;  2KWK A;  4R8P K;  2EGP A;  4S3O B;  3N9M A;  3ZVZ B;  3U5M A;  3EB5 A;  4ZUX U;  3M99 A;  4PTB A;  3N9P A;  5D1M B;  3KQI A;  4B86 C;  5B78 A;  4S3O C;  4AVX A;  5B76 A;  2K4D A;  4W4U A;  4YBT A;  2MKE A;  2L80 A;  1WE9 A;  2Y1M A;  3O35 A;  2I50 A;  3FJU B;  4F52 B;  5B77 A;  4V3L C;  1U6G B;  5KH3 A;  2DX8 A;  2VPE A;  3LVR E;  3RPG B;  2VJF B;  2K16 A;  3MHS A;  5TAB A;  2XOC A;  4FJC A;  3L1Z B;  4WZ3 B;  2D8U A;  5EYA F;  2L43 A;  4XI1 A;  3GL6 A;  5I3L A; 
#chains in the Genus database with same CATH homology
 3RPG C;  2KE1 A;  5TDR A;  4TKP B;  5C13 A;  3LRQ A;  5JG6 A;  2YHO A;  4IC2 A;  4CCG X;  3FL2 A;  4GNG A;  4YBS A;  2ECJ A;  2YT5 A;  3N9L A;  3GV4 A;  2G43 A;  2CKL B;  3PHD A;  5J3X A;  2LN0 A;  4C9Z A;  2VPG A;  3LQJ A;  3C5K A;  2F42 A;  5G0F A;  3O36 A;  2M6M A;  3I2D A;  3O70 A;  1MM3 A;  3O34 A;  4X3G A;  4GB0 A;  5B79 A;  2LGG A;  4A4B A;  2RI7 A;  1JM7 A;  2KRE A;  5LKU A;  2PUY A;  3ZPV E;  3SOW A;  1WEU A;  2E6S A;  2MA6 A;  5DKA A;  1WEE A;  3T6R A;  1WEM A;  5AIT A;  2QIZ A;  4BBQ A;  2IDA A;  1Z2Q A;  2G45 A;  1VFY A;  2HDP A;  2C2L A;  5KH9 A;  2YHN A;  1VD4 A;  2H0D B;  3LQI A;  5AIU A;  2LGV A;  3T7L A;  2ECT A;  3N9O A;  1WEW A;  3VK6 A;  2QIC A;  3LQH A;  4O64 A;  2JMD A;  1WGM A;  1N87 A;  4YC9 A;  1IYM A;  2VP7 A;  4NN2 A;  1FBV A;  1T1H A;  5LKT A;  2E6R A;  3V43 A;  2MA5 A;  2MT5 A;  5D1K B;  3RTR B;  1XWH A;  1Z6U A;  2KWJ A;  4QF2 A;  1WIL A;  2VNF A;  3N9Q A;  2KWO A;  2M1R A;  2M3H A;  2LGK A;  1V87 A;  4AP4 A;  3ASL A;  3IHP A;  2RSD A;  2YW8 A;  5C11 A;  2ECV A;  2ECN A;  4IC3 A;  2BAY A;  2CT2 A;  2YUR A;  5H1V A;  2YRE A;  1BOR A;  1RMD A;  4WA6 A;  1E4U A;  4L7X A;  2KIZ A;  4AUQ B;  4A4C A;  2K1J A;  5B8D A;  5TDW A;  2VJE A;  4UP0 A;  1WES A;  4LKA A;  5H9M A;  3L11 A;  2CKL A;  1X4U A;  3ZNI A;  3HCU A;  5FB1 A;  1HYJ A;  3O7A A;  2KWN A;  3EB6 A;  3PUR A;  3KNV A;  4B7Y C;  2NAA A;  2KR4 A;  2KFT A;  4I7C A;  3C6W A;  2F6N A;  4L58 A;  2MNZ A;  2Y43 A;  5H1T A;  4GNF A;  3MHH A;  4R2Y A;  1WEV A;  4YAX A;  4ZDT A;  2F6J A;  2YU4 A;  2M85 A;  4N3W A;  1K2F A;  3U5O A;  2UZG A;  4YAT A;  2MUM A;  2YSJ A;  4MVT A;  4GNE A;  5FEY A;  4FIP A;  3NG2 A;  4LAD B;  2LGL A;  5DIN A;  2VPB A;  1HYI A;  1JOC A;  3SOU A;  5H1U A;  4AYC A;  2JMI A;  4BHW A;  2MIQ A;  3L1X A;  2H0D A;  2D8S A;  1DVP A;  2CSY A;  3KV5 A;  2YQM A;  1JM7 B;  2KYU A;  3O37 A;  2YQL A;  1G25 A;  3U5N A;  4R7E A;  4FO9 A;  2L75 A;  5LKX A;  3QZV A;  2VPD A;  1Z60 A;  2MNY A;  2MD8 C;  5TBN A;  4A49 A;  2FSA A;  4YAB A;  2FUU A;  5D1L B;  5TRB A;  2YSM A;  2K17 A;  2LRI C;  3KV6 A;  2OXQ C;  4GND A;  4YBM A;  5FER A;  2VJF A;  3N9N A;  2FUI A;  3SOX A;  3HCT A;  2ZET C;  2KU3 A;  2XEU A;  2YYR A;  1MM2 A;  2XB1 A;  2QJ0 A;  3SHB A;  2EOD A;  3M63 A;  4QF3 A;  2AN6 A;  4N4F A;  3PUQ A;  4YAD A;  2KGI A;  2LXH C;  1WEN A;  2LQ6 A;  4WZ0 A;  5FB0 A;  4PPE A;  1WEO A;  1WIM A;  4Q6F A;  2LDR A;  1F62 A;  3HCS A;  3U5P A;  2C2V S;  2G6Q A;  2HYE D;  2KGG A;  3ZTG A;  3DPL R;  2VJE B;  1WEQ A;  4UI9 B;  2ECW A;  2ECG A;  2YUC A;  4UP5 A;  3DQV R;  2L0B A;  5G04 B;  2Y1N A;  3ZVY A;  3ZYQ A;  4ZQL A;  3M62 A;  1WFK A;  1X4J A;  4MSX A;  2MD7 B;  4FK5 A;  2JRJ A;  3ZPV 1;  4CA1 A;  1WEP A;  2CSZ A;  4LJN A;  2ECI A;  3HTK C;  3O33 A;  1X4I A;  4LK9 A;  4WZ2 A;  2LV9 A;  4V3K C;  4I7B A;  1CHC A;  5B75 A;  1LDJ B;  5LCW B;  1ZBD B;  1LDK C;  5KH7 A;  2JMJ A;  2L5U A;  2PNX A;  4I7D A;  4AYC B;  1VYX A;  5LKZ A;  2LXP C;  1FP0 A;  4P5O B;  5G05 B;  4A0C D;  2EA6 A;  4LLB A;  2KWK A;  4R8P K;  2EGP A;  4S3O B;  3N9M A;  3ZVZ B;  3U5M A;  3EB5 A;  4ZUX U;  3M99 A;  4PTB A;  3N9P A;  5D1M B;  3KQI A;  4B86 C;  5B78 A;  4S3O C;  4AVX A;  5B76 A;  2K4D A;  4W4U A;  4YBT A;  2L80 A;  1WE9 A;  2Y1M A;  3O35 A;  2I50 A;  4F52 B;  5B77 A;  4V3L C;  1U6G B;  5KH3 A;  2DX8 A;  2VPE A;  3RPG B;  2VJF B;  2K16 A;  3MHS A;  5TAB A;  4FJC A;  3L1Z B;  4WZ3 B;  5EYA F;  2L43 A;  4XI1 A;  3GL6 A;  5I3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...