4QF2A

Crystal structure of human baz2a phd zinc finger in the free form
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
total genus 8
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4qf2A00
4PPEA 4YC9A 4NN2A 4QF2A 3QZVA 2CKLA 2KYUA 2ECTA 3KQIA 4WZ0A 3DQVR 3LQIA 4N3WA 1K2FA 1Z2QA 4BHWA 2YHOA 1WEVA 5C11A 5J3XA 2Y43A 4I7DA 3U5MA 1RMDA 2MIQA 5B8DA 2YHNA 3KV5A 3L1XA 1MM2A 1WEQA 2LGGA 1E4UA 3N9QA 4R8PK 3LRQA 1V87A 4W4UA 1VFYA 1JOCA 4XI1A 4I7CA 2F42A 3N9OA 1WENA 2PUYA 4AYCA 2ECNA 2L5UA 3N9PA 2MA5A 1WEOA 2YT5A 1G25A 2F6JA 4V3LC 2LDRA 4I7BA 4FJCA 5B77A 4WZ2A 3O70A 4P5OB 5TABA 2DX8A 2KE1A 4YADA 3VK6A 4WZ3B 3KNVA 3N9NA 4ZDTA 2YQMA 2EGPA 2M85A 2VNFA 2EODA 4YATA 1DVPA 1IYMA 3LQJA 4YBSA 3MHSA 4AP4A 4R2YA 2C2LA 2YQLA 4C9ZA 3RPGC 3SOXA 2I50A 1WILA 1MM3A 3O36A 2CSYA 1X4IA 2AN6A 1Z60A 1WEUA 1FP0A 2MT5A 2JRJA 4UP0A 2Y1MA 2KGGA 2L75A 5JG6A 4IC3A 5B76A 1LDJB 2H0DB 1HYIA 2M3HA 3ZPVE 1BORA 4A0CD 2Y1NA 2YURA 3L1ZB 1X4JA 2KWKA 2JMDA 5LCWB 2XEUA 2FUIA 4FK5A 5LKUA 3NG2A 3ZVYA 4R7EA 1WIMA 5I3LA 5FB1A 2EA6A 2L43A 5C13A 2MUMA 3PURA 5TDWA 4AUQB 4F52B 2MD8C 2VJEB 3HCUA 3KV6A 4QF3A 4YBTA 3HCTA 3ZTGA 2ECJA 1JM7A 2L80A 5FERA 2LXHC 1CHCA 4UI9B 3V43A 3GL6A 2K1JA 3N9LA 4CA1A 1WE9A 2G6QA 3U5NA 4LJNA 5AITA 4WA6A 4AVXA 4Q6FA 3O35A 2BAYA 2FSAA 1WEWA 4GB0A 2LGVA 2UZGA 2YU4A 3SHBA 3C6WA 5H1UA 2QICA 2G43A 3O7AA 3O37A 4GNGA 5FEYA 2LXPC 3M99A 5TDRA 3M62A 4GNFA 5H1VA 4LKAA 2YUCA 4IC2A 4LK9A 2LV9A 2VPEA 3DPLR 5AIUA 2CT2A 1WESA 5H9MA 2VJFA 2KR4A 2ECIA 1XWHA 5LKZA 5TRBA 3HCSA 2KIZA 4N4FA 3GV4A 2K17A 5B79A 2K16A 3LQHA 3ZVZB 2PNXA 3EB5A 4YBMA 3O34A 1U6GB 4GNEA 3ZYQA 2CKLB 4LADB 2M6MA 2OXQC 5DKAA 2MNZA 3T7LA 2KREA 5EYAF 2RI7A 3ZNIA 4O64A 2KWOA 4AYCB 3SOUA 4S3OB 1X4UA 2ZETC 4TKPB 4ZUXU 3IHPA 2LGKA 2YW8A 5D1KB 2LRIC 4FIPA 5G05B 3N9MA 5D1LB 4A49A 1JM7B 2VPBA 3HTKC 2LGLA 4L58A 3ZPV1 1HYJA 1T1HA 4L7XA 4MVTA 3C5KA 2M1RA 2JMJA 2H0DA 3I2DA 2VPGA 1WFKA 5KH9A 5DINA 4GNDA 3L11A 2VJEA 2VPDA 4LLBA 5D1MB 4A4CA 2C2VS 4PTBA 1WEEA 2VP7A 2LN0A 2NAAA 5KH3A 5LKTA 5G04B 5FB0A 3EB6A 3U5PA 2QJ0A 2JMIA 2YYRA 3FL2A 3RPGB 2F6NA 1VYXA 2KU3A 4B86C 3PHDA 5KH7A 1FBVA 2KWNA 4YAXA 5B78A 3RTRB 2QIZA 2G45A 3M63A 3T6RA 4FO9A 4YABA 1VD4A 2RSDA 1Z6UA 2YSJA 2KGIA 3MHHA 2KWJA 2ECVA 3ASLA 2YSMA 2MNYA 2CSZA 4UP5A 4V3KC 2VJFB 2ECWA 5B75A 1LDKC 2HDPA 2K4DA 1ZBDB 2E6RA 1F62A 5H1TA 1WEMA 3U5OA 4A4BA 2D8SA 1N87A 2YREA 2L0BA 2LQ6A 3PUQA 2HYED 2E6SA 2MD7B 4S3OC 1WEPA 4MSXA 2XB1A 4X3GA 5LKXA 3O33A 3SOWA 2FUUA 1WGMA 4BBQA 2KFTA 4ZQLA 2MA6A 4CCGX 2ECGA 2IDAA 5G0FA 5TBNA 4B7YC
chains in the Genus database with same CATH superfamily
2XOCA 3MDBC 4PPEA 4YC9A 2XP0A 4NN2A 4QF2A 3QZVA 2CKLA 4Z0RA 2KYUA 2ECTA 3KQIA 4WZ0A 3DQVR 3FEHA 3LQIA 4N3WA 1K2FA 1Z2QA 3T9KA 3SUBA 4BHWA 2YHOA 2B0OE 1WEVA 5C11A 5J3XA 2Y43A 4I7DA 3U5MA 1RMDA 2MIQA 2MKEA 5B8DA 2YHNA 3KV5A 3L1XA 1MM2A 2DJAA 1WEQA 2LGGA 2P57A 1E4UA 3N9QA 4R8PK 3LRQA 1V87A 4W4UA 3O47A 3PLWA 1VFYA 1JOCA 4XI1A 4I7CA 2F42A 2CRWA 3N9OA 1WENA 2PUYA 4AYCA 2ECNA 2L5UA 3N9PA 2MA5A 1WEOA 2YT5A 3KDEC 1G25A 2F6JA 4V3LC 2LDRA 4I7BA 4FJCA 2LAUA 5B77A 4WZ2A 2EGMA 3O70A 4P5OB 5TABA 2IQJA 2DX8A 2KE1A 4YADA 3VK6A 3FJUB 4WZ3B 3KNVA 3N9NA 4ZDTA 2YQMA 2EGPA 2M85A 2VNFA 2EODA 4YATA 1DVPA 1IYMA 3LQJA 3LVQE 4YBSA 3MHSA 4AP4A 4R2YA 2C2LA 2YQLA 4C9ZA 3RPGC 4Z0OA 3Q1DA 3SOXA 2I50A 1WILA 1MM3A 3O36A 2CSYA 1X4IA 2AN6A 1Z60A 1WEUA 1FP0A 2MT5A 2JRJA 4UP0A 2Y1MA 2KGGA 2DSMA 2L75A 5JG6A 4IC3A 5B76A 2XOYA 1LDJB 2H0DB 1HYIA 2M3HA 4OGEA 3ZPVE 1BORA 4A0CD 2Y1NA 4QQ4A 2YURA 3L1ZB 2OWAA 1X4JA 5SVXA 2KWKA 2JMDA 5LCWB 2XEUA 2FUIA 2E61A 4FK5A 5LKUA 3NG2A 3ZVYA 4R7EA 1WIMA 5I3LA 5FB1A 2EA6A 2L43A 5C13A 2MUMA 3PURA 5TDWA 4AUQB 2XOZA 4F52B 2MD8C 2VJEB 3HCUA 3KV6A 4QF3A 4YBTA 3HCTA 3ZTGA 3LVRE 2ECJA 1JM7A 2L80A 5FERA 2LXHC 1CHCA 4UI9B 3V43A 3GL6A 2K1JA 3N9LA 4CA1A 1WE9A 2G6QA 3FM8C 3U5NA 4LJNA 5SVIA 5AITA 4WA6A 4AVXA 4Q6FA 3O35A 2BAYA 2FSAA 1WEWA 4GB0A 2LGVA 2UZGA 2YU4A 3SHBA 3C6WA 5H1UA 2QICA 2G43A 3O7AA 3O37A 4GNGA 5FEYA 2LXPC 3M99A 5TDRA 3M62A 4GNFA 5H1VA 4LKAA 2YUCA 4IC2A 4LK9A 2LV9A 2VPEA 3DPLR 5AIUA 3FAOA 2CT2A 1WESA 5H9MA 2VJFA 2KR4A 2RR4A 2ECIA 1XWHA 2YVRA 5LKZA 5TRBA 3HCSA 3E2DA 2KIZA 4N4FA 3GV4A 2K17A 2K16A 5B79A 3LQHA 3ZVZB 2PNXA 3EB5A 4YBMA 3O34A 1U6GB 2KKYA 4GNEA 5SVYA 3ZYQA 2CKLB 4LADB 5K3QA 2M6MA 2OXQC 5DKAA 2MNZA 3T7LA 2KREA 5EYAF 2RI7A 3JUEA 3ZNIA 4O64A 3M7KA 2KWOA 4AYCB 3SOUA 4S3OB 1X4UA 2ZETC 3DWDA 2D8UA 4TKPB 4ZUXU 3IHPA 2LGKA 2YW8A 5D1KB 2LRIC 4FIPA 1DCQA 5G05B 3N9MA 5D1LB 4A49A 1JM7B 2VPBA 3HTKC 2LGLA 2CRRA 4L58A 3ZPV1 3DDTA 1HYJA 1T1HA 4L7XA 4MVTA 3C5KA 2M1RA 2JMJA 2H0DA 3I2DA 2VPGA 1WFKA 5KH9A 2JM3A 2KKXA 5DINA 4GNDA 3L11A 2VJEA 2VPDA 4LLBA 5D1MB 4A4CA 2C2VS 4PTBA 1WEEA 2VP7A 2LN0A 2NAAA 5KH3A 2M13A 5LKTA 5G04B 3LDYA 5FB0A 3EB6A 2CONA 3U5PA 2QJ0A 2JMIA 4OGCA 2YYRA 3FL2A 3RPGB 2F6NA 1VYXA 2KU3A 4B86C 3PHDA 5KH7A 1FBVA 4F1PA 2KWNA 4YAXA 5B78A 3RTRB 2QIZA 2G45A 3M63A 3T6RA 4FO9A 4YABA 1VD4A 2RSDA 1MBMA 2L7PA 1Z6UA 2YSJA 2KGIA 2EXUA 3MHHA 3H7HA 2KWJA 2ECVA 3ASLA 2YSMA 2FFWA 2MNYA 3FANA 2CSZA 2FD4A 4UP5A 4V3KC 2VJFB 2ECWA 5B75A 1LDKC 2HDPA 2K4DA 1ZBDB 2E6RA 1F62A 5H1TA 1WEMA 3U5OA 4A4BA 2D8SA 1N87A 2YREA 2L0BA 2LQ6A 3PUQA 2CSVA 2HYED 5SVIB 2E6SA 2MD7B 4S3OC 1WEPA 3LJUX 4O62A 4MSXA 2XB1A 4H9DA 4X3GA 5LKXA 3O33A 3SOWA 2FUUA 1WGMA 4ZQLA 2KFTA 4BBQA 2MA6A 2IDAA 2ECGA 5G0FA 4CCGX 2JUNA 5TBNA 4B7YC
chains in the Genus database with same CATH topology
4PPEA 4YC9A 4NN2A 4QF2A 3QZVA 2CKLA 2KYUA 2ECTA 3KQIA 4WZ0A 3DQVR 3LQIA 4N3WA 1K2FA 1Z2QA 4BHWA 2YHOA 1WEVA 5C11A 5J3XA 2Y43A 4I7DA 3U5MA 1RMDA 2MIQA 5B8DA 2YHNA 3KV5A 3L1XA 1MM2A 1WEQA 2LGGA 1E4UA 3N9QA 4R8PK 3LRQA 1V87A 4W4UA 1VFYA 1JOCA 4XI1A 4I7CA 2F42A 3N9OA 1WENA 2PUYA 4AYCA 2ECNA 2L5UA 3N9PA 2MA5A 1WEOA 2YT5A 1G25A 2F6JA 4V3LC 2LDRA 4I7BA 4FJCA 5B77A 4WZ2A 3O70A 4P5OB 5TABA 2DX8A 2KE1A 4YADA 3VK6A 4WZ3B 3KNVA 3N9NA 4ZDTA 2YQMA 2EGPA 2M85A 2VNFA 2EODA 4YATA 1DVPA 1IYMA 3LQJA 4YBSA 3MHSA 4AP4A 4R2YA 2C2LA 2YQLA 4C9ZA 3RPGC 3SOXA 2I50A 1WILA 1MM3A 3O36A 2CSYA 1X4IA 2AN6A 1Z60A 1WEUA 1FP0A 2MT5A 2JRJA 4UP0A 2Y1MA 2KGGA 2L75A 5JG6A 4IC3A 5B76A 1LDJB 2H0DB 1HYIA 2M3HA 3ZPVE 1BORA 4A0CD 2Y1NA 2YURA 3L1ZB 1X4JA 2KWKA 2JMDA 5LCWB 2XEUA 2FUIA 4FK5A 5LKUA 3NG2A 3ZVYA 4R7EA 1WIMA 5I3LA 5FB1A 2EA6A 2L43A 5C13A 2MUMA 3PURA 5TDWA 4AUQB 4F52B 2MD8C 2VJEB 3HCUA 3KV6A 4QF3A 4YBTA 3HCTA 3ZTGA 2ECJA 1JM7A 2L80A 5FERA 2LXHC 1CHCA 4UI9B 3V43A 3GL6A 2K1JA 3N9LA 4CA1A 1WE9A 2G6QA 3U5NA 4LJNA 5AITA 4WA6A 4AVXA 4Q6FA 3O35A 2BAYA 2FSAA 1WEWA 4GB0A 2LGVA 2UZGA 2YU4A 3SHBA 3C6WA 5H1UA 2QICA 2G43A 3O7AA 3O37A 4GNGA 5FEYA 2LXPC 3M99A 5TDRA 3M62A 4GNFA 5H1VA 4LKAA 2YUCA 4IC2A 4LK9A 2LV9A 2VPEA 3DPLR 5AIUA 2CT2A 1WESA 5H9MA 2VJFA 2KR4A 2ECIA 1XWHA 5LKZA 5TRBA 3HCSA 2KIZA 4N4FA 3GV4A 2K17A 5B79A 2K16A 3LQHA 3ZVZB 2PNXA 3EB5A 4YBMA 3O34A 1U6GB 4GNEA 3ZYQA 2CKLB 4LADB 2M6MA 2OXQC 5DKAA 2MNZA 3T7LA 2KREA 5EYAF 2RI7A 3ZNIA 4O64A 2KWOA 4AYCB 3SOUA 4S3OB 1X4UA 2ZETC 4TKPB 4ZUXU 3IHPA 2LGKA 2YW8A 5D1KB 2LRIC 4FIPA 5G05B 3N9MA 5D1LB 4A49A 1JM7B 2VPBA 3HTKC 2LGLA 4L58A 3ZPV1 1HYJA 1T1HA 4L7XA 4MVTA 3C5KA 2M1RA 2JMJA 2H0DA 3I2DA 2VPGA 1WFKA 5KH9A 5DINA 4GNDA 3L11A 2VJEA 2VPDA 4LLBA 5D1MB 4A4CA 2C2VS 4PTBA 1WEEA 2VP7A 2LN0A 2NAAA 5KH3A 5LKTA 5G04B 5FB0A 3EB6A 3U5PA 2QJ0A 2JMIA 2YYRA 3FL2A 3RPGB 2F6NA 1VYXA 2KU3A 4B86C 3PHDA 5KH7A 1FBVA 2KWNA 4YAXA 5B78A 3RTRB 2QIZA 2G45A 3M63A 3T6RA 4FO9A 4YABA 1VD4A 2RSDA 1Z6UA 2YSJA 2KGIA 3MHHA 2KWJA 2ECVA 3ASLA 2YSMA 2MNYA 2CSZA 4UP5A 4V3KC 2VJFB 2ECWA 5B75A 1LDKC 2HDPA 2K4DA 1ZBDB 2E6RA 1F62A 5H1TA 1WEMA 3U5OA 4A4BA 2D8SA 1N87A 2YREA 2L0BA 2LQ6A 3PUQA 2HYED 2E6SA 2MD7B 4S3OC 1WEPA 4MSXA 2XB1A 4X3GA 5LKXA 3O33A 3SOWA 2FUUA 1WGMA 4BBQA 2KFTA 4ZQLA 2MA6A 4CCGX 2ECGA 2IDAA 5G0FA 5TBNA 4B7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPE A;  4YC9 A;  4NN2 A;  4QF2 A;  3QZV A;  2CKL A;  2KYU A;  2ECT A;  3KQI A;  4WZ0 A;  3DQV R;  3LQI A;  4N3W A;  1K2F A;  1Z2Q A;  4BHW A;  2YHO A;  1WEV A;  5C11 A;  5J3X A;  2Y43 A;  4I7D A;  3U5M A;  1RMD A;  2MIQ A;  5B8D A;  2YHN A;  3KV5 A;  3L1X A;  1MM2 A;  1WEQ A;  2LGG A;  1E4U A;  3N9Q A;  4R8P K;  3LRQ A;  1V87 A;  4W4U A;  1VFY A;  1JOC A;  4XI1 A;  4I7C A;  2F42 A;  3N9O A;  1WEN A;  2PUY A;  4AYC A;  2ECN A;  2L5U A;  3N9P A;  2MA5 A;  1WEO A;  2YT5 A;  1G25 A;  2F6J A;  4V3L C;  2LDR A;  4I7B A;  4FJC A;  5B77 A;  4WZ2 A;  3O70 A;  4P5O B;  5TAB A;  2DX8 A;  2KE1 A;  4YAD A;  3VK6 A;  4WZ3 B;  3KNV A;  3N9N A;  4ZDT A;  2YQM A;  2EGP A;  2M85 A;  2VNF A;  2EOD A;  4YAT A;  1DVP A;  1IYM A;  3LQJ A;  4YBS A;  3MHS A;  4AP4 A;  4R2Y A;  2C2L A;  2YQL A;  4C9Z A;  3RPG C;  3SOX A;  2I50 A;  1WIL A;  1MM3 A;  3O36 A;  2CSY A;  1X4I A;  2AN6 A;  1Z60 A;  1WEU A;  1FP0 A;  2MT5 A;  2JRJ A;  4UP0 A;  2Y1M A;  2KGG A;  2L75 A;  5JG6 A;  4IC3 A;  5B76 A;  1LDJ B;  2H0D B;  1HYI A;  2M3H A;  3ZPV E;  1BOR A;  4A0C D;  2Y1N A;  2YUR A;  3L1Z B;  1X4J A;  2KWK A;  2JMD A;  5LCW B;  2XEU A;  2FUI A;  4FK5 A;  5LKU A;  3NG2 A;  3ZVY A;  4R7E A;  1WIM A;  5I3L A;  5FB1 A;  2EA6 A;  2L43 A;  5C13 A;  2MUM A;  3PUR A;  5TDW A;  4AUQ B;  4F52 B;  2MD8 C;  2VJE B;  3HCU A;  3KV6 A;  4QF3 A;  4YBT A;  3HCT A;  3ZTG A;  2ECJ A;  1JM7 A;  2L80 A;  5FER A;  2LXH C;  1CHC A;  4UI9 B;  3V43 A;  3GL6 A;  2K1J A;  3N9L A;  4CA1 A;  1WE9 A;  2G6Q A;  3U5N A;  4LJN A;  5AIT A;  4WA6 A;  4AVX A;  4Q6F A;  3O35 A;  2BAY A;  2FSA A;  1WEW A;  4GB0 A;  2LGV A;  2UZG A;  2YU4 A;  3SHB A;  3C6W A;  5H1U A;  2QIC A;  2G43 A;  3O7A A;  3O37 A;  4GNG A;  5FEY A;  2LXP C;  3M99 A;  5TDR A;  3M62 A;  4GNF A;  5H1V A;  4LKA A;  2YUC A;  4IC2 A;  4LK9 A;  2LV9 A;  2VPE A;  3DPL R;  5AIU A;  2CT2 A;  1WES A;  5H9M A;  2VJF A;  2KR4 A;  2ECI A;  1XWH A;  5LKZ A;  5TRB A;  3HCS A;  2KIZ A;  4N4F A;  3GV4 A;  2K17 A;  5B79 A;  2K16 A;  3LQH A;  3ZVZ B;  2PNX A;  3EB5 A;  4YBM A;  3O34 A;  1U6G B;  4GNE A;  3ZYQ A;  2CKL B;  4LAD B;  2M6M A;  2OXQ C;  5DKA A;  2MNZ A;  3T7L A;  2KRE A;  5EYA F;  2RI7 A;  3ZNI A;  4O64 A;  2KWO A;  4AYC B;  3SOU A;  4S3O B;  1X4U A;  2ZET C;  4TKP B;  4ZUX U;  3IHP A;  2LGK A;  2YW8 A;  5D1K B;  2LRI C;  4FIP A;  5G05 B;  3N9M A;  5D1L B;  4A49 A;  1JM7 B;  2VPB A;  3HTK C;  2LGL A;  4L58 A;  3ZPV 1;  1HYJ A;  1T1H A;  4L7X A;  4MVT A;  3C5K A;  2M1R A;  2JMJ A;  2H0D A;  3I2D A;  2VPG A;  1WFK A;  5KH9 A;  5DIN A;  4GND A;  3L11 A;  2VJE A;  2VPD A;  4LLB A;  5D1M B;  4A4C A;  2C2V S;  4PTB A;  1WEE A;  2VP7 A;  2LN0 A;  2NAA A;  5KH3 A;  5LKT A;  5G04 B;  5FB0 A;  3EB6 A;  3U5P A;  2QJ0 A;  2JMI A;  2YYR A;  3FL2 A;  3RPG B;  2F6N A;  1VYX A;  2KU3 A;  4B86 C;  3PHD A;  5KH7 A;  1FBV A;  2KWN A;  4YAX A;  5B78 A;  3RTR B;  2QIZ A;  2G45 A;  3M63 A;  3T6R A;  4FO9 A;  4YAB A;  1VD4 A;  2RSD A;  1Z6U A;  2YSJ A;  2KGI A;  3MHH A;  2KWJ A;  2ECV A;  3ASL A;  2YSM A;  2MNY A;  2CSZ A;  4UP5 A;  4V3K C;  2VJF B;  2ECW A;  5B75 A;  1LDK C;  2HDP A;  2K4D A;  1ZBD B;  2E6R A;  1F62 A;  5H1T A;  1WEM A;  3U5O A;  4A4B A;  2D8S A;  1N87 A;  2YRE A;  2L0B A;  2LQ6 A;  3PUQ A;  2HYE D;  2E6S A;  2MD7 B;  4S3O C;  1WEP A;  4MSX A;  2XB1 A;  4X3G A;  5LKX A;  3O33 A;  3SOW A;  2FUU A;  1WGM A;  4BBQ A;  2KFT A;  4ZQL A;  2MA6 A;  4CCG X;  2ECG A;  2IDA A;  5G0F A;  5TBN A;  4B7Y C; 
#chains in the Genus database with same CATH topology
 2XOC A;  3MDB C;  4PPE A;  4YC9 A;  2XP0 A;  4NN2 A;  4QF2 A;  3QZV A;  2CKL A;  4Z0R A;  2KYU A;  2ECT A;  3KQI A;  4WZ0 A;  3DQV R;  3FEH A;  3LQI A;  4N3W A;  1K2F A;  1Z2Q A;  3T9K A;  3SUB A;  4BHW A;  2YHO A;  2B0O E;  1WEV A;  5C11 A;  5J3X A;  2Y43 A;  4I7D A;  3U5M A;  1RMD A;  2MIQ A;  2MKE A;  5B8D A;  2YHN A;  3KV5 A;  3L1X A;  1MM2 A;  2DJA A;  1WEQ A;  2LGG A;  2P57 A;  1E4U A;  3N9Q A;  4R8P K;  3LRQ A;  1V87 A;  4W4U A;  3O47 A;  3PLW A;  1VFY A;  1JOC A;  4XI1 A;  4I7C A;  2F42 A;  2CRW A;  3N9O A;  1WEN A;  2PUY A;  4AYC A;  2ECN A;  2L5U A;  3N9P A;  2MA5 A;  1WEO A;  2YT5 A;  3KDE C;  1G25 A;  2F6J A;  4V3L C;  2LDR A;  4I7B A;  4FJC A;  2LAU A;  5B77 A;  4WZ2 A;  2EGM A;  3O70 A;  4P5O B;  5TAB A;  2IQJ A;  2DX8 A;  2KE1 A;  4YAD A;  3VK6 A;  3FJU B;  4WZ3 B;  3KNV A;  3N9N A;  4ZDT A;  2YQM A;  2EGP A;  2M85 A;  2VNF A;  2EOD A;  4YAT A;  1DVP A;  1IYM A;  3LQJ A;  3LVQ E;  4YBS A;  3MHS A;  4AP4 A;  4R2Y A;  2C2L A;  2YQL A;  4C9Z A;  3RPG C;  4Z0O A;  3Q1D A;  3SOX A;  2I50 A;  1WIL A;  1MM3 A;  3O36 A;  2CSY A;  1X4I A;  2AN6 A;  1Z60 A;  1WEU A;  1FP0 A;  2MT5 A;  2JRJ A;  4UP0 A;  2Y1M A;  2KGG A;  2DSM A;  2L75 A;  5JG6 A;  4IC3 A;  5B76 A;  2XOY A;  1LDJ B;  2H0D B;  1HYI A;  2M3H A;  4OGE A;  3ZPV E;  1BOR A;  4A0C D;  2Y1N A;  4QQ4 A;  2YUR A;  3L1Z B;  2OWA A;  1X4J A;  5SVX A;  2KWK A;  2JMD A;  5LCW B;  2XEU A;  2FUI A;  2E61 A;  4FK5 A;  5LKU A;  3NG2 A;  3ZVY A;  4R7E A;  1WIM A;  5I3L A;  5FB1 A;  2EA6 A;  2L43 A;  5C13 A;  2MUM A;  3PUR A;  5TDW A;  4AUQ B;  2XOZ A;  4F52 B;  2MD8 C;  2VJE B;  3HCU A;  3KV6 A;  4QF3 A;  4YBT A;  3HCT A;  3ZTG A;  3LVR E;  2ECJ A;  1JM7 A;  2L80 A;  5FER A;  2LXH C;  1CHC A;  4UI9 B;  3V43 A;  3GL6 A;  2K1J A;  3N9L A;  4CA1 A;  1WE9 A;  2G6Q A;  3FM8 C;  3U5N A;  4LJN A;  5SVI A;  5AIT A;  4WA6 A;  4AVX A;  4Q6F A;  3O35 A;  2BAY A;  2FSA A;  1WEW A;  4GB0 A;  2LGV A;  2UZG A;  2YU4 A;  3SHB A;  3C6W A;  5H1U A;  2QIC A;  2G43 A;  3O7A A;  3O37 A;  4GNG A;  5FEY A;  2LXP C;  3M99 A;  5TDR A;  3M62 A;  4GNF A;  5H1V A;  4LKA A;  2YUC A;  4IC2 A;  4LK9 A;  2LV9 A;  2VPE A;  3DPL R;  5AIU A;  3FAO A;  2CT2 A;  1WES A;  5H9M A;  2VJF A;  2KR4 A;  2RR4 A;  2ECI A;  1XWH A;  2YVR A;  5LKZ A;  5TRB A;  3HCS A;  3E2D A;  2KIZ A;  4N4F A;  3GV4 A;  2K17 A;  2K16 A;  5B79 A;  3LQH A;  3ZVZ B;  2PNX A;  3EB5 A;  4YBM A;  3O34 A;  1U6G B;  2KKY A;  4GNE A;  5SVY A;  3ZYQ A;  2CKL B;  4LAD B;  5K3Q A;  2M6M A;  2OXQ C;  5DKA A;  2MNZ A;  3T7L A;  2KRE A;  5EYA F;  2RI7 A;  3JUE A;  3ZNI A;  4O64 A;  3M7K A;  2KWO A;  4AYC B;  3SOU A;  4S3O B;  1X4U A;  2ZET C;  3DWD A;  2D8U A;  4TKP B;  4ZUX U;  3IHP A;  2LGK A;  2YW8 A;  5D1K B;  2LRI C;  4FIP A;  1DCQ A;  5G05 B;  3N9M A;  5D1L B;  4A49 A;  1JM7 B;  2VPB A;  3HTK C;  2LGL A;  2CRR A;  4L58 A;  3ZPV 1;  3DDT A;  1HYJ A;  1T1H A;  4L7X A;  4MVT A;  3C5K A;  2M1R A;  2JMJ A;  2H0D A;  3I2D A;  2VPG A;  1WFK A;  5KH9 A;  2JM3 A;  2KKX A;  5DIN A;  4GND A;  3L11 A;  2VJE A;  2VPD A;  4LLB A;  5D1M B;  4A4C A;  2C2V S;  4PTB A;  1WEE A;  2VP7 A;  2LN0 A;  2NAA A;  5KH3 A;  2M13 A;  5LKT A;  5G04 B;  3LDY A;  5FB0 A;  3EB6 A;  2CON A;  3U5P A;  2QJ0 A;  2JMI A;  4OGC A;  2YYR A;  3FL2 A;  3RPG B;  2F6N A;  1VYX A;  2KU3 A;  4B86 C;  3PHD A;  5KH7 A;  1FBV A;  4F1P A;  2KWN A;  4YAX A;  5B78 A;  3RTR B;  2QIZ A;  2G45 A;  3M63 A;  3T6R A;  4FO9 A;  4YAB A;  1VD4 A;  2RSD A;  1MBM A;  2L7P A;  1Z6U A;  2YSJ A;  2KGI A;  2EXU A;  3MHH A;  3H7H A;  2KWJ A;  2ECV A;  3ASL A;  2YSM A;  2FFW A;  2MNY A;  3FAN A;  2CSZ A;  2FD4 A;  4UP5 A;  4V3K C;  2VJF B;  2ECW A;  5B75 A;  1LDK C;  2HDP A;  2K4D A;  1ZBD B;  2E6R A;  1F62 A;  5H1T A;  1WEM A;  3U5O A;  4A4B A;  2D8S A;  1N87 A;  2YRE A;  2L0B A;  2LQ6 A;  3PUQ A;  2CSV A;  2HYE D;  5SVI B;  2E6S A;  2MD7 B;  4S3O C;  1WEP A;  3LJU X;  4O62 A;  4MSX A;  2XB1 A;  4H9D A;  4X3G A;  5LKX A;  3O33 A;  3SOW A;  2FUU A;  1WGM A;  4ZQL A;  2KFT A;  4BBQ A;  2MA6 A;  2IDA A;  2ECG A;  5G0F A;  4CCG X;  2JUN A;  5TBN A;  4B7Y C; 
#chains in the Genus database with same CATH homology
 4PPE A;  4YC9 A;  4NN2 A;  4QF2 A;  3QZV A;  2CKL A;  2KYU A;  2ECT A;  3KQI A;  4WZ0 A;  3DQV R;  3LQI A;  4N3W A;  1K2F A;  1Z2Q A;  4BHW A;  2YHO A;  1WEV A;  5C11 A;  5J3X A;  2Y43 A;  4I7D A;  3U5M A;  1RMD A;  2MIQ A;  5B8D A;  2YHN A;  3KV5 A;  3L1X A;  1MM2 A;  1WEQ A;  2LGG A;  1E4U A;  3N9Q A;  4R8P K;  3LRQ A;  1V87 A;  4W4U A;  1VFY A;  1JOC A;  4XI1 A;  4I7C A;  2F42 A;  3N9O A;  1WEN A;  2PUY A;  4AYC A;  2ECN A;  2L5U A;  3N9P A;  2MA5 A;  1WEO A;  2YT5 A;  1G25 A;  2F6J A;  4V3L C;  2LDR A;  4I7B A;  4FJC A;  5B77 A;  4WZ2 A;  3O70 A;  4P5O B;  5TAB A;  2DX8 A;  2KE1 A;  4YAD A;  3VK6 A;  4WZ3 B;  3KNV A;  3N9N A;  4ZDT A;  2YQM A;  2EGP A;  2M85 A;  2VNF A;  2EOD A;  4YAT A;  1DVP A;  1IYM A;  3LQJ A;  4YBS A;  3MHS A;  4AP4 A;  4R2Y A;  2C2L A;  2YQL A;  4C9Z A;  3RPG C;  3SOX A;  2I50 A;  1WIL A;  1MM3 A;  3O36 A;  2CSY A;  1X4I A;  2AN6 A;  1Z60 A;  1WEU A;  1FP0 A;  2MT5 A;  2JRJ A;  4UP0 A;  2Y1M A;  2KGG A;  2L75 A;  5JG6 A;  4IC3 A;  5B76 A;  1LDJ B;  2H0D B;  1HYI A;  2M3H A;  3ZPV E;  1BOR A;  4A0C D;  2Y1N A;  2YUR A;  3L1Z B;  1X4J A;  2KWK A;  2JMD A;  5LCW B;  2XEU A;  2FUI A;  4FK5 A;  5LKU A;  3NG2 A;  3ZVY A;  4R7E A;  1WIM A;  5I3L A;  5FB1 A;  2EA6 A;  2L43 A;  5C13 A;  2MUM A;  3PUR A;  5TDW A;  4AUQ B;  4F52 B;  2MD8 C;  2VJE B;  3HCU A;  3KV6 A;  4QF3 A;  4YBT A;  3HCT A;  3ZTG A;  2ECJ A;  1JM7 A;  2L80 A;  5FER A;  2LXH C;  1CHC A;  4UI9 B;  3V43 A;  3GL6 A;  2K1J A;  3N9L A;  4CA1 A;  1WE9 A;  2G6Q A;  3U5N A;  4LJN A;  5AIT A;  4WA6 A;  4AVX A;  4Q6F A;  3O35 A;  2BAY A;  2FSA A;  1WEW A;  4GB0 A;  2LGV A;  2UZG A;  2YU4 A;  3SHB A;  3C6W A;  5H1U A;  2QIC A;  2G43 A;  3O7A A;  3O37 A;  4GNG A;  5FEY A;  2LXP C;  3M99 A;  5TDR A;  3M62 A;  4GNF A;  5H1V A;  4LKA A;  2YUC A;  4IC2 A;  4LK9 A;  2LV9 A;  2VPE A;  3DPL R;  5AIU A;  2CT2 A;  1WES A;  5H9M A;  2VJF A;  2KR4 A;  2ECI A;  1XWH A;  5LKZ A;  5TRB A;  3HCS A;  2KIZ A;  4N4F A;  3GV4 A;  2K17 A;  5B79 A;  2K16 A;  3LQH A;  3ZVZ B;  2PNX A;  3EB5 A;  4YBM A;  3O34 A;  1U6G B;  4GNE A;  3ZYQ A;  2CKL B;  4LAD B;  2M6M A;  2OXQ C;  5DKA A;  2MNZ A;  3T7L A;  2KRE A;  5EYA F;  2RI7 A;  3ZNI A;  4O64 A;  2KWO A;  4AYC B;  3SOU A;  4S3O B;  1X4U A;  2ZET C;  4TKP B;  4ZUX U;  3IHP A;  2LGK A;  2YW8 A;  5D1K B;  2LRI C;  4FIP A;  5G05 B;  3N9M A;  5D1L B;  4A49 A;  1JM7 B;  2VPB A;  3HTK C;  2LGL A;  4L58 A;  3ZPV 1;  1HYJ A;  1T1H A;  4L7X A;  4MVT A;  3C5K A;  2M1R A;  2JMJ A;  2H0D A;  3I2D A;  2VPG A;  1WFK A;  5KH9 A;  5DIN A;  4GND A;  3L11 A;  2VJE A;  2VPD A;  4LLB A;  5D1M B;  4A4C A;  2C2V S;  4PTB A;  1WEE A;  2VP7 A;  2LN0 A;  2NAA A;  5KH3 A;  5LKT A;  5G04 B;  5FB0 A;  3EB6 A;  3U5P A;  2QJ0 A;  2JMI A;  2YYR A;  3FL2 A;  3RPG B;  2F6N A;  1VYX A;  2KU3 A;  4B86 C;  3PHD A;  5KH7 A;  1FBV A;  2KWN A;  4YAX A;  5B78 A;  3RTR B;  2QIZ A;  2G45 A;  3M63 A;  3T6R A;  4FO9 A;  4YAB A;  1VD4 A;  2RSD A;  1Z6U A;  2YSJ A;  2KGI A;  3MHH A;  2KWJ A;  2ECV A;  3ASL A;  2YSM A;  2MNY A;  2CSZ A;  4UP5 A;  4V3K C;  2VJF B;  2ECW A;  5B75 A;  1LDK C;  2HDP A;  2K4D A;  1ZBD B;  2E6R A;  1F62 A;  5H1T A;  1WEM A;  3U5O A;  4A4B A;  2D8S A;  1N87 A;  2YRE A;  2L0B A;  2LQ6 A;  3PUQ A;  2HYE D;  2E6S A;  2MD7 B;  4S3O C;  1WEP A;  4MSX A;  2XB1 A;  4X3G A;  5LKX A;  3O33 A;  3SOW A;  2FUU A;  1WGM A;  4BBQ A;  2KFT A;  4ZQL A;  2MA6 A;  4CCG X;  2ECG A;  2IDA A;  5G0F A;  5TBN A;  4B7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...