1WENA

Solution structure of phd domain in ing1-like protein bac25079
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inhibitor of growth family, member 4; ING1-like protein
publication title Solution structure of PHD domain in ING1-like protein BAC25079
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 4
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wenA00
1VFYA 4GNGA 5TBNA 2EODA 4XI1A 2ZETC 2ECWA 3LQHA 3N9NA 2E6RA 2F6JA 2H0DA 5B76A 3MHHA 3QZVA 1ZBDB 4AYCB 2CT2A 2YREA 4NN2A 2ECTA 1LDJB 2ECIA 4UP0A 5JG6A 4L7XA 4AVXA 5B75A 4MSXA 5AITA 5B78A 2JMJA 3EB6A 5FEYA 4CA1A 3U5PA 5EYAF 2LXHC 3FL2A 4AYCA 3KV6A 5KH7A 2KWKA 2RSDA 4WZ2A 2KFTA 3ZNIA 5LKXA 3M63A 4L58A 2KYUA 2RI7A 1Z2QA 3KQIA 4FK5A 5C11A 1T1HA 3L1XA 3O37A 4WZ3B 4C9ZA 2XB1A 2VJFB 3O34A 1F62A 3U5OA 3ZVZB 2LXPC 4PTBA 2LQ6A 3SHBA 2HYED 3M62A 4V3KC 5B77A 3O36A 2JRJA 4PPEA 4CCGX 2MNZA 2L80A 3U5MA 3MHSA 2G6QA 1WILA 4V3LC 2KU3A 3ZVYA 1X4JA 3KNVA 2VJFA 2JMIA 4YABA 1WEVA 1IYMA 1MM3A 2KWOA 2MD8C 4YADA 2VPBA 4QF2A 2C2VS 4WA6A 5AIUA 2QIZA 4A4CA 3O7AA 4YBSA 3HCUA 2OXQC 2HDPA 3PURA 3VK6A 2D8SA 2KGIA 3LRQA 1WEOA 4FJCA 2VPDA 2KWNA 5FB0A 4BBQA 2L43A 4YC9A 2CSZA 3HCSA 1VD4A 4O64A 1WE9A 5KH3A 2VP7A 2YHNA 2BAYA 4I7BA 3HTKC 3GL6A 4R8PK 4ZQLA 1HYJA 4A0CD 2K1JA 4B86C 3T6RA 4YATA 2LV9A 2EGPA 2VJEB 2YUCA 4IC3A 1Z6UA 2JMDA 4R7EA 3SOXA 2KR4A 4GNDA 2PNXA 4LKAA 2VPGA 3DPLR 3RPGB 4IC2A 1E4UA 2KWJA 5TDWA 3LQJA 4UI9B 3RPGC 3ASLA 5H9MA 4LK9A 1JM7B 2VJEA 2K17A 5LKTA 2YSJA 1WEEA 2YU4A 1V87A 2LGKA 3PHDA 2MT5A 3C5KA 5LCWB 5FERA 1JOCA 5G04B 2VPEA 2FSAA 1U6GB 1LDKC 4R2YA 1K2FA 2ECJA 4QF3A 3ZTGA 3LQIA 1JM7A 4N3WA 5D1KB 3KV5A 3ZPV1 3O70A 4UP5A 2NAAA 4A49A 4AUQB 3V43A 5C13A 5LKZA 2YQMA 4ZDTA 4FIPA 5H1UA 5FB1A 3SOUA 1WGMA 2LGLA 3N9LA 2LRIC 2LGVA 4LJNA 1WEQA 2EA6A 2LDRA 3U5NA 5TDRA 3NG2A 2MUMA 4B7YC 1X4IA 2XEUA 4GNEA 3O35A 1XWHA 2MD7B 1G25A 2YQLA 2QICA 3L1ZB 5LKUA 2LN0A 5I3LA 4ZUXU 2MA6A 2LGGA 2IDAA 2I50A 5G0FA 5KH9A 5H1TA 2CKLB 3PUQA 1MM2A 2ECGA 2PUYA 2MNYA 5DKAA 4WZ0A 1WIMA 4TKPB 2E6SA 4LADB 4Q6FA 2M1RA 1FBVA 2K16A 2CKLA 4FO9A 5DINA 3ZPVE 4W4UA 4I7DA 3N9PA 2Y43A 3C6WA 4P5OB 2K4DA 1WEWA 2YT5A 1Z60A 4GB0A 2MA5A 2YHOA 4X3GA 5D1LB 4LLBA 2ECVA 4YAXA 5D1MB 2KE1A 2C2LA 1VYXA 2KIZA 2YW8A 4YBTA 1WESA 5TRBA 5B8DA 3L11A 2YURA 2L75A 3I2DA 1CHCA 1BORA 2FUUA 3O33A 2F42A 4MVTA 2M85A 1X4UA 1WEMA 2G43A 2QJ0A 2L0BA 2UZGA 1FP0A 1WEUA 2DX8A 1DVPA 3M99A 2YSMA 2AN6A 3N9QA 2Y1MA 4YBMA 1HYIA 2F6NA 5G05B 3EB5A 2G45A 5J3XA 3T7LA 5H1VA 3DQVR 3N9MA 2M3HA 1WFKA 5B79A 2YYRA 5TABA 4GNFA 1N87A 4BHWA 3RTRB 2M6MA 4F52B 4A4BA 2KREA 2ECNA 2MIQA 2VNFA 1WEPA 2FUIA 3HCTA 3IHPA 4I7CA 3SOWA 2Y1NA 2H0DB 1RMDA 2KGGA 3N9OA 3GV4A 4S3OB 1WENA 2CSYA 4AP4A 4N4FA 3ZYQA 2L5UA 4S3OC
chains in the Genus database with same CATH superfamily
1VFYA 4GNGA 5TBNA 2EODA 4XI1A 2ZETC 2ECWA 3FAOA 3LQHA 3N9NA 2E6RA 2F6JA 2H0DA 5B76A 3MHHA 3T9KA 3QZVA 1ZBDB 4AYCB 2CT2A 2YREA 4NN2A 2ECTA 1LDJB 2ECIA 2XOCA 4UP0A 2OWAA 5JG6A 3FJUB 4L7XA 3E2DA 4AVXA 5B75A 4MSXA 2XOZA 5AITA 5B78A 2JMJA 3EB6A 5FEYA 4CA1A 2CRRA 3U5PA 5EYAF 2LXHC 3FL2A 4AYCA 3KV6A 5KH7A 2KWKA 3FANA 2RSDA 2CRWA 4WZ2A 2EXUA 2KFTA 3KDEC 3ZNIA 5LKXA 3M63A 4L58A 2KYUA 3H7HA 2RI7A 1Z2QA 3KQIA 4FK5A 5C11A 2LAUA 1T1HA 3L1XA 3O37A 4WZ3B 4C9ZA 2XB1A 2VJFB 3O34A 1F62A 3U5OA 3ZVZB 2LXPC 4PTBA 4F1PA 2LQ6A 3SHBA 2HYED 3M62A 4V3KC 5B77A 3O36A 2JRJA 4PPEA 4CCGX 2MNZA 2L80A 3U5MA 3MHSA 2G6QA 1WILA 4V3LC 4H9DA 2KU3A 3FEHA 3ZVYA 1X4JA 3KNVA 2VJFA 2JMIA 4YABA 1WEVA 1IYMA 2L7PA 1MM3A 2KWOA 2MD8C 4YADA 2VPBA 4QF2A 2C2VS 4WA6A 5AIUA 2E61A 2QIZA 4A4CA 3O7AA 4YBSA 3HCUA 2OXQC 2CONA 2HDPA 3PURA 3VK6A 2D8SA 2KGIA 3LRQA 2M13A 1WEOA 4FJCA 2VPDA 2KWNA 5FB0A 4BBQA 2L43A 4YC9A 2CSZA 3HCSA 1VD4A 4O64A 1WE9A 2KKXA 2VP7A 5KH3A 2YHNA 2D8UA 2BAYA 4I7BA 3HTKC 3GL6A 2CSVA 4ZQLA 4R8PK 1HYJA 1DCQA 4A0CD 2K1JA 4B86C 3T6RA 4YATA 2LV9A 2EGPA 2VJEB 2YUCA 4IC3A 1Z6UA 2JMDA 4R7EA 3SOXA 3JUEA 2KR4A 4GNDA 2PNXA 4LKAA 2VPGA 3DPLR 2IQJA 3Q1DA 3RPGB 4IC2A 1E4UA 2KWJA 5TDWA 2JM3A 3LQJA 4UI9B 3RPGC 3SUBA 3ASLA 3LVQE 5H9MA 4LK9A 1JM7B 2VJEA 2KKYA 2JUNA 2K17A 5LKTA 2YSJA 3M7KA 1WEEA 2YU4A 1V87A 2LGKA 4QQ4A 3PHDA 2MT5A 3C5KA 5LCWB 5FERA 1JOCA 5G04B 2VPEA 2FSAA 1U6GB 5SVIB 1LDKC 4R2YA 1K2FA 2ECJA 4QF3A 3ZTGA 2XP0A 3LQIA 1JM7A 4N3WA 5D1KB 3KV5A 3ZPV1 3O70A 4Z0RA 4UP5A 2NAAA 4A49A 4AUQB 3V43A 5C13A 5LKZA 2YQMA 4ZDTA 4FIPA 5SVIA 2MKEA 3LJUX 3LDYA 5H1UA 5FB1A 2YVRA 3SOUA 1WGMA 2LGLA 2DJAA 3N9LA 2LRIC 2LGVA 4LJNA 1WEQA 2EA6A 2LDRA 4OGCA 3U5NA 5TDRA 3NG2A 2MUMA 4B7YC 2FD4A 1X4IA 2XEUA 4GNEA 3O35A 1XWHA 2MD7B 1G25A 2YQLA 2QICA 3L1ZB 5LKUA 2LN0A 2XOYA 4N4FA 5I3LA 4ZUXU 2MA6A 2LGGA 2IDAA 2I50A 5G0FA 5KH9A 5H1TA 2CKLB 2DSMA 3PUQA 1MM2A 2ECGA 2PUYA 2MNYA 5DKAA 4WZ0A 1WIMA 5K3QA 4TKPB 2E6SA 3LVRE 4LADB 2FFWA 4Q6FA 2M1RA 3DDTA 1FBVA 2K16A 2CKLA 5SVYA 4FO9A 5DINA 3ZPVE 4W4UA 4I7DA 3N9PA 3O47A 2Y43A 3C6WA 4P5OB 2K4DA 1WEWA 2B0OE 2YT5A 1Z60A 4GB0A 2MA5A 2YHOA 4O62A 4X3GA 5D1LB 4LLBA 2ECVA 4YAXA 5D1MB 2KE1A 2C2LA 1VYXA 2KIZA 2YW8A 4YBTA 1WESA 5TRBA 5B8DA 3L11A 2YURA 2L75A 3I2DA 1CHCA 1BORA 4Z0OA 2FUUA 3O33A 2F42A 4MVTA 2M85A 2EGMA 1X4UA 1WEMA 2G43A 2QJ0A 2L0BA 2UZGA 1FP0A 1WEUA 2DX8A 1DVPA 3M99A 2YSMA 2AN6A 3N9QA 2Y1MA 4YBMA 1HYIA 2F6NA 5G05B 3EB5A 2G45A 5J3XA 3T7LA 5H1VA 3DQVR 3N9MA 2M3HA 1WFKA 5B79A 2YYRA 5TABA 4GNFA 1N87A 4BHWA 3RTRB 3DWDA 5SVXA 2M6MA 4F52B 4A4BA 3FM8C 2KREA 2ECNA 2MIQA 1MBMA 2VNFA 1WEPA 2FUIA 3HCTA 3IHPA 4I7CA 3SOWA 2Y1NA 4OGEA 2H0DB 1RMDA 2KGGA 3N9OA 3GV4A 4S3OB 1WENA 2CSYA 2P57A 4AP4A 2RR4A 3MDBC 3ZYQA 3PLWA 2L5UA 4S3OC
chains in the Genus database with same CATH topology
1VFYA 4GNGA 5TBNA 2EODA 4XI1A 2ZETC 2ECWA 3LQHA 3N9NA 2E6RA 2F6JA 2H0DA 5B76A 3MHHA 3QZVA 1ZBDB 4AYCB 2CT2A 2YREA 4NN2A 2ECTA 1LDJB 2ECIA 4UP0A 5JG6A 4L7XA 4AVXA 5B75A 4MSXA 5AITA 5B78A 2JMJA 3EB6A 5FEYA 4CA1A 3U5PA 5EYAF 2LXHC 3FL2A 4AYCA 3KV6A 5KH7A 2KWKA 2RSDA 4WZ2A 2KFTA 3ZNIA 5LKXA 3M63A 4L58A 2KYUA 2RI7A 1Z2QA 3KQIA 4FK5A 5C11A 1T1HA 3L1XA 3O37A 4WZ3B 4C9ZA 2XB1A 2VJFB 3O34A 1F62A 3U5OA 3ZVZB 2LXPC 4PTBA 2LQ6A 3SHBA 2HYED 3M62A 4V3KC 5B77A 3O36A 2JRJA 4PPEA 4CCGX 2MNZA 2L80A 3U5MA 3MHSA 2G6QA 1WILA 4V3LC 2KU3A 3ZVYA 1X4JA 3KNVA 2VJFA 2JMIA 4YABA 1WEVA 1IYMA 1MM3A 2KWOA 2MD8C 4YADA 2VPBA 4QF2A 2C2VS 4WA6A 5AIUA 2QIZA 4A4CA 3O7AA 4YBSA 3HCUA 2OXQC 2HDPA 3PURA 3VK6A 2D8SA 2KGIA 3LRQA 1WEOA 4FJCA 2VPDA 2KWNA 5FB0A 4BBQA 2L43A 4YC9A 2CSZA 3HCSA 1VD4A 4O64A 1WE9A 5KH3A 2VP7A 2YHNA 2BAYA 4I7BA 3HTKC 3GL6A 4R8PK 4ZQLA 1HYJA 4A0CD 2K1JA 4B86C 3T6RA 4YATA 2LV9A 2EGPA 2VJEB 2YUCA 4IC3A 1Z6UA 2JMDA 4R7EA 3SOXA 2KR4A 4GNDA 2PNXA 4LKAA 2VPGA 3DPLR 3RPGB 4IC2A 1E4UA 2KWJA 5TDWA 3LQJA 4UI9B 3RPGC 3ASLA 5H9MA 4LK9A 1JM7B 2VJEA 2K17A 5LKTA 2YSJA 1WEEA 2YU4A 1V87A 2LGKA 3PHDA 2MT5A 3C5KA 5LCWB 5FERA 1JOCA 5G04B 2VPEA 2FSAA 1U6GB 1LDKC 4R2YA 1K2FA 2ECJA 4QF3A 3ZTGA 3LQIA 1JM7A 4N3WA 5D1KB 3KV5A 3ZPV1 3O70A 4UP5A 2NAAA 4A49A 4AUQB 3V43A 5C13A 5LKZA 2YQMA 4ZDTA 4FIPA 5H1UA 5FB1A 3SOUA 1WGMA 2LGLA 3N9LA 2LRIC 2LGVA 4LJNA 1WEQA 2EA6A 2LDRA 3U5NA 5TDRA 3NG2A 2MUMA 4B7YC 1X4IA 2XEUA 4GNEA 3O35A 1XWHA 2MD7B 1G25A 2YQLA 2QICA 3L1ZB 5LKUA 2LN0A 5I3LA 4ZUXU 2MA6A 2LGGA 2IDAA 2I50A 5G0FA 5KH9A 5H1TA 2CKLB 3PUQA 1MM2A 2ECGA 2PUYA 2MNYA 5DKAA 4WZ0A 1WIMA 4TKPB 2E6SA 4LADB 4Q6FA 2M1RA 1FBVA 2K16A 2CKLA 4FO9A 5DINA 3ZPVE 4W4UA 4I7DA 3N9PA 2Y43A 3C6WA 4P5OB 2K4DA 1WEWA 2YT5A 1Z60A 4GB0A 2MA5A 2YHOA 4X3GA 5D1LB 4LLBA 2ECVA 4YAXA 5D1MB 2KE1A 2C2LA 1VYXA 2KIZA 2YW8A 4YBTA 1WESA 5TRBA 5B8DA 3L11A 2YURA 2L75A 3I2DA 1CHCA 1BORA 2FUUA 3O33A 2F42A 4MVTA 2M85A 1X4UA 1WEMA 2G43A 2QJ0A 2L0BA 2UZGA 1FP0A 1WEUA 2DX8A 1DVPA 3M99A 2YSMA 2AN6A 3N9QA 2Y1MA 4YBMA 1HYIA 2F6NA 5G05B 3EB5A 2G45A 5J3XA 3T7LA 5H1VA 3DQVR 3N9MA 2M3HA 1WFKA 5B79A 2YYRA 5TABA 4GNFA 1N87A 4BHWA 3RTRB 2M6MA 4F52B 4A4BA 2KREA 2ECNA 2MIQA 2VNFA 1WEPA 2FUIA 3HCTA 3IHPA 4I7CA 3SOWA 2Y1NA 2H0DB 1RMDA 2KGGA 3N9OA 3GV4A 4S3OB 1WENA 2CSYA 4AP4A 4N4FA 3ZYQA 2L5UA 4S3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFY A;  4GNG A;  5TBN A;  2EOD A;  4XI1 A;  2ZET C;  2ECW A;  3LQH A;  3N9N A;  2E6R A;  2F6J A;  2H0D A;  5B76 A;  3MHH A;  3QZV A;  1ZBD B;  4AYC B;  2CT2 A;  2YRE A;  4NN2 A;  2ECT A;  1LDJ B;  2ECI A;  4UP0 A;  5JG6 A;  4L7X A;  4AVX A;  5B75 A;  4MSX A;  5AIT A;  5B78 A;  2JMJ A;  3EB6 A;  5FEY A;  4CA1 A;  3U5P A;  5EYA F;  2LXH C;  3FL2 A;  4AYC A;  3KV6 A;  5KH7 A;  2KWK A;  2RSD A;  4WZ2 A;  2KFT A;  3ZNI A;  5LKX A;  3M63 A;  4L58 A;  2KYU A;  2RI7 A;  1Z2Q A;  3KQI A;  4FK5 A;  5C11 A;  1T1H A;  3L1X A;  3O37 A;  4WZ3 B;  4C9Z A;  2XB1 A;  2VJF B;  3O34 A;  1F62 A;  3U5O A;  3ZVZ B;  2LXP C;  4PTB A;  2LQ6 A;  3SHB A;  2HYE D;  3M62 A;  4V3K C;  5B77 A;  3O36 A;  2JRJ A;  4PPE A;  4CCG X;  2MNZ A;  2L80 A;  3U5M A;  3MHS A;  2G6Q A;  1WIL A;  4V3L C;  2KU3 A;  3ZVY A;  1X4J A;  3KNV A;  2VJF A;  2JMI A;  4YAB A;  1WEV A;  1IYM A;  1MM3 A;  2KWO A;  2MD8 C;  4YAD A;  2VPB A;  4QF2 A;  2C2V S;  4WA6 A;  5AIU A;  2QIZ A;  4A4C A;  3O7A A;  4YBS A;  3HCU A;  2OXQ C;  2HDP A;  3PUR A;  3VK6 A;  2D8S A;  2KGI A;  3LRQ A;  1WEO A;  4FJC A;  2VPD A;  2KWN A;  5FB0 A;  4BBQ A;  2L43 A;  4YC9 A;  2CSZ A;  3HCS A;  1VD4 A;  4O64 A;  1WE9 A;  5KH3 A;  2VP7 A;  2YHN A;  2BAY A;  4I7B A;  3HTK C;  3GL6 A;  4R8P K;  4ZQL A;  1HYJ A;  4A0C D;  2K1J A;  4B86 C;  3T6R A;  4YAT A;  2LV9 A;  2EGP A;  2VJE B;  2YUC A;  4IC3 A;  1Z6U A;  2JMD A;  4R7E A;  3SOX A;  2KR4 A;  4GND A;  2PNX A;  4LKA A;  2VPG A;  3DPL R;  3RPG B;  4IC2 A;  1E4U A;  2KWJ A;  5TDW A;  3LQJ A;  4UI9 B;  3RPG C;  3ASL A;  5H9M A;  4LK9 A;  1JM7 B;  2VJE A;  2K17 A;  5LKT A;  2YSJ A;  1WEE A;  2YU4 A;  1V87 A;  2LGK A;  3PHD A;  2MT5 A;  3C5K A;  5LCW B;  5FER A;  1JOC A;  5G04 B;  2VPE A;  2FSA A;  1U6G B;  1LDK C;  4R2Y A;  1K2F A;  2ECJ A;  4QF3 A;  3ZTG A;  3LQI A;  1JM7 A;  4N3W A;  5D1K B;  3KV5 A;  3ZPV 1;  3O70 A;  4UP5 A;  2NAA A;  4A49 A;  4AUQ B;  3V43 A;  5C13 A;  5LKZ A;  2YQM A;  4ZDT A;  4FIP A;  5H1U A;  5FB1 A;  3SOU A;  1WGM A;  2LGL A;  3N9L A;  2LRI C;  2LGV A;  4LJN A;  1WEQ A;  2EA6 A;  2LDR A;  3U5N A;  5TDR A;  3NG2 A;  2MUM A;  4B7Y C;  1X4I A;  2XEU A;  4GNE A;  3O35 A;  1XWH A;  2MD7 B;  1G25 A;  2YQL A;  2QIC A;  3L1Z B;  5LKU A;  2LN0 A;  5I3L A;  4ZUX U;  2MA6 A;  2LGG A;  2IDA A;  2I50 A;  5G0F A;  5KH9 A;  5H1T A;  2CKL B;  3PUQ A;  1MM2 A;  2ECG A;  2PUY A;  2MNY A;  5DKA A;  4WZ0 A;  1WIM A;  4TKP B;  2E6S A;  4LAD B;  4Q6F A;  2M1R A;  1FBV A;  2K16 A;  2CKL A;  4FO9 A;  5DIN A;  3ZPV E;  4W4U A;  4I7D A;  3N9P A;  2Y43 A;  3C6W A;  4P5O B;  2K4D A;  1WEW A;  2YT5 A;  1Z60 A;  4GB0 A;  2MA5 A;  2YHO A;  4X3G A;  5D1L B;  4LLB A;  2ECV A;  4YAX A;  5D1M B;  2KE1 A;  2C2L A;  1VYX A;  2KIZ A;  2YW8 A;  4YBT A;  1WES A;  5TRB A;  5B8D A;  3L11 A;  2YUR A;  2L75 A;  3I2D A;  1CHC A;  1BOR A;  2FUU A;  3O33 A;  2F42 A;  4MVT A;  2M85 A;  1X4U A;  1WEM A;  2G43 A;  2QJ0 A;  2L0B A;  2UZG A;  1FP0 A;  1WEU A;  2DX8 A;  1DVP A;  3M99 A;  2YSM A;  2AN6 A;  3N9Q A;  2Y1M A;  4YBM A;  1HYI A;  2F6N A;  5G05 B;  3EB5 A;  2G45 A;  5J3X A;  3T7L A;  5H1V A;  3DQV R;  3N9M A;  2M3H A;  1WFK A;  5B79 A;  2YYR A;  5TAB A;  4GNF A;  1N87 A;  4BHW A;  3RTR B;  2M6M A;  4F52 B;  4A4B A;  2KRE A;  2ECN A;  2MIQ A;  2VNF A;  1WEP A;  2FUI A;  3HCT A;  3IHP A;  4I7C A;  3SOW A;  2Y1N A;  2H0D B;  1RMD A;  2KGG A;  3N9O A;  3GV4 A;  4S3O B;  1WEN A;  2CSY A;  4AP4 A;  4N4F A;  3ZYQ A;  2L5U A;  4S3O C; 
#chains in the Genus database with same CATH topology
 1VFY A;  4GNG A;  5TBN A;  2EOD A;  4XI1 A;  2ZET C;  2ECW A;  3FAO A;  3LQH A;  3N9N A;  2E6R A;  2F6J A;  2H0D A;  5B76 A;  3MHH A;  3T9K A;  3QZV A;  1ZBD B;  4AYC B;  2CT2 A;  2YRE A;  4NN2 A;  2ECT A;  1LDJ B;  2ECI A;  2XOC A;  4UP0 A;  2OWA A;  5JG6 A;  3FJU B;  4L7X A;  3E2D A;  4AVX A;  5B75 A;  4MSX A;  2XOZ A;  5AIT A;  5B78 A;  2JMJ A;  3EB6 A;  5FEY A;  4CA1 A;  2CRR A;  3U5P A;  5EYA F;  2LXH C;  3FL2 A;  4AYC A;  3KV6 A;  5KH7 A;  2KWK A;  3FAN A;  2RSD A;  2CRW A;  4WZ2 A;  2EXU A;  2KFT A;  3KDE C;  3ZNI A;  5LKX A;  3M63 A;  4L58 A;  2KYU A;  3H7H A;  2RI7 A;  1Z2Q A;  3KQI A;  4FK5 A;  5C11 A;  2LAU A;  1T1H A;  3L1X A;  3O37 A;  4WZ3 B;  4C9Z A;  2XB1 A;  2VJF B;  3O34 A;  1F62 A;  3U5O A;  3ZVZ B;  2LXP C;  4PTB A;  4F1P A;  2LQ6 A;  3SHB A;  2HYE D;  3M62 A;  4V3K C;  5B77 A;  3O36 A;  2JRJ A;  4PPE A;  4CCG X;  2MNZ A;  2L80 A;  3U5M A;  3MHS A;  2G6Q A;  1WIL A;  4V3L C;  4H9D A;  2KU3 A;  3FEH A;  3ZVY A;  1X4J A;  3KNV A;  2VJF A;  2JMI A;  4YAB A;  1WEV A;  1IYM A;  2L7P A;  1MM3 A;  2KWO A;  2MD8 C;  4YAD A;  2VPB A;  4QF2 A;  2C2V S;  4WA6 A;  5AIU A;  2E61 A;  2QIZ A;  4A4C A;  3O7A A;  4YBS A;  3HCU A;  2OXQ C;  2CON A;  2HDP A;  3PUR A;  3VK6 A;  2D8S A;  2KGI A;  3LRQ A;  2M13 A;  1WEO A;  4FJC A;  2VPD A;  2KWN A;  5FB0 A;  4BBQ A;  2L43 A;  4YC9 A;  2CSZ A;  3HCS A;  1VD4 A;  4O64 A;  1WE9 A;  2KKX A;  2VP7 A;  5KH3 A;  2YHN A;  2D8U A;  2BAY A;  4I7B A;  3HTK C;  3GL6 A;  2CSV A;  4ZQL A;  4R8P K;  1HYJ A;  1DCQ A;  4A0C D;  2K1J A;  4B86 C;  3T6R A;  4YAT A;  2LV9 A;  2EGP A;  2VJE B;  2YUC A;  4IC3 A;  1Z6U A;  2JMD A;  4R7E A;  3SOX A;  3JUE A;  2KR4 A;  4GND A;  2PNX A;  4LKA A;  2VPG A;  3DPL R;  2IQJ A;  3Q1D A;  3RPG B;  4IC2 A;  1E4U A;  2KWJ A;  5TDW A;  2JM3 A;  3LQJ A;  4UI9 B;  3RPG C;  3SUB A;  3ASL A;  3LVQ E;  5H9M A;  4LK9 A;  1JM7 B;  2VJE A;  2KKY A;  2JUN A;  2K17 A;  5LKT A;  2YSJ A;  3M7K A;  1WEE A;  2YU4 A;  1V87 A;  2LGK A;  4QQ4 A;  3PHD A;  2MT5 A;  3C5K A;  5LCW B;  5FER A;  1JOC A;  5G04 B;  2VPE A;  2FSA A;  1U6G B;  5SVI B;  1LDK C;  4R2Y A;  1K2F A;  2ECJ A;  4QF3 A;  3ZTG A;  2XP0 A;  3LQI A;  1JM7 A;  4N3W A;  5D1K B;  3KV5 A;  3ZPV 1;  3O70 A;  4Z0R A;  4UP5 A;  2NAA A;  4A49 A;  4AUQ B;  3V43 A;  5C13 A;  5LKZ A;  2YQM A;  4ZDT A;  4FIP A;  5SVI A;  2MKE A;  3LJU X;  3LDY A;  5H1U A;  5FB1 A;  2YVR A;  3SOU A;  1WGM A;  2LGL A;  2DJA A;  3N9L A;  2LRI C;  2LGV A;  4LJN A;  1WEQ A;  2EA6 A;  2LDR A;  4OGC A;  3U5N A;  5TDR A;  3NG2 A;  2MUM A;  4B7Y C;  2FD4 A;  1X4I A;  2XEU A;  4GNE A;  3O35 A;  1XWH A;  2MD7 B;  1G25 A;  2YQL A;  2QIC A;  3L1Z B;  5LKU A;  2LN0 A;  2XOY A;  4N4F A;  5I3L A;  4ZUX U;  2MA6 A;  2LGG A;  2IDA A;  2I50 A;  5G0F A;  5KH9 A;  5H1T A;  2CKL B;  2DSM A;  3PUQ A;  1MM2 A;  2ECG A;  2PUY A;  2MNY A;  5DKA A;  4WZ0 A;  1WIM A;  5K3Q A;  4TKP B;  2E6S A;  3LVR E;  4LAD B;  2FFW A;  4Q6F A;  2M1R A;  3DDT A;  1FBV A;  2K16 A;  2CKL A;  5SVY A;  4FO9 A;  5DIN A;  3ZPV E;  4W4U A;  4I7D A;  3N9P A;  3O47 A;  2Y43 A;  3C6W A;  4P5O B;  2K4D A;  1WEW A;  2B0O E;  2YT5 A;  1Z60 A;  4GB0 A;  2MA5 A;  2YHO A;  4O62 A;  4X3G A;  5D1L B;  4LLB A;  2ECV A;  4YAX A;  5D1M B;  2KE1 A;  2C2L A;  1VYX A;  2KIZ A;  2YW8 A;  4YBT A;  1WES A;  5TRB A;  5B8D A;  3L11 A;  2YUR A;  2L75 A;  3I2D A;  1CHC A;  1BOR A;  4Z0O A;  2FUU A;  3O33 A;  2F42 A;  4MVT A;  2M85 A;  2EGM A;  1X4U A;  1WEM A;  2G43 A;  2QJ0 A;  2L0B A;  2UZG A;  1FP0 A;  1WEU A;  2DX8 A;  1DVP A;  3M99 A;  2YSM A;  2AN6 A;  3N9Q A;  2Y1M A;  4YBM A;  1HYI A;  2F6N A;  5G05 B;  3EB5 A;  2G45 A;  5J3X A;  3T7L A;  5H1V A;  3DQV R;  3N9M A;  2M3H A;  1WFK A;  5B79 A;  2YYR A;  5TAB A;  4GNF A;  1N87 A;  4BHW A;  3RTR B;  3DWD A;  5SVX A;  2M6M A;  4F52 B;  4A4B A;  3FM8 C;  2KRE A;  2ECN A;  2MIQ A;  1MBM A;  2VNF A;  1WEP A;  2FUI A;  3HCT A;  3IHP A;  4I7C A;  3SOW A;  2Y1N A;  4OGE A;  2H0D B;  1RMD A;  2KGG A;  3N9O A;  3GV4 A;  4S3O B;  1WEN A;  2CSY A;  2P57 A;  4AP4 A;  2RR4 A;  3MDB C;  3ZYQ A;  3PLW A;  2L5U A;  4S3O C; 
#chains in the Genus database with same CATH homology
 1VFY A;  4GNG A;  5TBN A;  2EOD A;  4XI1 A;  2ZET C;  2ECW A;  3LQH A;  3N9N A;  2E6R A;  2F6J A;  2H0D A;  5B76 A;  3MHH A;  3QZV A;  1ZBD B;  4AYC B;  2CT2 A;  2YRE A;  4NN2 A;  2ECT A;  1LDJ B;  2ECI A;  4UP0 A;  5JG6 A;  4L7X A;  4AVX A;  5B75 A;  4MSX A;  5AIT A;  5B78 A;  2JMJ A;  3EB6 A;  5FEY A;  4CA1 A;  3U5P A;  5EYA F;  2LXH C;  3FL2 A;  4AYC A;  3KV6 A;  5KH7 A;  2KWK A;  2RSD A;  4WZ2 A;  2KFT A;  3ZNI A;  5LKX A;  3M63 A;  4L58 A;  2KYU A;  2RI7 A;  1Z2Q A;  3KQI A;  4FK5 A;  5C11 A;  1T1H A;  3L1X A;  3O37 A;  4WZ3 B;  4C9Z A;  2XB1 A;  2VJF B;  3O34 A;  1F62 A;  3U5O A;  3ZVZ B;  2LXP C;  4PTB A;  2LQ6 A;  3SHB A;  2HYE D;  3M62 A;  4V3K C;  5B77 A;  3O36 A;  2JRJ A;  4PPE A;  4CCG X;  2MNZ A;  2L80 A;  3U5M A;  3MHS A;  2G6Q A;  1WIL A;  4V3L C;  2KU3 A;  3ZVY A;  1X4J A;  3KNV A;  2VJF A;  2JMI A;  4YAB A;  1WEV A;  1IYM A;  1MM3 A;  2KWO A;  2MD8 C;  4YAD A;  2VPB A;  4QF2 A;  2C2V S;  4WA6 A;  5AIU A;  2QIZ A;  4A4C A;  3O7A A;  4YBS A;  3HCU A;  2OXQ C;  2HDP A;  3PUR A;  3VK6 A;  2D8S A;  2KGI A;  3LRQ A;  1WEO A;  4FJC A;  2VPD A;  2KWN A;  5FB0 A;  4BBQ A;  2L43 A;  4YC9 A;  2CSZ A;  3HCS A;  1VD4 A;  4O64 A;  1WE9 A;  5KH3 A;  2VP7 A;  2YHN A;  2BAY A;  4I7B A;  3HTK C;  3GL6 A;  4R8P K;  4ZQL A;  1HYJ A;  4A0C D;  2K1J A;  4B86 C;  3T6R A;  4YAT A;  2LV9 A;  2EGP A;  2VJE B;  2YUC A;  4IC3 A;  1Z6U A;  2JMD A;  4R7E A;  3SOX A;  2KR4 A;  4GND A;  2PNX A;  4LKA A;  2VPG A;  3DPL R;  3RPG B;  4IC2 A;  1E4U A;  2KWJ A;  5TDW A;  3LQJ A;  4UI9 B;  3RPG C;  3ASL A;  5H9M A;  4LK9 A;  1JM7 B;  2VJE A;  2K17 A;  5LKT A;  2YSJ A;  1WEE A;  2YU4 A;  1V87 A;  2LGK A;  3PHD A;  2MT5 A;  3C5K A;  5LCW B;  5FER A;  1JOC A;  5G04 B;  2VPE A;  2FSA A;  1U6G B;  1LDK C;  4R2Y A;  1K2F A;  2ECJ A;  4QF3 A;  3ZTG A;  3LQI A;  1JM7 A;  4N3W A;  5D1K B;  3KV5 A;  3ZPV 1;  3O70 A;  4UP5 A;  2NAA A;  4A49 A;  4AUQ B;  3V43 A;  5C13 A;  5LKZ A;  2YQM A;  4ZDT A;  4FIP A;  5H1U A;  5FB1 A;  3SOU A;  1WGM A;  2LGL A;  3N9L A;  2LRI C;  2LGV A;  4LJN A;  1WEQ A;  2EA6 A;  2LDR A;  3U5N A;  5TDR A;  3NG2 A;  2MUM A;  4B7Y C;  1X4I A;  2XEU A;  4GNE A;  3O35 A;  1XWH A;  2MD7 B;  1G25 A;  2YQL A;  2QIC A;  3L1Z B;  5LKU A;  2LN0 A;  5I3L A;  4ZUX U;  2MA6 A;  2LGG A;  2IDA A;  2I50 A;  5G0F A;  5KH9 A;  5H1T A;  2CKL B;  3PUQ A;  1MM2 A;  2ECG A;  2PUY A;  2MNY A;  5DKA A;  4WZ0 A;  1WIM A;  4TKP B;  2E6S A;  4LAD B;  4Q6F A;  2M1R A;  1FBV A;  2K16 A;  2CKL A;  4FO9 A;  5DIN A;  3ZPV E;  4W4U A;  4I7D A;  3N9P A;  2Y43 A;  3C6W A;  4P5O B;  2K4D A;  1WEW A;  2YT5 A;  1Z60 A;  4GB0 A;  2MA5 A;  2YHO A;  4X3G A;  5D1L B;  4LLB A;  2ECV A;  4YAX A;  5D1M B;  2KE1 A;  2C2L A;  1VYX A;  2KIZ A;  2YW8 A;  4YBT A;  1WES A;  5TRB A;  5B8D A;  3L11 A;  2YUR A;  2L75 A;  3I2D A;  1CHC A;  1BOR A;  2FUU A;  3O33 A;  2F42 A;  4MVT A;  2M85 A;  1X4U A;  1WEM A;  2G43 A;  2QJ0 A;  2L0B A;  2UZG A;  1FP0 A;  1WEU A;  2DX8 A;  1DVP A;  3M99 A;  2YSM A;  2AN6 A;  3N9Q A;  2Y1M A;  4YBM A;  1HYI A;  2F6N A;  5G05 B;  3EB5 A;  2G45 A;  5J3X A;  3T7L A;  5H1V A;  3DQV R;  3N9M A;  2M3H A;  1WFK A;  5B79 A;  2YYR A;  5TAB A;  4GNF A;  1N87 A;  4BHW A;  3RTR B;  2M6M A;  4F52 B;  4A4B A;  2KRE A;  2ECN A;  2MIQ A;  2VNF A;  1WEP A;  2FUI A;  3HCT A;  3IHP A;  4I7C A;  3SOW A;  2Y1N A;  2H0D B;  1RMD A;  2KGG A;  3N9O A;  3GV4 A;  4S3O B;  1WEN A;  2CSY A;  4AP4 A;  4N4F A;  3ZYQ A;  2L5U A;  4S3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...