4QF2A

Crystal structure of human baz2a phd zinc finger in the free form
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4qf2A00
2JMDA 2VJEA 2KREA 2YT5A 2EODA 4YAXA 4A49A 5LKXA 5FB1A 2VPBA 4MSXA 4X3GA 1WEOA 3HCUA 4GNDA 2ECNA 3EB6A 2PNXA 2L80A 3SOUA 4YC9A 2YREA 5H1UA 2UZGA 2C2VS 2D8SA 2K16A 3M99A 2F6NA 2AN6A 5C11A 2VPDA 1F62A 4LLBA 1WE9A 3N9QA 4WZ2A 2HYED 3RPGC 2LDRA 3U5PA 2LGGA 1WFKA 5J3XA 2FUIA 4F52B 3MHSA 1WEVA 3I2DA 4FO9A 3ZVYA 2HDPA 1U6GB 3PUQA 4LJNA 3PURA 2ECWA 2KE1A 3ZPVE 1WIMA 5DKAA 2LGKA 1Z60A 2K17A 2YW8A 4I7BA 3RTRB 2K1JA 3O7AA 1G25A 2CSZA 2JMIA 3LQIA 4LKAA 3O35A 2RSDA 4S3OC 4AUQB 4V3LC 4A0CD 4R2YA 1X4UA 2MD8C 3ZPV1 4YBSA 2QIZA 2VP7A 2L5UA 4QF2A 1JM7A 5H1TA 2KWKA 3MHHA 4B7YC 1HYJA 2KWJA 2YQMA 2MIQA 2MA5A 2KFTA 5B77A 4YBTA 4ZUXU 3C6WA 2G6QA 2LRIC 4B86C 3ZYQA 2LN0A 3FL2A 5D1MB 1BORA 3O34A 3KQIA 3N9NA 3U5OA 2JMJA 2I50A 2L75A 2VJEB 4L7XA 1RMDA 2KR4A 3PHDA 3SOWA 2XB1A 2LV9A 1N87A 3U5MA 4FJCA 4CCGX 5B78A 1V87A 4XI1A 1X4IA 2C2LA 3N9MA 4I7DA 3LRQA 3ZVZB 4GNFA 5B75A 2MUMA 4S3OB 2YQLA 2RI7A 4AYCA 3DPLR 3N9PA 4Q6FA 4UP5A 1IYMA 1K2FA 1MM2A 4QF3A 2CSYA 5G04B 4AVXA 1VFYA 3M63A 1FP0A 2KGIA 2KWOA 4CA1A 4FK5A 3LQHA 1LDKC 2LXPC 2Y1MA 1WEQA 2PUYA 1WEUA 3QZVA 3SHBA 4YABA 5FERA 1WGMA 3N9OA 4O64A 4TKPB 3VK6A 1E4UA 2YURA 4IC2A 1WEEA 5AIUA 5FEYA 2YHNA 2G43A 5LKUA 5TDWA 2MA6A 3T7LA 2E6RA 2VJFA 4UI9B 4R7EA 2M1RA 3O37A 4YADA 1JOCA 1Z6UA 1JM7B 3N9LA 2M3HA 2H0DA 1LDJB 5EYAF 4V3KC 4PPEA 2LGLA 4ZDTA 5TBNA 4L58A 2VPGA 3C5KA 2YU4A 4IC3A 5LCWB 3KV5A 4N3WA 4UP0A 1WENA 1X4JA 1XWHA 5B79A 2CKLA 5H9MA 4GNEA 5G0FA 4A4CA 5B76A 4PTBA 3GL6A 4I7CA 1WESA 3GV4A 1FBVA 2YUCA 2M6MA 5KH9A 4A4BA 2ECVA 3IHPA 5AITA 2KU3A 4AYCB 2L0BA 2EA6A 2F6JA 4YATA 3L1ZB 4R8PK 2QJ0A 2G45A 2KYUA 1WEMA 4WZ0A 4W4UA 3HCTA 4ZQLA 5KH7A 2FUUA 2MNZA 3V43A 3KV6A 5LKTA 1WEPA 2LQ6A 4LK9A 2YSJA 5B8DA 2ECGA 5KH3A 1HYIA 2VPEA 1Z2QA 5FB0A 2E6SA 3O36A 3NG2A 2Y43A 3EB5A 2DX8A 2BAYA 2Y1NA 3U5NA 4C9ZA 2CT2A 2VJFB 5G05B 4LADB 3ZTGA 3ZNIA 3O33A 5D1LB 1MM3A 3O70A 3SOXA 3M62A 2MT5A 2H0DB 2KWNA 3HCSA 5D1KB 2LGVA 2L43A 3T6RA 3KNVA 1VD4A 2F42A 4YBMA 2K4DA 1WEWA 5I3LA 5JG6A 4AP4A 1WILA 2ECIA 2FSAA 2OXQC 2QICA 3ASLA 5H1VA 3L11A 4GNGA 4N4FA 4NN2A 5C13A 2M85A 2KIZA 5TDRA 1DVPA 2CKLB 1CHCA 3L1XA 2ZETC 3LQJA 4WZ3B 2EGPA 5LKZA 2ECTA 4GB0A 4MVTA 5TRBA 2NAAA 3DQVR 4BBQA 5TABA 2XEUA 2YHOA 2MNYA 4P5OB 4BHWA 2YYRA 1VYXA 2ECJA 1T1HA 1ZBDB 2LXHC 2MD7B 2YSMA 3HTKC 2KGGA 4FIPA 4WA6A 2IDAA 3RPGB 2JRJA 2VNFA 5DINA
chains in the Genus database with same CATH superfamily
2JMDA 2VJEA 2KREA 2YT5A 2EODA 4YAXA 4F1PA 4A49A 1DCQA 5LKXA 5FB1A 2VPBA 4MSXA 4X3GA 2JM3A 3MDBC 1WEOA 3HCUA 4GNDA 2ECNA 3EB6A 2PNXA 2L80A 4O62A 3SOUA 4YC9A 2YREA 5H1UA 2DJAA 2UZGA 2C2VS 2D8SA 2K16A 3M99A 3SUBA 2F6NA 2AN6A 5C11A 3DDTA 2VPDA 1F62A 4LLBA 1WE9A 3DWDA 3N9QA 4WZ2A 2HYED 3RPGC 2LDRA 3U5PA 2LGGA 1WFKA 5J3XA 2FUIA 4F52B 3MHSA 3FANA 1WEVA 3I2DA 4FO9A 3ZVYA 2HDPA 1U6GB 3PUQA 4LJNA 3PURA 2KKYA 5K3QA 2EXUA 2ECWA 2KE1A 3ZPVE 4OGCA 1WIMA 5DKAA 2LGKA 1Z60A 2K17A 2YW8A 4I7BA 3RTRB 2K1JA 3O7AA 1G25A 2CSZA 2JMIA 3LQIA 4LKAA 3O35A 2B0OE 2RSDA 4S3OC 4H9DA 4AUQB 4V3LC 4A0CD 4R2YA 1X4UA 2MD8C 4QQ4A 3ZPV1 4YBSA 2FFWA 2QIZA 2VP7A 2L5UA 2OWAA 4QF2A 1JM7A 5H1TA 2KWKA 3JUEA 3MHHA 4B7YC 1HYJA 2KWJA 2YQMA 2MIQA 2MA5A 2KFTA 5B77A 4YBTA 4ZUXU 3C6WA 2G6QA 2LRIC 4B86C 3ZYQA 2LN0A 3FL2A 5D1MB 1BORA 3O34A 3KQIA 3N9NA 3U5OA 2JMJA 2I50A 2L75A 2VJEB 4L7XA 1RMDA 2KR4A 3PHDA 3Q1DA 3SOWA 2XB1A 4Z0RA 2LV9A 1N87A 3U5MA 4FJCA 4CCGX 5B78A 1V87A 4XI1A 3H7HA 1X4IA 2C2LA 3N9MA 4I7DA 3LRQA 3ZVZB 5SVIA 2EGMA 4GNFA 5B75A 2MUMA 4S3OB 2YQLA 2RI7A 4AYCA 3DPLR 3N9PA 4Q6FA 4UP5A 1IYMA 4Z0OA 3FEHA 1K2FA 1MM2A 4QF3A 4OGEA 2CSYA 5G04B 4AVXA 1VFYA 2DSMA 1MBMA 3M63A 1FP0A 2KGIA 2KWOA 2JUNA 4CA1A 4FK5A 3LQHA 1LDKC 2LXPC 2Y1MA 1WEQA 2YVRA 2PUYA 1WEUA 3QZVA 3SHBA 4YABA 5FERA 1WGMA 3N9OA 4O64A 4TKPB 3VK6A 1E4UA 2YURA 4IC2A 1WEEA 5AIUA 5FEYA 2YHNA 2G43A 5LKUA 5TDWA 2MA6A 3T7LA 3FJUB 2E6RA 2E61A 2RR4A 2VJFA 3FM8C 4UI9B 3FAOA 4R7EA 2M1RA 3O37A 4YADA 1JOCA 1Z6UA 1JM7B 3N9LA 2M3HA 2H0DA 1LDJB 4V3KC 5EYAF 4PPEA 2LGLA 2CRRA 4ZDTA 4L58A 5TBNA 2VPGA 3C5KA 2YU4A 4IC3A 5LCWB 3KV5A 2XOZA 2MKEA 4N3WA 4UP0A 3T9KA 1WENA 1X4JA 1XWHA 5B79A 2IQJA 2CKLA 3LVQE 5H9MA 4GNEA 5G0FA 4A4CA 5B76A 4PTBA 3GL6A 4I7CA 2P57A 1WESA 2KKXA 3GV4A 1FBVA 3LJUX 2YUCA 2M6MA 5SVIB 3M7KA 5KH9A 4A4BA 5SVXA 2ECVA 3IHPA 5AITA 2L7PA 2KU3A 4AYCB 2CSVA 2L0BA 2EA6A 2F6JA 4YATA 3L1ZB 4R8PK 2QJ0A 2G45A 2KYUA 1WEMA 2FD4A 4WZ0A 4W4UA 3HCTA 4ZQLA 5KH7A 2FUUA 2MNZA 3V43A 3KV6A 5LKTA 2XOYA 1WEPA 2LQ6A 4LK9A 2YSJA 5B8DA 2ECGA 5KH3A 1HYIA 2VPEA 5SVYA 1Z2QA 5FB0A 2E6SA 3O36A 3NG2A 3O47A 2Y43A 3EB5A 2M13A 2DX8A 2BAYA 2Y1NA 3U5NA 4C9ZA 3KDEC 2CT2A 2VJFB 5G05B 4LADB 3ZTGA 3ZNIA 3O33A 5D1LB 1MM3A 3O70A 3SOXA 3M62A 2MT5A 2H0DB 2KWNA 3HCSA 5D1KB 2D8UA 2L43A 2LGVA 3T6RA 3KNVA 1VD4A 2F42A 4YBMA 2K4DA 1WEWA 5I3LA 5JG6A 4AP4A 1WILA 2ECIA 2FSAA 2OXQC 2QICA 3ASLA 5H1VA 2XP0A 3L11A 4GNGA 4N4FA 4NN2A 3PLWA 5C13A 2M85A 2KIZA 2CONA 5TDRA 1DVPA 3LDYA 2CKLB 1CHCA 2CRWA 3L1XA 2ZETC 3LQJA 4WZ3B 2EGPA 5LKZA 2ECTA 4GB0A 4MVTA 2XOCA 3LVRE 5TRBA 2NAAA 3DQVR 4BBQA 5TABA 2LAUA 2XEUA 2YHOA 2MNYA 4P5OB 4BHWA 2YYRA 1VYXA 2ECJA 1T1HA 1ZBDB 2LXHC 2MD7B 2YSMA 3HTKC 2KGGA 3E2DA 4FIPA 4WA6A 2IDAA 3RPGB 2JRJA 2VNFA 5DINA
chains in the Genus database with same CATH topology
2JMDA 2VJEA 2KREA 2YT5A 2EODA 4YAXA 4A49A 5LKXA 5FB1A 2VPBA 4MSXA 4X3GA 1WEOA 3HCUA 4GNDA 2ECNA 3EB6A 2PNXA 2L80A 3SOUA 4YC9A 2YREA 5H1UA 2UZGA 2C2VS 2D8SA 2K16A 3M99A 2F6NA 2AN6A 5C11A 2VPDA 1F62A 4LLBA 1WE9A 3N9QA 4WZ2A 2HYED 3RPGC 2LDRA 3U5PA 2LGGA 1WFKA 5J3XA 2FUIA 4F52B 3MHSA 1WEVA 3I2DA 4FO9A 3ZVYA 2HDPA 1U6GB 3PUQA 4LJNA 3PURA 2ECWA 2KE1A 3ZPVE 1WIMA 5DKAA 2LGKA 1Z60A 2K17A 2YW8A 4I7BA 3RTRB 2K1JA 3O7AA 1G25A 2CSZA 2JMIA 3LQIA 4LKAA 3O35A 2RSDA 4S3OC 4AUQB 4V3LC 4A0CD 4R2YA 1X4UA 2MD8C 3ZPV1 4YBSA 2QIZA 2VP7A 2L5UA 4QF2A 1JM7A 5H1TA 2KWKA 3MHHA 4B7YC 1HYJA 2KWJA 2YQMA 2MIQA 2MA5A 2KFTA 5B77A 4YBTA 4ZUXU 3C6WA 2G6QA 2LRIC 4B86C 3ZYQA 2LN0A 3FL2A 5D1MB 1BORA 3O34A 3KQIA 3N9NA 3U5OA 2JMJA 2I50A 2L75A 2VJEB 4L7XA 1RMDA 2KR4A 3PHDA 3SOWA 2XB1A 2LV9A 1N87A 3U5MA 4FJCA 4CCGX 5B78A 1V87A 4XI1A 1X4IA 2C2LA 3N9MA 4I7DA 3LRQA 3ZVZB 4GNFA 5B75A 2MUMA 4S3OB 2YQLA 2RI7A 4AYCA 3DPLR 3N9PA 4Q6FA 4UP5A 1IYMA 1K2FA 1MM2A 4QF3A 2CSYA 5G04B 4AVXA 1VFYA 3M63A 1FP0A 2KGIA 2KWOA 4CA1A 4FK5A 3LQHA 1LDKC 2LXPC 2Y1MA 1WEQA 2PUYA 1WEUA 3QZVA 3SHBA 4YABA 5FERA 1WGMA 3N9OA 4O64A 4TKPB 3VK6A 1E4UA 2YURA 4IC2A 1WEEA 5AIUA 5FEYA 2YHNA 2G43A 5LKUA 5TDWA 2MA6A 3T7LA 2E6RA 2VJFA 4UI9B 4R7EA 2M1RA 3O37A 4YADA 1JOCA 1Z6UA 1JM7B 3N9LA 2M3HA 2H0DA 1LDJB 5EYAF 4V3KC 4PPEA 2LGLA 4ZDTA 5TBNA 4L58A 2VPGA 3C5KA 2YU4A 4IC3A 5LCWB 3KV5A 4N3WA 4UP0A 1WENA 1X4JA 1XWHA 5B79A 2CKLA 5H9MA 4GNEA 5G0FA 4A4CA 5B76A 4PTBA 3GL6A 4I7CA 1WESA 3GV4A 1FBVA 2YUCA 2M6MA 5KH9A 4A4BA 2ECVA 3IHPA 5AITA 2KU3A 4AYCB 2L0BA 2EA6A 2F6JA 4YATA 3L1ZB 4R8PK 2QJ0A 2G45A 2KYUA 1WEMA 4WZ0A 4W4UA 3HCTA 4ZQLA 5KH7A 2FUUA 2MNZA 3V43A 3KV6A 5LKTA 1WEPA 2LQ6A 4LK9A 2YSJA 5B8DA 2ECGA 5KH3A 1HYIA 2VPEA 1Z2QA 5FB0A 2E6SA 3O36A 3NG2A 2Y43A 3EB5A 2DX8A 2BAYA 2Y1NA 3U5NA 4C9ZA 2CT2A 2VJFB 5G05B 4LADB 3ZTGA 3ZNIA 3O33A 5D1LB 1MM3A 3O70A 3SOXA 3M62A 2MT5A 2H0DB 2KWNA 3HCSA 5D1KB 2LGVA 2L43A 3T6RA 3KNVA 1VD4A 2F42A 4YBMA 2K4DA 1WEWA 5I3LA 5JG6A 4AP4A 1WILA 2ECIA 2FSAA 2OXQC 2QICA 3ASLA 5H1VA 3L11A 4GNGA 4N4FA 4NN2A 5C13A 2M85A 2KIZA 5TDRA 1DVPA 2CKLB 1CHCA 3L1XA 2ZETC 3LQJA 4WZ3B 2EGPA 5LKZA 2ECTA 4GB0A 4MVTA 5TRBA 2NAAA 3DQVR 4BBQA 5TABA 2XEUA 2YHOA 2MNYA 4P5OB 4BHWA 2YYRA 1VYXA 2ECJA 1T1HA 1ZBDB 2LXHC 2MD7B 2YSMA 3HTKC 2KGGA 4FIPA 4WA6A 2IDAA 3RPGB 2JRJA 2VNFA 5DINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMD A;  2VJE A;  2KRE A;  2YT5 A;  2EOD A;  4YAX A;  4A49 A;  5LKX A;  5FB1 A;  2VPB A;  4MSX A;  4X3G A;  1WEO A;  3HCU A;  4GND A;  2ECN A;  3EB6 A;  2PNX A;  2L80 A;  3SOU A;  4YC9 A;  2YRE A;  5H1U A;  2UZG A;  2C2V S;  2D8S A;  2K16 A;  3M99 A;  2F6N A;  2AN6 A;  5C11 A;  2VPD A;  1F62 A;  4LLB A;  1WE9 A;  3N9Q A;  4WZ2 A;  2HYE D;  3RPG C;  2LDR A;  3U5P A;  2LGG A;  1WFK A;  5J3X A;  2FUI A;  4F52 B;  3MHS A;  1WEV A;  3I2D A;  4FO9 A;  3ZVY A;  2HDP A;  1U6G B;  3PUQ A;  4LJN A;  3PUR A;  2ECW A;  2KE1 A;  3ZPV E;  1WIM A;  5DKA A;  2LGK A;  1Z60 A;  2K17 A;  2YW8 A;  4I7B A;  3RTR B;  2K1J A;  3O7A A;  1G25 A;  2CSZ A;  2JMI A;  3LQI A;  4LKA A;  3O35 A;  2RSD A;  4S3O C;  4AUQ B;  4V3L C;  4A0C D;  4R2Y A;  1X4U A;  2MD8 C;  3ZPV 1;  4YBS A;  2QIZ A;  2VP7 A;  2L5U A;  4QF2 A;  1JM7 A;  5H1T A;  2KWK A;  3MHH A;  4B7Y C;  1HYJ A;  2KWJ A;  2YQM A;  2MIQ A;  2MA5 A;  2KFT A;  5B77 A;  4YBT A;  4ZUX U;  3C6W A;  2G6Q A;  2LRI C;  4B86 C;  3ZYQ A;  2LN0 A;  3FL2 A;  5D1M B;  1BOR A;  3O34 A;  3KQI A;  3N9N A;  3U5O A;  2JMJ A;  2I50 A;  2L75 A;  2VJE B;  4L7X A;  1RMD A;  2KR4 A;  3PHD A;  3SOW A;  2XB1 A;  2LV9 A;  1N87 A;  3U5M A;  4FJC A;  4CCG X;  5B78 A;  1V87 A;  4XI1 A;  1X4I A;  2C2L A;  3N9M A;  4I7D A;  3LRQ A;  3ZVZ B;  4GNF A;  5B75 A;  2MUM A;  4S3O B;  2YQL A;  2RI7 A;  4AYC A;  3DPL R;  3N9P A;  4Q6F A;  4UP5 A;  1IYM A;  1K2F A;  1MM2 A;  4QF3 A;  2CSY A;  5G04 B;  4AVX A;  1VFY A;  3M63 A;  1FP0 A;  2KGI A;  2KWO A;  4CA1 A;  4FK5 A;  3LQH A;  1LDK C;  2LXP C;  2Y1M A;  1WEQ A;  2PUY A;  1WEU A;  3QZV A;  3SHB A;  4YAB A;  5FER A;  1WGM A;  3N9O A;  4O64 A;  4TKP B;  3VK6 A;  1E4U A;  2YUR A;  4IC2 A;  1WEE A;  5AIU A;  5FEY A;  2YHN A;  2G43 A;  5LKU A;  5TDW A;  2MA6 A;  3T7L A;  2E6R A;  2VJF A;  4UI9 B;  4R7E A;  2M1R A;  3O37 A;  4YAD A;  1JOC A;  1Z6U A;  1JM7 B;  3N9L A;  2M3H A;  2H0D A;  1LDJ B;  5EYA F;  4V3K C;  4PPE A;  2LGL A;  4ZDT A;  5TBN A;  4L58 A;  2VPG A;  3C5K A;  2YU4 A;  4IC3 A;  5LCW B;  3KV5 A;  4N3W A;  4UP0 A;  1WEN A;  1X4J A;  1XWH A;  5B79 A;  2CKL A;  5H9M A;  4GNE A;  5G0F A;  4A4C A;  5B76 A;  4PTB A;  3GL6 A;  4I7C A;  1WES A;  3GV4 A;  1FBV A;  2YUC A;  2M6M A;  5KH9 A;  4A4B A;  2ECV A;  3IHP A;  5AIT A;  2KU3 A;  4AYC B;  2L0B A;  2EA6 A;  2F6J A;  4YAT A;  3L1Z B;  4R8P K;  2QJ0 A;  2G45 A;  2KYU A;  1WEM A;  4WZ0 A;  4W4U A;  3HCT A;  4ZQL A;  5KH7 A;  2FUU A;  2MNZ A;  3V43 A;  3KV6 A;  5LKT A;  1WEP A;  2LQ6 A;  4LK9 A;  2YSJ A;  5B8D A;  2ECG A;  5KH3 A;  1HYI A;  2VPE A;  1Z2Q A;  5FB0 A;  2E6S A;  3O36 A;  3NG2 A;  2Y43 A;  3EB5 A;  2DX8 A;  2BAY A;  2Y1N A;  3U5N A;  4C9Z A;  2CT2 A;  2VJF B;  5G05 B;  4LAD B;  3ZTG A;  3ZNI A;  3O33 A;  5D1L B;  1MM3 A;  3O70 A;  3SOX A;  3M62 A;  2MT5 A;  2H0D B;  2KWN A;  3HCS A;  5D1K B;  2LGV A;  2L43 A;  3T6R A;  3KNV A;  1VD4 A;  2F42 A;  4YBM A;  2K4D A;  1WEW A;  5I3L A;  5JG6 A;  4AP4 A;  1WIL A;  2ECI A;  2FSA A;  2OXQ C;  2QIC A;  3ASL A;  5H1V A;  3L11 A;  4GNG A;  4N4F A;  4NN2 A;  5C13 A;  2M85 A;  2KIZ A;  5TDR A;  1DVP A;  2CKL B;  1CHC A;  3L1X A;  2ZET C;  3LQJ A;  4WZ3 B;  2EGP A;  5LKZ A;  2ECT A;  4GB0 A;  4MVT A;  5TRB A;  2NAA A;  3DQV R;  4BBQ A;  5TAB A;  2XEU A;  2YHO A;  2MNY A;  4P5O B;  4BHW A;  2YYR A;  1VYX A;  2ECJ A;  1T1H A;  1ZBD B;  2LXH C;  2MD7 B;  2YSM A;  3HTK C;  2KGG A;  4FIP A;  4WA6 A;  2IDA A;  3RPG B;  2JRJ A;  2VNF A;  5DIN A; 
#chains in the Genus database with same CATH topology
 2JMD A;  2VJE A;  2KRE A;  2YT5 A;  2EOD A;  4YAX A;  4F1P A;  4A49 A;  1DCQ A;  5LKX A;  5FB1 A;  2VPB A;  4MSX A;  4X3G A;  2JM3 A;  3MDB C;  1WEO A;  3HCU A;  4GND A;  2ECN A;  3EB6 A;  2PNX A;  2L80 A;  4O62 A;  3SOU A;  4YC9 A;  2YRE A;  5H1U A;  2DJA A;  2UZG A;  2C2V S;  2D8S A;  2K16 A;  3M99 A;  3SUB A;  2F6N A;  2AN6 A;  5C11 A;  3DDT A;  2VPD A;  1F62 A;  4LLB A;  1WE9 A;  3DWD A;  3N9Q A;  4WZ2 A;  2HYE D;  3RPG C;  2LDR A;  3U5P A;  2LGG A;  1WFK A;  5J3X A;  2FUI A;  4F52 B;  3MHS A;  3FAN A;  1WEV A;  3I2D A;  4FO9 A;  3ZVY A;  2HDP A;  1U6G B;  3PUQ A;  4LJN A;  3PUR A;  2KKY A;  5K3Q A;  2EXU A;  2ECW A;  2KE1 A;  3ZPV E;  4OGC A;  1WIM A;  5DKA A;  2LGK A;  1Z60 A;  2K17 A;  2YW8 A;  4I7B A;  3RTR B;  2K1J A;  3O7A A;  1G25 A;  2CSZ A;  2JMI A;  3LQI A;  4LKA A;  3O35 A;  2B0O E;  2RSD A;  4S3O C;  4H9D A;  4AUQ B;  4V3L C;  4A0C D;  4R2Y A;  1X4U A;  2MD8 C;  4QQ4 A;  3ZPV 1;  4YBS A;  2FFW A;  2QIZ A;  2VP7 A;  2L5U A;  2OWA A;  4QF2 A;  1JM7 A;  5H1T A;  2KWK A;  3JUE A;  3MHH A;  4B7Y C;  1HYJ A;  2KWJ A;  2YQM A;  2MIQ A;  2MA5 A;  2KFT A;  5B77 A;  4YBT A;  4ZUX U;  3C6W A;  2G6Q A;  2LRI C;  4B86 C;  3ZYQ A;  2LN0 A;  3FL2 A;  5D1M B;  1BOR A;  3O34 A;  3KQI A;  3N9N A;  3U5O A;  2JMJ A;  2I50 A;  2L75 A;  2VJE B;  4L7X A;  1RMD A;  2KR4 A;  3PHD A;  3Q1D A;  3SOW A;  2XB1 A;  4Z0R A;  2LV9 A;  1N87 A;  3U5M A;  4FJC A;  4CCG X;  5B78 A;  1V87 A;  4XI1 A;  3H7H A;  1X4I A;  2C2L A;  3N9M A;  4I7D A;  3LRQ A;  3ZVZ B;  5SVI A;  2EGM A;  4GNF A;  5B75 A;  2MUM A;  4S3O B;  2YQL A;  2RI7 A;  4AYC A;  3DPL R;  3N9P A;  4Q6F A;  4UP5 A;  1IYM A;  4Z0O A;  3FEH A;  1K2F A;  1MM2 A;  4QF3 A;  4OGE A;  2CSY A;  5G04 B;  4AVX A;  1VFY A;  2DSM A;  1MBM A;  3M63 A;  1FP0 A;  2KGI A;  2KWO A;  2JUN A;  4CA1 A;  4FK5 A;  3LQH A;  1LDK C;  2LXP C;  2Y1M A;  1WEQ A;  2YVR A;  2PUY A;  1WEU A;  3QZV A;  3SHB A;  4YAB A;  5FER A;  1WGM A;  3N9O A;  4O64 A;  4TKP B;  3VK6 A;  1E4U A;  2YUR A;  4IC2 A;  1WEE A;  5AIU A;  5FEY A;  2YHN A;  2G43 A;  5LKU A;  5TDW A;  2MA6 A;  3T7L A;  3FJU B;  2E6R A;  2E61 A;  2RR4 A;  2VJF A;  3FM8 C;  4UI9 B;  3FAO A;  4R7E A;  2M1R A;  3O37 A;  4YAD A;  1JOC A;  1Z6U A;  1JM7 B;  3N9L A;  2M3H A;  2H0D A;  1LDJ B;  4V3K C;  5EYA F;  4PPE A;  2LGL A;  2CRR A;  4ZDT A;  4L58 A;  5TBN A;  2VPG A;  3C5K A;  2YU4 A;  4IC3 A;  5LCW B;  3KV5 A;  2XOZ A;  2MKE A;  4N3W A;  4UP0 A;  3T9K A;  1WEN A;  1X4J A;  1XWH A;  5B79 A;  2IQJ A;  2CKL A;  3LVQ E;  5H9M A;  4GNE A;  5G0F A;  4A4C A;  5B76 A;  4PTB A;  3GL6 A;  4I7C A;  2P57 A;  1WES A;  2KKX A;  3GV4 A;  1FBV A;  3LJU X;  2YUC A;  2M6M A;  5SVI B;  3M7K A;  5KH9 A;  4A4B A;  5SVX A;  2ECV A;  3IHP A;  5AIT A;  2L7P A;  2KU3 A;  4AYC B;  2CSV A;  2L0B A;  2EA6 A;  2F6J A;  4YAT A;  3L1Z B;  4R8P K;  2QJ0 A;  2G45 A;  2KYU A;  1WEM A;  2FD4 A;  4WZ0 A;  4W4U A;  3HCT A;  4ZQL A;  5KH7 A;  2FUU A;  2MNZ A;  3V43 A;  3KV6 A;  5LKT A;  2XOY A;  1WEP A;  2LQ6 A;  4LK9 A;  2YSJ A;  5B8D A;  2ECG A;  5KH3 A;  1HYI A;  2VPE A;  5SVY A;  1Z2Q A;  5FB0 A;  2E6S A;  3O36 A;  3NG2 A;  3O47 A;  2Y43 A;  3EB5 A;  2M13 A;  2DX8 A;  2BAY A;  2Y1N A;  3U5N A;  4C9Z A;  3KDE C;  2CT2 A;  2VJF B;  5G05 B;  4LAD B;  3ZTG A;  3ZNI A;  3O33 A;  5D1L B;  1MM3 A;  3O70 A;  3SOX A;  3M62 A;  2MT5 A;  2H0D B;  2KWN A;  3HCS A;  5D1K B;  2D8U A;  2L43 A;  2LGV A;  3T6R A;  3KNV A;  1VD4 A;  2F42 A;  4YBM A;  2K4D A;  1WEW A;  5I3L A;  5JG6 A;  4AP4 A;  1WIL A;  2ECI A;  2FSA A;  2OXQ C;  2QIC A;  3ASL A;  5H1V A;  2XP0 A;  3L11 A;  4GNG A;  4N4F A;  4NN2 A;  3PLW A;  5C13 A;  2M85 A;  2KIZ A;  2CON A;  5TDR A;  1DVP A;  3LDY A;  2CKL B;  1CHC A;  2CRW A;  3L1X A;  2ZET C;  3LQJ A;  4WZ3 B;  2EGP A;  5LKZ A;  2ECT A;  4GB0 A;  4MVT A;  2XOC A;  3LVR E;  5TRB A;  2NAA A;  3DQV R;  4BBQ A;  5TAB A;  2LAU A;  2XEU A;  2YHO A;  2MNY A;  4P5O B;  4BHW A;  2YYR A;  1VYX A;  2ECJ A;  1T1H A;  1ZBD B;  2LXH C;  2MD7 B;  2YSM A;  3HTK C;  2KGG A;  3E2D A;  4FIP A;  4WA6 A;  2IDA A;  3RPG B;  2JRJ A;  2VNF A;  5DIN A; 
#chains in the Genus database with same CATH homology
 2JMD A;  2VJE A;  2KRE A;  2YT5 A;  2EOD A;  4YAX A;  4A49 A;  5LKX A;  5FB1 A;  2VPB A;  4MSX A;  4X3G A;  1WEO A;  3HCU A;  4GND A;  2ECN A;  3EB6 A;  2PNX A;  2L80 A;  3SOU A;  4YC9 A;  2YRE A;  5H1U A;  2UZG A;  2C2V S;  2D8S A;  2K16 A;  3M99 A;  2F6N A;  2AN6 A;  5C11 A;  2VPD A;  1F62 A;  4LLB A;  1WE9 A;  3N9Q A;  4WZ2 A;  2HYE D;  3RPG C;  2LDR A;  3U5P A;  2LGG A;  1WFK A;  5J3X A;  2FUI A;  4F52 B;  3MHS A;  1WEV A;  3I2D A;  4FO9 A;  3ZVY A;  2HDP A;  1U6G B;  3PUQ A;  4LJN A;  3PUR A;  2ECW A;  2KE1 A;  3ZPV E;  1WIM A;  5DKA A;  2LGK A;  1Z60 A;  2K17 A;  2YW8 A;  4I7B A;  3RTR B;  2K1J A;  3O7A A;  1G25 A;  2CSZ A;  2JMI A;  3LQI A;  4LKA A;  3O35 A;  2RSD A;  4S3O C;  4AUQ B;  4V3L C;  4A0C D;  4R2Y A;  1X4U A;  2MD8 C;  3ZPV 1;  4YBS A;  2QIZ A;  2VP7 A;  2L5U A;  4QF2 A;  1JM7 A;  5H1T A;  2KWK A;  3MHH A;  4B7Y C;  1HYJ A;  2KWJ A;  2YQM A;  2MIQ A;  2MA5 A;  2KFT A;  5B77 A;  4YBT A;  4ZUX U;  3C6W A;  2G6Q A;  2LRI C;  4B86 C;  3ZYQ A;  2LN0 A;  3FL2 A;  5D1M B;  1BOR A;  3O34 A;  3KQI A;  3N9N A;  3U5O A;  2JMJ A;  2I50 A;  2L75 A;  2VJE B;  4L7X A;  1RMD A;  2KR4 A;  3PHD A;  3SOW A;  2XB1 A;  2LV9 A;  1N87 A;  3U5M A;  4FJC A;  4CCG X;  5B78 A;  1V87 A;  4XI1 A;  1X4I A;  2C2L A;  3N9M A;  4I7D A;  3LRQ A;  3ZVZ B;  4GNF A;  5B75 A;  2MUM A;  4S3O B;  2YQL A;  2RI7 A;  4AYC A;  3DPL R;  3N9P A;  4Q6F A;  4UP5 A;  1IYM A;  1K2F A;  1MM2 A;  4QF3 A;  2CSY A;  5G04 B;  4AVX A;  1VFY A;  3M63 A;  1FP0 A;  2KGI A;  2KWO A;  4CA1 A;  4FK5 A;  3LQH A;  1LDK C;  2LXP C;  2Y1M A;  1WEQ A;  2PUY A;  1WEU A;  3QZV A;  3SHB A;  4YAB A;  5FER A;  1WGM A;  3N9O A;  4O64 A;  4TKP B;  3VK6 A;  1E4U A;  2YUR A;  4IC2 A;  1WEE A;  5AIU A;  5FEY A;  2YHN A;  2G43 A;  5LKU A;  5TDW A;  2MA6 A;  3T7L A;  2E6R A;  2VJF A;  4UI9 B;  4R7E A;  2M1R A;  3O37 A;  4YAD A;  1JOC A;  1Z6U A;  1JM7 B;  3N9L A;  2M3H A;  2H0D A;  1LDJ B;  5EYA F;  4V3K C;  4PPE A;  2LGL A;  4ZDT A;  5TBN A;  4L58 A;  2VPG A;  3C5K A;  2YU4 A;  4IC3 A;  5LCW B;  3KV5 A;  4N3W A;  4UP0 A;  1WEN A;  1X4J A;  1XWH A;  5B79 A;  2CKL A;  5H9M A;  4GNE A;  5G0F A;  4A4C A;  5B76 A;  4PTB A;  3GL6 A;  4I7C A;  1WES A;  3GV4 A;  1FBV A;  2YUC A;  2M6M A;  5KH9 A;  4A4B A;  2ECV A;  3IHP A;  5AIT A;  2KU3 A;  4AYC B;  2L0B A;  2EA6 A;  2F6J A;  4YAT A;  3L1Z B;  4R8P K;  2QJ0 A;  2G45 A;  2KYU A;  1WEM A;  4WZ0 A;  4W4U A;  3HCT A;  4ZQL A;  5KH7 A;  2FUU A;  2MNZ A;  3V43 A;  3KV6 A;  5LKT A;  1WEP A;  2LQ6 A;  4LK9 A;  2YSJ A;  5B8D A;  2ECG A;  5KH3 A;  1HYI A;  2VPE A;  1Z2Q A;  5FB0 A;  2E6S A;  3O36 A;  3NG2 A;  2Y43 A;  3EB5 A;  2DX8 A;  2BAY A;  2Y1N A;  3U5N A;  4C9Z A;  2CT2 A;  2VJF B;  5G05 B;  4LAD B;  3ZTG A;  3ZNI A;  3O33 A;  5D1L B;  1MM3 A;  3O70 A;  3SOX A;  3M62 A;  2MT5 A;  2H0D B;  2KWN A;  3HCS A;  5D1K B;  2LGV A;  2L43 A;  3T6R A;  3KNV A;  1VD4 A;  2F42 A;  4YBM A;  2K4D A;  1WEW A;  5I3L A;  5JG6 A;  4AP4 A;  1WIL A;  2ECI A;  2FSA A;  2OXQ C;  2QIC A;  3ASL A;  5H1V A;  3L11 A;  4GNG A;  4N4F A;  4NN2 A;  5C13 A;  2M85 A;  2KIZ A;  5TDR A;  1DVP A;  2CKL B;  1CHC A;  3L1X A;  2ZET C;  3LQJ A;  4WZ3 B;  2EGP A;  5LKZ A;  2ECT A;  4GB0 A;  4MVT A;  5TRB A;  2NAA A;  3DQV R;  4BBQ A;  5TAB A;  2XEU A;  2YHO A;  2MNY A;  4P5O B;  4BHW A;  2YYR A;  1VYX A;  2ECJ A;  1T1H A;  1ZBD B;  2LXH C;  2MD7 B;  2YSM A;  3HTK C;  2KGG A;  4FIP A;  4WA6 A;  2IDA A;  3RPG B;  2JRJ A;  2VNF A;  5DIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...