4QF2A

Crystal structure of human baz2a phd zinc finger in the free form
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4qf2A00
2VPEA 2XB1A 2MT5A 3O36A 5D1LB 1X4IA 2G43A 2JMIA 2L43A 4FJCA 4BHWA 5B75A 4FK5A 4MVTA 2YHOA 2Y43A 4V3KC 2F42A 3O70A 4GNEA 3KNVA 2MNYA 2YQMA 3LQJA 2M3HA 3NG2A 5AITA 2MIQA 5H1VA 1LDJB 2F6NA 4GNFA 2LXPC 3O34A 1WIMA 4XI1A 4LADB 5JG6A 2MUMA 1WGMA 3SHBA 3N9MA 3O35A 3LQHA 2KREA 5G05B 2Y1NA 2YSMA 2YURA 4LLBA 2KR4A 2VJEA 5D1KB 1WEWA 1WE9A 1Z6UA 5B8DA 3HCSA 3O37A 3IHPA 1WILA 1WEEA 2G6QA 3PHDA 3U5NA 2MNZA 4A49A 2Y1MA 2YHNA 1JM7B 2ECVA 4I7CA 2E6RA 4L7XA 3SOXA 2JMDA 2E6SA 2FSAA 2KFTA 2LGVA 5FB1A 3ZVYA 2IDAA 4WA6A 2YSJA 3N9PA 4LKAA 5LKZA 4S3OB 2RI7A 3LRQA 4AUQB 2UZGA 4ZUXU 3EB5A 2M85A 2LGLA 1DVPA 4N3WA 4YABA 4FO9A 2DX8A 4O64A 4UP0A 4Q6FA 2LDRA 4MSXA 3ZPVE 3MHHA 4GNDA 1CHCA 1WFKA 4LK9A 4W4UA 2D8SA 5B79A 5LCWB 2JMJA 2AN6A 3QZVA 4IC2A 2KIZA 3LQIA 1X4JA 2PNXA 4AYCA 2H0DA 3ASLA 2VPGA 4YADA 4TKPB 5DKAA 3M62A 1JOCA 5B78A 4ZQLA 2CSZA 1WEPA 2YUCA 3O7AA 4GB0A 5H1TA 4B86C 2CKLA 2C2VS 2MD8C 1E4UA 2QICA 2MA6A 4IC3A 2VJEB 3HCTA 2KYUA 1VD4A 4ZDTA 4QF3A 4I7BA 1WEUA 2BAYA 3N9QA 4R7EA 1WEQA 5D1MB 2K16A 5TDRA 2KU3A 4WZ3B 5DINA 1WEOA 3I2DA 3SOWA 2EA6A 5B76A 4GNGA 3KV6A 3GL6A 2YREA 4QF2A 3V43A 3SOUA 2L0BA 2NAAA 5G0FA 1F62A 2VP7A 3M63A 1T1HA 1VFYA 4WZ2A 1Z2QA 3RTRB 4YBMA 4S3OC 5J3XA 1FP0A 2YYRA 2K4DA 4UP5A 2FUUA 4PTBA 1X4UA 2HDPA 1G25A 3U5OA 3M99A 2KWNA 1WENA 3U5MA 3DQVR 2EGPA 1N87A 4CCGX 3ZNIA 4WZ0A 1BORA 5FERA 1K2FA 5TBNA 2YT5A 1MM3A 1WESA 4R8PK 4A0CD 5LKTA 4YBTA 4AYCB 2H0DB 5TABA 2L80A 2LRIC 2MD7B 2YU4A 2VJFA 5EYAF 2K17A 4B7YC 3EB6A 3HCUA 2KWOA 2VNFA 3HTKC 2ECIA 5FB0A 4YBSA 4X3GA 3T7LA 2CKLB 2L75A 2ECWA 1HYIA 1V87A 3ZPV1 1WEVA 5TDWA 2YQLA 2LXHC 2LN0A 3N9LA 2FUIA 1RMDA 2EODA 2I50A 5C13A 2ECNA 2MA5A 2G45A 2LGKA 4R2YA 2KE1A 5H9MA 2XEUA 2ECTA 2KWKA 2ECJA 3VK6A 3ZTGA 1ZBDB 5FEYA 2OXQC 1Z60A 2ZETC 3N9OA 4AP4A 5KH7A 3L11A 5I3LA 2KGGA 2VPBA 1IYMA 2KWJA 2K1JA 2YW8A 3O33A 2ECGA 4C9ZA 3U5PA 1MM2A 2C2LA 4NN2A 4YC9A 4F52B 3FL2A 4N4FA 1HYJA 5KH3A 2PUYA 2RSDA 5LKXA 2KGIA 2F6JA 5B77A 5TRBA 5C11A 5AIUA 1XWHA 2LGGA 3ZYQA 2QIZA 4FIPA 2VJFB 3RPGC 4LJNA 2L5UA 3C6WA 2CT2A 1WEMA 3N9NA 1JM7A 2M1RA 4BBQA 1LDKC 2HYED 4UI9B 1FBVA 2M6MA 2LV9A 3MHSA 5KH9A 4A4BA 4V3LC 1VYXA 3L1ZB 3RPGB 4I7DA 4A4CA 5H1UA 3T6RA 3PURA 2VPDA 3PUQA 3KQIA 3KV5A 5G04B 5LKUA 4L58A 4YAXA 4PPEA 2JRJA 3L1XA 4CA1A 4AVXA 2LQ6A 4YATA 1U6GB 2QJ0A 3DPLR 3GV4A 3C5KA 4P5OB 3ZVZB 2CSYA
chains in the Genus database with same CATH superfamily
2VPEA 2XB1A 2MT5A 3O36A 5D1LB 1X4IA 2G43A 2JMIA 2L43A 4FJCA 4BHWA 5B75A 4FK5A 4MVTA 2LAUA 2YHOA 2Y43A 4V3KC 2F42A 3O70A 4GNEA 3KNVA 2MNYA 2YQMA 2IQJA 3LQJA 2M3HA 3NG2A 4F1PA 5AITA 2MIQA 5H1VA 1LDJB 2F6NA 4GNFA 2LXPC 3O34A 1WIMA 4XI1A 4LADB 5JG6A 2MUMA 1WGMA 3N9MA 3O35A 3SHBA 4OGEA 3LQHA 2KREA 5G05B 2DJAA 2Y1NA 2YSMA 5SVIB 2YURA 4LLBA 2KR4A 2VJEA 2OWAA 5D1KB 1WEWA 1WE9A 1Z6UA 5B8DA 3HCSA 3H7HA 3O37A 3IHPA 1WILA 1WEEA 2G6QA 3PHDA 3U5NA 2MNZA 4A49A 2Y1MA 2YHNA 1JM7B 2ECVA 2XOYA 2CRWA 4I7CA 2E6RA 3FM8C 4L7XA 3SOXA 2JMDA 2RR4A 2E6SA 2M13A 2B0OE 2FSAA 2KFTA 2LGVA 3JUEA 5FB1A 3ZVYA 2IDAA 4WA6A 2YSJA 3N9PA 4LKAA 5LKZA 4S3OB 2RI7A 3LRQA 4AUQB 2UZGA 4ZUXU 3EB5A 2M85A 2LGLA 1DVPA 4N3WA 4YABA 4FO9A 2DX8A 3FANA 4O64A 4UP0A 4Q6FA 2LDRA 4MSXA 3ZPVE 3MHHA 4GNDA 1CHCA 1WFKA 4LK9A 4W4UA 2D8SA 5B79A 5LCWB 2JMJA 2AN6A 3QZVA 4IC2A 2MKEA 2KIZA 3LQIA 1X4JA 2KKXA 2PNXA 4AYCA 2H0DA 3ASLA 2VPGA 4YADA 4TKPB 5DKAA 3M62A 2XP0A 1JOCA 5B78A 3LVQE 4ZQLA 2CSZA 3PLWA 1WEPA 2YUCA 3O7AA 4GB0A 5H1TA 4B86C 2XOCA 2CKLA 2C2VS 2MD8C 1E4UA 2QICA 2MA6A 4IC3A 5K3QA 2VJEB 3HCTA 2KYUA 1VD4A 4ZDTA 4QF3A 3DDTA 4I7BA 1WEUA 2BAYA 3N9QA 4R7EA 1WEQA 5D1MB 2K16A 5SVYA 5TDRA 2KU3A 4WZ3B 5DINA 1WEOA 3I2DA 3SOWA 2EA6A 5B76A 1DCQA 4GNGA 3KV6A 3GL6A 2YREA 4QF2A 3V43A 3SOUA 2L0BA 3FAOA 2P57A 2NAAA 2L7PA 5G0FA 1F62A 2VP7A 3M63A 1T1HA 1VFYA 4WZ2A 1Z2QA 3RTRB 4YBMA 4S3OC 5J3XA 2JUNA 2EGMA 1FP0A 2YYRA 2K4DA 4UP5A 2FUUA 4PTBA 1X4UA 2HDPA 1G25A 3U5OA 3M99A 2KWNA 1WENA 3U5MA 3DQVR 3LVRE 2EGPA 4Z0OA 1N87A 4CCGX 3ZNIA 4WZ0A 3KDEC 1BORA 3M7KA 5FERA 1K2FA 5TBNA 2YT5A 1MM3A 1WESA 4R8PK 4A0CD 5LKTA 4YBTA 4AYCB 2H0DB 5TABA 2L80A 2LRIC 2MD7B 2YU4A 2VJFA 5EYAF 2K17A 4B7YC 3EB6A 3HCUA 2KWOA 2VNFA 3HTKC 3MDBC 2ECIA 5FB0A 4YBSA 4X3GA 2E61A 3T7LA 2CKLB 2L75A 2ECWA 1HYIA 1V87A 3ZPV1 1WEVA 3SUBA 5TDWA 2YQLA 2LXHC 2LN0A 3T9KA 3N9LA 2FUIA 1RMDA 2EODA 2I50A 5C13A 3LJUX 2ECNA 2MA5A 2G45A 3O47A 2LGKA 4R2YA 2KE1A 5H9MA 4O62A 2XEUA 5SVXA 2ECTA 2KWKA 2ECJA 3VK6A 3ZTGA 1ZBDB 2CRRA 2OXQC 5FEYA 1Z60A 2ZETC 3N9OA 4AP4A 3FJUB 5KH7A 2FFWA 3L11A 5I3LA 2DSMA 2KGGA 2VPBA 1IYMA 2YVRA 4QQ4A 3FEHA 2KKYA 2KWJA 2K1JA 3LDYA 2EXUA 2YW8A 3O33A 2ECGA 2D8UA 4C9ZA 3U5PA 1MM2A 2C2LA 5SVIA 4NN2A 4YC9A 4F52B 3FL2A 4N4FA 1HYJA 5KH3A 2PUYA 2RSDA 5LKXA 2KGIA 2F6JA 5B77A 4Z0RA 5TRBA 5C11A 2JM3A 5AIUA 1XWHA 2LGGA 3ZYQA 2QIZA 4H9DA 4FIPA 2VJFB 3RPGC 4LJNA 2L5UA 2XOZA 3C6WA 2CT2A 1WEMA 3N9NA 1JM7A 2FD4A 2M1RA 4BBQA 1LDKC 2HYED 4UI9B 1FBVA 2M6MA 2CONA 2LV9A 1MBMA 3MHSA 5KH9A 4A4BA 4V3LC 1VYXA 3L1ZB 3E2DA 3RPGB 4I7DA 4A4CA 2CSVA 5H1UA 3T6RA 3PURA 3Q1DA 2VPDA 3PUQA 3KQIA 3KV5A 5G04B 5LKUA 4L58A 4YAXA 4OGCA 4PPEA 2JRJA 3L1XA 4CA1A 4AVXA 2LQ6A 4YATA 1U6GB 2QJ0A 3DWDA 3DPLR 3GV4A 3C5KA 4P5OB 3ZVZB 2CSYA
chains in the Genus database with same CATH topology
2VPEA 2XB1A 2MT5A 3O36A 5D1LB 1X4IA 2G43A 2JMIA 2L43A 4FJCA 4BHWA 5B75A 4FK5A 4MVTA 2YHOA 2Y43A 4V3KC 2F42A 3O70A 4GNEA 3KNVA 2MNYA 2YQMA 3LQJA 2M3HA 3NG2A 5AITA 2MIQA 5H1VA 1LDJB 2F6NA 4GNFA 2LXPC 3O34A 1WIMA 4XI1A 4LADB 5JG6A 2MUMA 1WGMA 3SHBA 3N9MA 3O35A 3LQHA 2KREA 5G05B 2Y1NA 2YSMA 2YURA 4LLBA 2KR4A 2VJEA 5D1KB 1WEWA 1WE9A 1Z6UA 5B8DA 3HCSA 3O37A 3IHPA 1WILA 1WEEA 2G6QA 3PHDA 3U5NA 2MNZA 4A49A 2Y1MA 2YHNA 1JM7B 2ECVA 4I7CA 2E6RA 4L7XA 3SOXA 2JMDA 2E6SA 2FSAA 2KFTA 2LGVA 5FB1A 3ZVYA 2IDAA 4WA6A 2YSJA 3N9PA 4LKAA 5LKZA 4S3OB 2RI7A 3LRQA 4AUQB 2UZGA 4ZUXU 3EB5A 2M85A 2LGLA 1DVPA 4N3WA 4YABA 4FO9A 2DX8A 4O64A 4UP0A 4Q6FA 2LDRA 4MSXA 3ZPVE 3MHHA 4GNDA 1CHCA 1WFKA 4LK9A 4W4UA 2D8SA 5B79A 5LCWB 2JMJA 2AN6A 3QZVA 4IC2A 2KIZA 3LQIA 1X4JA 2PNXA 4AYCA 2H0DA 3ASLA 2VPGA 4YADA 4TKPB 5DKAA 3M62A 1JOCA 5B78A 4ZQLA 2CSZA 1WEPA 2YUCA 3O7AA 4GB0A 5H1TA 4B86C 2CKLA 2C2VS 2MD8C 1E4UA 2QICA 2MA6A 4IC3A 2VJEB 3HCTA 2KYUA 1VD4A 4ZDTA 4QF3A 4I7BA 1WEUA 2BAYA 3N9QA 4R7EA 1WEQA 5D1MB 2K16A 5TDRA 2KU3A 4WZ3B 5DINA 1WEOA 3I2DA 3SOWA 2EA6A 5B76A 4GNGA 3KV6A 3GL6A 2YREA 4QF2A 3V43A 3SOUA 2L0BA 2NAAA 5G0FA 1F62A 2VP7A 3M63A 1T1HA 1VFYA 4WZ2A 1Z2QA 3RTRB 4YBMA 4S3OC 5J3XA 1FP0A 2YYRA 2K4DA 4UP5A 2FUUA 4PTBA 1X4UA 2HDPA 1G25A 3U5OA 3M99A 2KWNA 1WENA 3U5MA 3DQVR 2EGPA 1N87A 4CCGX 3ZNIA 4WZ0A 1BORA 5FERA 1K2FA 5TBNA 2YT5A 1MM3A 1WESA 4R8PK 4A0CD 5LKTA 4YBTA 4AYCB 2H0DB 5TABA 2L80A 2LRIC 2MD7B 2YU4A 2VJFA 5EYAF 2K17A 4B7YC 3EB6A 3HCUA 2KWOA 2VNFA 3HTKC 2ECIA 5FB0A 4YBSA 4X3GA 3T7LA 2CKLB 2L75A 2ECWA 1HYIA 1V87A 3ZPV1 1WEVA 5TDWA 2YQLA 2LXHC 2LN0A 3N9LA 2FUIA 1RMDA 2EODA 2I50A 5C13A 2ECNA 2MA5A 2G45A 2LGKA 4R2YA 2KE1A 5H9MA 2XEUA 2ECTA 2KWKA 2ECJA 3VK6A 3ZTGA 1ZBDB 5FEYA 2OXQC 1Z60A 2ZETC 3N9OA 4AP4A 5KH7A 3L11A 5I3LA 2KGGA 2VPBA 1IYMA 2KWJA 2K1JA 2YW8A 3O33A 2ECGA 4C9ZA 3U5PA 1MM2A 2C2LA 4NN2A 4YC9A 4F52B 3FL2A 4N4FA 1HYJA 5KH3A 2PUYA 2RSDA 5LKXA 2KGIA 2F6JA 5B77A 5TRBA 5C11A 5AIUA 1XWHA 2LGGA 3ZYQA 2QIZA 4FIPA 2VJFB 3RPGC 4LJNA 2L5UA 3C6WA 2CT2A 1WEMA 3N9NA 1JM7A 2M1RA 4BBQA 1LDKC 2HYED 4UI9B 1FBVA 2M6MA 2LV9A 3MHSA 5KH9A 4A4BA 4V3LC 1VYXA 3L1ZB 3RPGB 4I7DA 4A4CA 5H1UA 3T6RA 3PURA 2VPDA 3PUQA 3KQIA 3KV5A 5G04B 5LKUA 4L58A 4YAXA 4PPEA 2JRJA 3L1XA 4CA1A 4AVXA 2LQ6A 4YATA 1U6GB 2QJ0A 3DPLR 3GV4A 3C5KA 4P5OB 3ZVZB 2CSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPE A;  2XB1 A;  2MT5 A;  3O36 A;  5D1L B;  1X4I A;  2G43 A;  2JMI A;  2L43 A;  4FJC A;  4BHW A;  5B75 A;  4FK5 A;  4MVT A;  2YHO A;  2Y43 A;  4V3K C;  2F42 A;  3O70 A;  4GNE A;  3KNV A;  2MNY A;  2YQM A;  3LQJ A;  2M3H A;  3NG2 A;  5AIT A;  2MIQ A;  5H1V A;  1LDJ B;  2F6N A;  4GNF A;  2LXP C;  3O34 A;  1WIM A;  4XI1 A;  4LAD B;  5JG6 A;  2MUM A;  1WGM A;  3SHB A;  3N9M A;  3O35 A;  3LQH A;  2KRE A;  5G05 B;  2Y1N A;  2YSM A;  2YUR A;  4LLB A;  2KR4 A;  2VJE A;  5D1K B;  1WEW A;  1WE9 A;  1Z6U A;  5B8D A;  3HCS A;  3O37 A;  3IHP A;  1WIL A;  1WEE A;  2G6Q A;  3PHD A;  3U5N A;  2MNZ A;  4A49 A;  2Y1M A;  2YHN A;  1JM7 B;  2ECV A;  4I7C A;  2E6R A;  4L7X A;  3SOX A;  2JMD A;  2E6S A;  2FSA A;  2KFT A;  2LGV A;  5FB1 A;  3ZVY A;  2IDA A;  4WA6 A;  2YSJ A;  3N9P A;  4LKA A;  5LKZ A;  4S3O B;  2RI7 A;  3LRQ A;  4AUQ B;  2UZG A;  4ZUX U;  3EB5 A;  2M85 A;  2LGL A;  1DVP A;  4N3W A;  4YAB A;  4FO9 A;  2DX8 A;  4O64 A;  4UP0 A;  4Q6F A;  2LDR A;  4MSX A;  3ZPV E;  3MHH A;  4GND A;  1CHC A;  1WFK A;  4LK9 A;  4W4U A;  2D8S A;  5B79 A;  5LCW B;  2JMJ A;  2AN6 A;  3QZV A;  4IC2 A;  2KIZ A;  3LQI A;  1X4J A;  2PNX A;  4AYC A;  2H0D A;  3ASL A;  2VPG A;  4YAD A;  4TKP B;  5DKA A;  3M62 A;  1JOC A;  5B78 A;  4ZQL A;  2CSZ A;  1WEP A;  2YUC A;  3O7A A;  4GB0 A;  5H1T A;  4B86 C;  2CKL A;  2C2V S;  2MD8 C;  1E4U A;  2QIC A;  2MA6 A;  4IC3 A;  2VJE B;  3HCT A;  2KYU A;  1VD4 A;  4ZDT A;  4QF3 A;  4I7B A;  1WEU A;  2BAY A;  3N9Q A;  4R7E A;  1WEQ A;  5D1M B;  2K16 A;  5TDR A;  2KU3 A;  4WZ3 B;  5DIN A;  1WEO A;  3I2D A;  3SOW A;  2EA6 A;  5B76 A;  4GNG A;  3KV6 A;  3GL6 A;  2YRE A;  4QF2 A;  3V43 A;  3SOU A;  2L0B A;  2NAA A;  5G0F A;  1F62 A;  2VP7 A;  3M63 A;  1T1H A;  1VFY A;  4WZ2 A;  1Z2Q A;  3RTR B;  4YBM A;  4S3O C;  5J3X A;  1FP0 A;  2YYR A;  2K4D A;  4UP5 A;  2FUU A;  4PTB A;  1X4U A;  2HDP A;  1G25 A;  3U5O A;  3M99 A;  2KWN A;  1WEN A;  3U5M A;  3DQV R;  2EGP A;  1N87 A;  4CCG X;  3ZNI A;  4WZ0 A;  1BOR A;  5FER A;  1K2F A;  5TBN A;  2YT5 A;  1MM3 A;  1WES A;  4R8P K;  4A0C D;  5LKT A;  4YBT A;  4AYC B;  2H0D B;  5TAB A;  2L80 A;  2LRI C;  2MD7 B;  2YU4 A;  2VJF A;  5EYA F;  2K17 A;  4B7Y C;  3EB6 A;  3HCU A;  2KWO A;  2VNF A;  3HTK C;  2ECI A;  5FB0 A;  4YBS A;  4X3G A;  3T7L A;  2CKL B;  2L75 A;  2ECW A;  1HYI A;  1V87 A;  3ZPV 1;  1WEV A;  5TDW A;  2YQL A;  2LXH C;  2LN0 A;  3N9L A;  2FUI A;  1RMD A;  2EOD A;  2I50 A;  5C13 A;  2ECN A;  2MA5 A;  2G45 A;  2LGK A;  4R2Y A;  2KE1 A;  5H9M A;  2XEU A;  2ECT A;  2KWK A;  2ECJ A;  3VK6 A;  3ZTG A;  1ZBD B;  5FEY A;  2OXQ C;  1Z60 A;  2ZET C;  3N9O A;  4AP4 A;  5KH7 A;  3L11 A;  5I3L A;  2KGG A;  2VPB A;  1IYM A;  2KWJ A;  2K1J A;  2YW8 A;  3O33 A;  2ECG A;  4C9Z A;  3U5P A;  1MM2 A;  2C2L A;  4NN2 A;  4YC9 A;  4F52 B;  3FL2 A;  4N4F A;  1HYJ A;  5KH3 A;  2PUY A;  2RSD A;  5LKX A;  2KGI A;  2F6J A;  5B77 A;  5TRB A;  5C11 A;  5AIU A;  1XWH A;  2LGG A;  3ZYQ A;  2QIZ A;  4FIP A;  2VJF B;  3RPG C;  4LJN A;  2L5U A;  3C6W A;  2CT2 A;  1WEM A;  3N9N A;  1JM7 A;  2M1R A;  4BBQ A;  1LDK C;  2HYE D;  4UI9 B;  1FBV A;  2M6M A;  2LV9 A;  3MHS A;  5KH9 A;  4A4B A;  4V3L C;  1VYX A;  3L1Z B;  3RPG B;  4I7D A;  4A4C A;  5H1U A;  3T6R A;  3PUR A;  2VPD A;  3PUQ A;  3KQI A;  3KV5 A;  5G04 B;  5LKU A;  4L58 A;  4YAX A;  4PPE A;  2JRJ A;  3L1X A;  4CA1 A;  4AVX A;  2LQ6 A;  4YAT A;  1U6G B;  2QJ0 A;  3DPL R;  3GV4 A;  3C5K A;  4P5O B;  3ZVZ B;  2CSY A; 
#chains in the Genus database with same CATH topology
 2VPE A;  2XB1 A;  2MT5 A;  3O36 A;  5D1L B;  1X4I A;  2G43 A;  2JMI A;  2L43 A;  4FJC A;  4BHW A;  5B75 A;  4FK5 A;  4MVT A;  2LAU A;  2YHO A;  2Y43 A;  4V3K C;  2F42 A;  3O70 A;  4GNE A;  3KNV A;  2MNY A;  2YQM A;  2IQJ A;  3LQJ A;  2M3H A;  3NG2 A;  4F1P A;  5AIT A;  2MIQ A;  5H1V A;  1LDJ B;  2F6N A;  4GNF A;  2LXP C;  3O34 A;  1WIM A;  4XI1 A;  4LAD B;  5JG6 A;  2MUM A;  1WGM A;  3N9M A;  3O35 A;  3SHB A;  4OGE A;  3LQH A;  2KRE A;  5G05 B;  2DJA A;  2Y1N A;  2YSM A;  5SVI B;  2YUR A;  4LLB A;  2KR4 A;  2VJE A;  2OWA A;  5D1K B;  1WEW A;  1WE9 A;  1Z6U A;  5B8D A;  3HCS A;  3H7H A;  3O37 A;  3IHP A;  1WIL A;  1WEE A;  2G6Q A;  3PHD A;  3U5N A;  2MNZ A;  4A49 A;  2Y1M A;  2YHN A;  1JM7 B;  2ECV A;  2XOY A;  2CRW A;  4I7C A;  2E6R A;  3FM8 C;  4L7X A;  3SOX A;  2JMD A;  2RR4 A;  2E6S A;  2M13 A;  2B0O E;  2FSA A;  2KFT A;  2LGV A;  3JUE A;  5FB1 A;  3ZVY A;  2IDA A;  4WA6 A;  2YSJ A;  3N9P A;  4LKA A;  5LKZ A;  4S3O B;  2RI7 A;  3LRQ A;  4AUQ B;  2UZG A;  4ZUX U;  3EB5 A;  2M85 A;  2LGL A;  1DVP A;  4N3W A;  4YAB A;  4FO9 A;  2DX8 A;  3FAN A;  4O64 A;  4UP0 A;  4Q6F A;  2LDR A;  4MSX A;  3ZPV E;  3MHH A;  4GND A;  1CHC A;  1WFK A;  4LK9 A;  4W4U A;  2D8S A;  5B79 A;  5LCW B;  2JMJ A;  2AN6 A;  3QZV A;  4IC2 A;  2MKE A;  2KIZ A;  3LQI A;  1X4J A;  2KKX A;  2PNX A;  4AYC A;  2H0D A;  3ASL A;  2VPG A;  4YAD A;  4TKP B;  5DKA A;  3M62 A;  2XP0 A;  1JOC A;  5B78 A;  3LVQ E;  4ZQL A;  2CSZ A;  3PLW A;  1WEP A;  2YUC A;  3O7A A;  4GB0 A;  5H1T A;  4B86 C;  2XOC A;  2CKL A;  2C2V S;  2MD8 C;  1E4U A;  2QIC A;  2MA6 A;  4IC3 A;  5K3Q A;  2VJE B;  3HCT A;  2KYU A;  1VD4 A;  4ZDT A;  4QF3 A;  3DDT A;  4I7B A;  1WEU A;  2BAY A;  3N9Q A;  4R7E A;  1WEQ A;  5D1M B;  2K16 A;  5SVY A;  5TDR A;  2KU3 A;  4WZ3 B;  5DIN A;  1WEO A;  3I2D A;  3SOW A;  2EA6 A;  5B76 A;  1DCQ A;  4GNG A;  3KV6 A;  3GL6 A;  2YRE A;  4QF2 A;  3V43 A;  3SOU A;  2L0B A;  3FAO A;  2P57 A;  2NAA A;  2L7P A;  5G0F A;  1F62 A;  2VP7 A;  3M63 A;  1T1H A;  1VFY A;  4WZ2 A;  1Z2Q A;  3RTR B;  4YBM A;  4S3O C;  5J3X A;  2JUN A;  2EGM A;  1FP0 A;  2YYR A;  2K4D A;  4UP5 A;  2FUU A;  4PTB A;  1X4U A;  2HDP A;  1G25 A;  3U5O A;  3M99 A;  2KWN A;  1WEN A;  3U5M A;  3DQV R;  3LVR E;  2EGP A;  4Z0O A;  1N87 A;  4CCG X;  3ZNI A;  4WZ0 A;  3KDE C;  1BOR A;  3M7K A;  5FER A;  1K2F A;  5TBN A;  2YT5 A;  1MM3 A;  1WES A;  4R8P K;  4A0C D;  5LKT A;  4YBT A;  4AYC B;  2H0D B;  5TAB A;  2L80 A;  2LRI C;  2MD7 B;  2YU4 A;  2VJF A;  5EYA F;  2K17 A;  4B7Y C;  3EB6 A;  3HCU A;  2KWO A;  2VNF A;  3HTK C;  3MDB C;  2ECI A;  5FB0 A;  4YBS A;  4X3G A;  2E61 A;  3T7L A;  2CKL B;  2L75 A;  2ECW A;  1HYI A;  1V87 A;  3ZPV 1;  1WEV A;  3SUB A;  5TDW A;  2YQL A;  2LXH C;  2LN0 A;  3T9K A;  3N9L A;  2FUI A;  1RMD A;  2EOD A;  2I50 A;  5C13 A;  3LJU X;  2ECN A;  2MA5 A;  2G45 A;  3O47 A;  2LGK A;  4R2Y A;  2KE1 A;  5H9M A;  4O62 A;  2XEU A;  5SVX A;  2ECT A;  2KWK A;  2ECJ A;  3VK6 A;  3ZTG A;  1ZBD B;  2CRR A;  2OXQ C;  5FEY A;  1Z60 A;  2ZET C;  3N9O A;  4AP4 A;  3FJU B;  5KH7 A;  2FFW A;  3L11 A;  5I3L A;  2DSM A;  2KGG A;  2VPB A;  1IYM A;  2YVR A;  4QQ4 A;  3FEH A;  2KKY A;  2KWJ A;  2K1J A;  3LDY A;  2EXU A;  2YW8 A;  3O33 A;  2ECG A;  2D8U A;  4C9Z A;  3U5P A;  1MM2 A;  2C2L A;  5SVI A;  4NN2 A;  4YC9 A;  4F52 B;  3FL2 A;  4N4F A;  1HYJ A;  5KH3 A;  2PUY A;  2RSD A;  5LKX A;  2KGI A;  2F6J A;  5B77 A;  4Z0R A;  5TRB A;  5C11 A;  2JM3 A;  5AIU A;  1XWH A;  2LGG A;  3ZYQ A;  2QIZ A;  4H9D A;  4FIP A;  2VJF B;  3RPG C;  4LJN A;  2L5U A;  2XOZ A;  3C6W A;  2CT2 A;  1WEM A;  3N9N A;  1JM7 A;  2FD4 A;  2M1R A;  4BBQ A;  1LDK C;  2HYE D;  4UI9 B;  1FBV A;  2M6M A;  2CON A;  2LV9 A;  1MBM A;  3MHS A;  5KH9 A;  4A4B A;  4V3L C;  1VYX A;  3L1Z B;  3E2D A;  3RPG B;  4I7D A;  4A4C A;  2CSV A;  5H1U A;  3T6R A;  3PUR A;  3Q1D A;  2VPD A;  3PUQ A;  3KQI A;  3KV5 A;  5G04 B;  5LKU A;  4L58 A;  4YAX A;  4OGC A;  4PPE A;  2JRJ A;  3L1X A;  4CA1 A;  4AVX A;  2LQ6 A;  4YAT A;  1U6G B;  2QJ0 A;  3DWD A;  3DPL R;  3GV4 A;  3C5K A;  4P5O B;  3ZVZ B;  2CSY A; 
#chains in the Genus database with same CATH homology
 2VPE A;  2XB1 A;  2MT5 A;  3O36 A;  5D1L B;  1X4I A;  2G43 A;  2JMI A;  2L43 A;  4FJC A;  4BHW A;  5B75 A;  4FK5 A;  4MVT A;  2YHO A;  2Y43 A;  4V3K C;  2F42 A;  3O70 A;  4GNE A;  3KNV A;  2MNY A;  2YQM A;  3LQJ A;  2M3H A;  3NG2 A;  5AIT A;  2MIQ A;  5H1V A;  1LDJ B;  2F6N A;  4GNF A;  2LXP C;  3O34 A;  1WIM A;  4XI1 A;  4LAD B;  5JG6 A;  2MUM A;  1WGM A;  3SHB A;  3N9M A;  3O35 A;  3LQH A;  2KRE A;  5G05 B;  2Y1N A;  2YSM A;  2YUR A;  4LLB A;  2KR4 A;  2VJE A;  5D1K B;  1WEW A;  1WE9 A;  1Z6U A;  5B8D A;  3HCS A;  3O37 A;  3IHP A;  1WIL A;  1WEE A;  2G6Q A;  3PHD A;  3U5N A;  2MNZ A;  4A49 A;  2Y1M A;  2YHN A;  1JM7 B;  2ECV A;  4I7C A;  2E6R A;  4L7X A;  3SOX A;  2JMD A;  2E6S A;  2FSA A;  2KFT A;  2LGV A;  5FB1 A;  3ZVY A;  2IDA A;  4WA6 A;  2YSJ A;  3N9P A;  4LKA A;  5LKZ A;  4S3O B;  2RI7 A;  3LRQ A;  4AUQ B;  2UZG A;  4ZUX U;  3EB5 A;  2M85 A;  2LGL A;  1DVP A;  4N3W A;  4YAB A;  4FO9 A;  2DX8 A;  4O64 A;  4UP0 A;  4Q6F A;  2LDR A;  4MSX A;  3ZPV E;  3MHH A;  4GND A;  1CHC A;  1WFK A;  4LK9 A;  4W4U A;  2D8S A;  5B79 A;  5LCW B;  2JMJ A;  2AN6 A;  3QZV A;  4IC2 A;  2KIZ A;  3LQI A;  1X4J A;  2PNX A;  4AYC A;  2H0D A;  3ASL A;  2VPG A;  4YAD A;  4TKP B;  5DKA A;  3M62 A;  1JOC A;  5B78 A;  4ZQL A;  2CSZ A;  1WEP A;  2YUC A;  3O7A A;  4GB0 A;  5H1T A;  4B86 C;  2CKL A;  2C2V S;  2MD8 C;  1E4U A;  2QIC A;  2MA6 A;  4IC3 A;  2VJE B;  3HCT A;  2KYU A;  1VD4 A;  4ZDT A;  4QF3 A;  4I7B A;  1WEU A;  2BAY A;  3N9Q A;  4R7E A;  1WEQ A;  5D1M B;  2K16 A;  5TDR A;  2KU3 A;  4WZ3 B;  5DIN A;  1WEO A;  3I2D A;  3SOW A;  2EA6 A;  5B76 A;  4GNG A;  3KV6 A;  3GL6 A;  2YRE A;  4QF2 A;  3V43 A;  3SOU A;  2L0B A;  2NAA A;  5G0F A;  1F62 A;  2VP7 A;  3M63 A;  1T1H A;  1VFY A;  4WZ2 A;  1Z2Q A;  3RTR B;  4YBM A;  4S3O C;  5J3X A;  1FP0 A;  2YYR A;  2K4D A;  4UP5 A;  2FUU A;  4PTB A;  1X4U A;  2HDP A;  1G25 A;  3U5O A;  3M99 A;  2KWN A;  1WEN A;  3U5M A;  3DQV R;  2EGP A;  1N87 A;  4CCG X;  3ZNI A;  4WZ0 A;  1BOR A;  5FER A;  1K2F A;  5TBN A;  2YT5 A;  1MM3 A;  1WES A;  4R8P K;  4A0C D;  5LKT A;  4YBT A;  4AYC B;  2H0D B;  5TAB A;  2L80 A;  2LRI C;  2MD7 B;  2YU4 A;  2VJF A;  5EYA F;  2K17 A;  4B7Y C;  3EB6 A;  3HCU A;  2KWO A;  2VNF A;  3HTK C;  2ECI A;  5FB0 A;  4YBS A;  4X3G A;  3T7L A;  2CKL B;  2L75 A;  2ECW A;  1HYI A;  1V87 A;  3ZPV 1;  1WEV A;  5TDW A;  2YQL A;  2LXH C;  2LN0 A;  3N9L A;  2FUI A;  1RMD A;  2EOD A;  2I50 A;  5C13 A;  2ECN A;  2MA5 A;  2G45 A;  2LGK A;  4R2Y A;  2KE1 A;  5H9M A;  2XEU A;  2ECT A;  2KWK A;  2ECJ A;  3VK6 A;  3ZTG A;  1ZBD B;  5FEY A;  2OXQ C;  1Z60 A;  2ZET C;  3N9O A;  4AP4 A;  5KH7 A;  3L11 A;  5I3L A;  2KGG A;  2VPB A;  1IYM A;  2KWJ A;  2K1J A;  2YW8 A;  3O33 A;  2ECG A;  4C9Z A;  3U5P A;  1MM2 A;  2C2L A;  4NN2 A;  4YC9 A;  4F52 B;  3FL2 A;  4N4F A;  1HYJ A;  5KH3 A;  2PUY A;  2RSD A;  5LKX A;  2KGI A;  2F6J A;  5B77 A;  5TRB A;  5C11 A;  5AIU A;  1XWH A;  2LGG A;  3ZYQ A;  2QIZ A;  4FIP A;  2VJF B;  3RPG C;  4LJN A;  2L5U A;  3C6W A;  2CT2 A;  1WEM A;  3N9N A;  1JM7 A;  2M1R A;  4BBQ A;  1LDK C;  2HYE D;  4UI9 B;  1FBV A;  2M6M A;  2LV9 A;  3MHS A;  5KH9 A;  4A4B A;  4V3L C;  1VYX A;  3L1Z B;  3RPG B;  4I7D A;  4A4C A;  5H1U A;  3T6R A;  3PUR A;  2VPD A;  3PUQ A;  3KQI A;  3KV5 A;  5G04 B;  5LKU A;  4L58 A;  4YAX A;  4PPE A;  2JRJ A;  3L1X A;  4CA1 A;  4AVX A;  2LQ6 A;  4YAT A;  1U6G B;  2QJ0 A;  3DPL R;  3GV4 A;  3C5K A;  4P5O B;  3ZVZ B;  2CSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...