3VK6A

Crystal structure of a phosphotyrosine binding domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase Hakai
total genus 20
structure length 96
sequence length 96
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18408 zf_Hakai C2H2 Hakai zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3vk6A01
3.30.160.640 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vk6A02
3LQIA 3T7LA 3M99A 3ZVYA 3M63A 2MA6A 5J3XA 1E4UA 2OXQC 2MD7B 2JMIA 1BORA 2K16A 5KH7A 4CCGX 3IHPA 3MHHA 2PUYA 2YU4A 2FUUA 2LGKA 3HTKC 4A0CD 2E6SA 5B78A 3O33A 4LADB 2VNFA 3N9NA 3DPLR 5D1MB 5KH3A 3RPGB 1K2FA 3ZVZB 4S3OC 3VK6A 4I7CA 3O34A 4I7DA 2KREA 3ASLA 2LXHC 1DVPA 1JM7A 2E6RA 4WA6A 2RSDA 4GNGA 5AIUA 1U6GB 5C11A 5LKZA 3DQVR 2VJFA 4UP0A 4WZ3B 3M62A 3SOXA 5D1LB 1T1HA 1V87A 2LGLA 1WFKA 4FJCA 2FSAA 3RTRB 1LDKC 5TBNA 3PHDA 5AITA 2H0DB 1Z6UA 2KE1A 5D1KB 4MVTA 4AUQB 2MD8C 4QF3A 3EB5A 4PTBA 3ZNIA 2C2VS 2KGGA 2ZETC 2M85A 5LKUA 1X4JA 2YYRA 4GNDA 5DINA 5EYAF 2CSZA 2MIQA 2IDAA 2UZGA 5H1TA 2LXPC 4LLBA 5G05B 2L75A 2YW8A 2YQLA 4YAXA 2F42A 2LV9A 2VPEA 3LQHA 5G04B 2YSJA 2YREA 2PNXA 1FBVA 1VD4A 5B77A 5DKAA 3O37A 4UP5A 2JRJA 1JOCA 1WEPA 2NAAA 2G43A 2I50A 1ZBDB 4WZ2A 2QJ0A 4A4CA 2KWOA 4ZQLA 1Z60A 2KU3A 4W4UA 2MA5A 1WGMA 4UI9B 4PPEA 2G45A 4B86C 2YUCA 5G0FA 2RI7A 4S3OB 5FB1A 3L1XA 1XWHA 2C2LA 5FEYA 5TABA 2YT5A 4A49A 4ZDTA 3ZYQA 1WEOA 3U5NA 1X4UA 5H9MA 1MM3A 3LQJA 1WENA 2L5UA 2KFTA 4ZUXU 2Y1MA 3SOUA 2KIZA 2EGPA 2VJFB 4GNEA 2VJEA 1WIMA 2L0BA 3N9LA 4LJNA 2CKLB 2XEUA 2ECWA 4Q6FA 4X3GA 4AP4A 3V43A 2LGGA 4R2YA 2Y43A 2DX8A 3KV6A 2H0DA 5I3LA 2JMDA 3U5PA 5B8DA 1RMDA 2FUIA 3QZVA 2MNZA 2ECVA 2KGIA 4YC9A 1CHCA 1HYJA 2KR4A 5TDRA 4XI1A 2M1RA 3SHBA 4N4FA 2VPBA 2HDPA 3N9MA 3T6RA 2KWKA 2F6JA 2L43A 4R7EA 3O70A 4FK5A 2YHNA 1F62A 5B76A 4F52B 5B75A 2BAYA 2ECTA 1WEVA 4V3LC 3GV4A 4QF2A 4BBQA 4YADA 4AYCA 5C13A 1X4IA 3KNVA 1Z2QA 2K1JA 2VP7A 4WZ0A 4FO9A 1FP0A 2LDRA 3O7AA 2K17A 2CT2A 4NN2A 2LN0A 2VPDA 1WEMA 2MUMA 4C9ZA 5TRBA 4YBTA 4LKAA 2QIZA 4YBSA 3ZTGA 2ECNA 2F6NA 4L7XA 1IYMA 1WEQA 5JG6A 5LKTA 2QICA 2ECIA 3RPGC 2M3HA 3N9OA 1WE9A 3O36A 2LGVA 1VYXA 1JM7B 3PUQA 2MT5A 3GL6A 5FB0A 4TKPB 3KQIA 1LDJB 3O35A 1HYIA 2YQMA 2LQ6A 1WEUA 5H1UA 3ZPV1 5TDWA 3C6WA 1WEWA 4AVXA 2VJEB 4N3WA 4GB0A 2CKLA 3U5OA 2LRIC 3ZPVE 4IC2A 1WEEA 2G6QA 4CA1A 4LK9A 3N9PA 2VPGA 2D8SA 3PURA 5KH9A 4YBMA 3N9QA 1N87A 4O64A 3C5KA 2KWJA 4P5OB 2YURA 3LRQA 3L11A 1VFYA 2HYED 4V3KC 2K4DA 2Y1NA 2ECJA 1WILA 3HCTA 3MHSA 3NG2A 4IC3A 4YATA 2L80A 2YHOA 2EODA 2CSYA 4I7BA 3U5MA 4FIPA 4YABA 3EB6A 5H1VA 3I2DA 5LCWB 4AYCB 2M6MA 4A4BA 4GNFA 1MM2A 5LKXA 2MNYA 4L58A 2ECGA 2JMJA 2KWNA 3HCSA 3HCUA 1WESA 2KYUA 4MSXA 3L1ZB 3FL2A 1G25A 2AN6A 4R8PK 5FERA 5B79A 4BHWA 4B7YC 2EA6A 3KV5A 2YSMA 3SOWA 2XB1A
chains in the Genus database with same CATH superfamily
3T1HE 2EMCA 3ADGA 1GZ6A 1KJKA 2YTJA 4R2PA 4R2DA 2EOZA 4B3TE 3LQIA 3T7LA 3M99A 1A1FA 2NUFA 3ZVYA 3VYXA 3M63A 2BBGA 4HTGA 2F4VE 2MA6A 3J7Yp 5J3XA 1E4UA 2OXQC 1N3GA 3ADLA 4DUYE 1BBOA 2YTOA 4BC9A 5FLXC 2MD7B 1ZAAC 2CT1A 2JM3A 2JMIA 4TUGA 1BORA 2K16A 3E2DA 5AE2A 5A69A 5KH7A 3FJUB 4F2JC 2E61A 4CCGX 4JI3E 2JYAA 2L3JA 2VQEE 3IHPA 3MHHA 3LVRE 2PUYA 2YU4A 2FUUA 2EPMX 1L4SA 4M0VA 4GEQB 2LGKA 2JXPA 3HTKC 4A0CD 4O4KA 4P7DA 2E6SA 2ENAA 3MHHC 5B78A 2EM9A 5AASA 2MC5A 3ADJA 3O33A 3H7HA 4LADB 2LUQA 2VRDA 2VNFA 3FANA 3N9NA 3KWRA 3DPLR 2YRMA 5LL6R 4B3ME 2EM7A 2M13A 5D1MB 5KH3A 3RPGB 4X65E 1A1JA 2I9IA 3C6KA 4F1PA 2LJUA 2YU5A 1K2FA 4KWYA 2M7QA 3EPKA 3ZVZB 2K7IA 4S3OC 3VK6A 2E1MA 5SVXA 4I7CA 2EPPA 4RHBB 5BR8E 3O34A 1BB8A 4I7DA 1A1KA 3C4TA 2KREA 3ASLA 3AV0A 4DR5E 2LXHC 2LE2A 1DVPA 1JM7A 4BHBA 2E6RA 2WZOA 4WA6A 2EMGA 1F2IG 1ZBTA 2YTDA 4ZYDA 2RSDA 4GNGA 5AIUA 1U6GB 5C11A 4JI0E 5LKZA 4KZSA 3DQVR 4R03A 1YYWA 2DLQA 2JOXA 4ZYGA 5A6JA 2VJFA 4UP0A 4WZ3B 5IWAE 3M62A 3J7AG 2N3HA 3SOXA 5D1LB 1TF6A 1T1HA 3VHTB 2PRTA 1V87A 4DV4E 2LGLA 2GHFA 3OTOE 1HR0E 1DCQA 4K0KE 1WFKA 4FJCA 2FSAA 2FD4A 3RTRB 4X62E 1LDKC 1HNXE 5TBNA 3PHDA 5AITA 1SFEA 4M9VC 2MDGA 5IXMB 2H0DB 1Z6UA 2KE1A 3MHSC 5D1KB 4MVTA 4AUQB 2MD8C 2V86A 1J5EE 2N8XA 4QF3A 5DNYA 3T1YE 2EPLX 3EB5A 4PTBA 3ZNIA 2C2VS 2KGGA 1G2DC 1UILA 2EPNA 2KOUA 2EM5A 2ZETC 2JY9A 1IQSA 2M85A 2CPNA 3HXLA 3FM8C 5LKUA 4ZYHA 1X4JA 2EOEA 2R76A 2YYRA 2EM6A 1HNWE 4GNDA 5DINA 5EYAF 3DF6A 2ELYA 2CSZA 2MIQA 2EPAA 3KDEC 2YTNA 5SVIB 2XOZA 2IDAA 2EN1A 2UZGA 5H1TA 1UHZA 3AUZA 4HEIA 4MLQA 3T9KA 4P78A 2LXPC 2LBSB 2EOOA 4LLBA 2GPIA 5G05B 3THNA 1UBDC 2L75A 2B9DA 2YW8A 3M7KA 2EPZA 2V89A 4R2EA 2YQLA 4YAXA 2F42A 5A6BD 1MGTA 2EN7A 2YT4A 2MC6A 4Z0OA 2LV9A 3BF2A 2VPEA 2EL6A 2JWOA 3LQHA 1BBGA 5G04B 2YSJA 2YREA 2PNXA 4Z0RA 1FBVA 2CTDA 2EPRA 2DRPA 1VD4A 3LMLA 3EPJA 5B77A 2VE7C 5DKAA 3O37A 1YUIA 4UP5A 2JRJA 2FV4B 1T4LB 2YTEA 1JOCA 1ZBQA 1WEPA 5KL3A 2NAAA 2L8TA 1ZR9A 2L3CA 2CRRA 4QQ4A 2NUGA 1IQOA 2Q8UA 2G43A 2I50A 2EPKX 4JI6E 1ZBDB 3C6MA 2UXDE 2WBSA 4WZ2A 2EOQA 2V88A 2QJ0A 1T39A 2HJJA 1O0WA 4A4CA 2JUNA 2EMZA 2YTGA 3JTZA 1EH7A 4LFCE 2H36X 2KWOA 4ZQLA 4LFBE 1Z60A 1PJQA 4OOGC 1RQ0A 2KU3A 2V87A 4M30A 2KKYA 4LF7E 2EOHA 2JR1A 4O24A 4W4UA 3L00A 2RS7A 2DB2A 2MA5A 1WGMA 4UI9B 1FKAE 2LAUA 2DIXA 4PPEA 2EPCA 4NHRA 2FGGA 2YSPA 1PJSA 4R2RA 2LT7A 2G45A 4WXCA 4B86C 2ENCA 1MEYC 1YUJA 2YSOA 2YUCA 5G0FA 4OGEA 4MLVA 4X64E 4LF6E 1IBKE 1X5WA 2EMAA 2RI7A 2EM4A 4S3OB 1YFHA 2HC5A 1J26A 3PLWA 1QNTA 5FB1A 2EQ0A 1B69A 3L1XA 1XWHA 2C2LA 3M99B 4WYQB 5FEYA 4WX9A 5TABA 1G2FC 2YT5A 4A49A 2EMHA 2XOCA 4ZDTA 4X8WA 1A1IA 3ZYQA 1WEOA 4JI4E 2EXUA 5A6KA 2EOMA 1ZU1A 4X9JA 5A6AA 3U5NA 4IS1C 1TN9A 1X4UA 5H9MA 1MM3A 3LQJA 1GTKA 1WENA 5A2QC 2L5UA 2KFTA 2P57A 3DWDA 1X49A 1X6FA 2RSMA 2YTFA 4ZUXU 3QG5C 2ODRD 3F6HA 2EZ6A 1UN6B 4B3RE 4NXNE 2V83A 5AC5A 2Y1MA 3SOUA 2D9HA 4DKKA 1WHQA 2KIZA 2EGPA 2VJFB 2EN4A 4Q35B 4GZNC 2D8UA 3HPSA 1YSAC 4GNEA 2VJEA 1WIMA 5ADZA 4R2SA 2L0BA 4L5NC 3N9LA 4LJNA 4R8OA 4JV5E 2EOSA 2CKLB 2R1FA 5KL2A 1PJTA 2L2MA 4WPYA 2L2NA 2XEUA 4BHCA 2ECWA 4AQYE 1X47A 4Q6FA 4X3GA 2LGGA 3V43A 4AP4A 4R2YA 2Y43A 4I8OA 3LJUX 2IHR1 2EM8A 2K4VA 5KL4A 1N32E 2UXBE 1T4NA 2DX8A 4OX9E 2EE8A 2EPXA 3KV6A 2JP9A 2H0DA 1GQEA 4BMJA 5I3LA 1RC7A 2LTSA 4BS9A 2ODRC 1PKPA 4YHHE 2JMDA 4JI8E 1WXRA 1JK2A 2UUBE 2DJAA 3U5PA 2HGHA 3DJWA 5LLQA 5B8DA 4GKKE 4L8NA 3ZOQB 1WHNA 1RMDA 2FUIA 2LUPB 3QZVA 3EPHA 5SVIA 3KZZA 2MNZA 2IQJA 4R2QA 2ECVA 4TUIA 2KGIA 2M1SA 5IT9C 4YC9A 4DV7E 5F3WA 2EL4A 1CHCA 3SUBA 4DR6E 2EMBA 1HYJA 2EMIA 2KR4A 2V8QB 1A1LA 4NZVA 2JPAA 5TDRA 2MKNA 4XI1A 2M1RA 2RPCA 3SHBA 2YPNA 4N4FA 1IMUA 2VPBA 2B7VA 2B0OE 2HDPA 3N9MA 3T6RA 1DQ3A 2KWKA 2EOJA 3F6GA 2F6JA 2L43A 4IJDA 1T38A 4R7EA 3O70A 4FK5A 5KL5A 2YHNA 4H9DA 1F62A 4J8ZA 5B76A 2FFWA 4F52B 2LV2A 3KZYA 1XNRE 2EPUA 5B75A 5T6JA 3HTXA 4LFAE 2EOXA 2DLKA 2EMFA 4O43A 2GLIA 2BAYA 2ECTA 1WEVA 4V3LC 3GV4A 5KL7A 4QF2A 4BBQA 4YADA 4AYCA 2MKEA 5C13A 2DMYA 1X4IA 2EMKA 2RS6A 3KNVA 4DR3E 1Z2QA 2N3GA 2DSYA 2K1JA 3FEHA 2E5LE 4WFTA 2VP7A 4WZ0A 4FO9A 2MDRA 1FP0A 2LDRA 1SR9A 2UUCE 1DI2A 2L6MA 2M9AA 2RR4A 3O7AA 2K17A 5LMNE 2CT2A 1EKZA 2LMZA 3LVQE 2E72A 3ECRA 4NN2A 3HPZA 3FAOA 2LN0A 4LTYA 2VPDA 1WEMA 2MUMA 4N4RB 4C9ZA 2EN2A 1PDAA 4F9AB 4LF5E 2VF1A 1YYKA 3MSWA 2B3TB 1LLMC 3FIGA 5TRBA 4YBTA 4LKAA 2QIZA 4F6MA 4LF4E 2DSMA 2YVRA 5CFFE 4YBSA 3ZTGA 2ECNA 1N36E 4DV5E 3P1XA 2LJHA 4R2CA 3J80C 2F6NA 4L7XA 4F54A 2JVAA 4M2ZA 4X66E 2JOBA 1IYMA 2NUEA 4RH8A 4DR7E 1WJPA 1WEQA 1XMOE 1N33E 2LVHA 4DV3E 1XNQE 3Q1DA 4YY3E 5JG6A 2EOFA 5LKTA 2L2KB 2QICA 2EQ3A 2YRHA 2ECIA 2L7PA 2F8BA 4LU9A 4F9CB 1FJGE 3RPGC 4WSGA 2M3HA 1WRJA 3N9OA 1WE9A 3H09A 3O36A 2LGVA 3J81C 1VYXA 2DMIA 4LF9E 1JM7B 1NCSA 2EMLA 4WSPA 3BGHA 2YTQA 5SVYA 1EH6A 1MBMA 3PUQA 2MT5A 3GL6A 5FB0A 4TKPB 3KQIA 2YTPA 4DUZE 3VYYA 1LDJB 3O35A 1HYIA 2L33A 1Z1BA 2YQMA 2LQ6A 4BC7A 1WEUA 1A1GA 5H1UA 3ZPV1 2EN8A 5TDWA 2G7HA 4OGCA 2EORA 2EM0A 4FK5C 2EWLA 4O5GA 4JI2E 2LTRA 2WBUA 3C6WA 1WEWA 4AVXA 3OMLA 1KYQA 2VJEB 4F9BB 4N3WA 1AH5A 4GB0A 2CKLA 5K3QA 3U5OA 2A25A 2M4IA 2MKDA 5A6BA 1X6EA 2LO3A 2LRIC 2EJ4A 3ZPVE 4IC2A 1I94E 1WEEA 2ZM6E 1QU6A 4R2AA 2G6QA 4CA1A 3IWDA 4LK9A 4O62A 2ENHA 1IBME 3N9PA 1DGCA 5KL6A 2EMYA 2J7JA 2VPGA 2ADRA 2D8SA 3PURA 2LCEA 5KH9A 2EPOA 4DR1E 4YBMA 2KONA 3N9QA 1HNZE 1N87A 4DV6E 2CRWA 1NEIA 4JYAE 3RMPA 1TF3A 4O64A 5AE3A 3BBGA 2WBTA 3C5KA 1AAYA 2UUAE 1YZ9A 2KWJA 4P5OB 3JAMC 2DGCA 4Q28A 2YURA 3LRQA 2RSIA 4JI1E 2EGMA 3TQMA 4DR4E 2EP3A 4DV2E 3L11A 2YWQA 1P47A 1VFYA 1A1HA 1EH8A 2XP0A 2L92A 1X48A 2WCC3 2EN3A 2HYED 4V3KC 2K4DA 2Y1NA 1YPNA 4DV1E 1X6HA 2ECJA 1WILA 3BIDA 3IWBA 5AC4A 4JI5E 4GKJE 2YTIA 2CSVA 3HCTA 3JUEA 4NXME 3THOB 2YU8A 1N34E 2EMWA 2NABA 3MHSA 3K6QA 3NG2A 4IC3A 4YATA 5AE1A 2L80A 2YHOA 3JU0A 2EODA 2CSYA 4I7BA 2EOIA 2NA2A 3U5MA 2UXCE 2V85A 4FIPA 3ADIA 4YABA 3C4BA 3IWCA 4KHPE 4BBYA 3EB6A 5LMUE 2VQFE 1JK1A 5H1VA 2YRKA 3I2DA 2EL5A 3DDTA 5LCWB 4AYCB 2CSHA 2LRSA 4F6NA 1YYOA 4DMIA 2M6MA 4A4BA 4GNFA 1MM2A 5LKXA 1X3CA 2EM3A 2FTXB 4JI7E 2MNYA 1IBLE 2XOYA 3UK3C 2I13A 4L58A 2ECGA 2JMJA 4DR2E 2KWNA 3HCUA 3HCSA 1WESA 2KYUA 2B7TA 3EPLA 3O47A 2RTXA 2EM2A 3MDBC 4MSXA 2CONA 3L1ZB 3LDYA 3FL2A 3EQ1A 1G25A 2AN6A 4R8PK 2ELZA 1T4OA 2KHXA 5FERA 3HQ1A 1STUA 5B79A 4WXDA 4BHWA 2HHHE 2EN6A 2UU9E 2RQLA 4BCAA 2YZTA 4B7YC 3LLHA 2OWAA 2EA6A 2KKXA 5IV8B 4DV0E 2BB8A 3KV5A 2EQ1A 1XMQE 4LF8E 5TSEA 2EMXA 4ZYEA 4B3SE 2YSMA 2EOYA 3SOWA 2XB1A
chains in the Genus database with same CATH topology
3T1HE 3ADGA 1GZ6A 4B3TE 3LQIA 3T7LA 3M99A 2NUFA 3VYXA 3ZVYA 3M63A 2F4VE 2MA6A 3J7Yp 5J3XA 1E4UA 2OXQC 3ADLA 4DUYE 4BC9A 5FLXC 2MD7B 2JMIA 4TUGA 1BORA 2K16A 5AE2A 5KH7A 4CCGX 4JI3E 2L3JA 2VQEE 3IHPA 3MHHA 2PUYA 2YU4A 2FUUA 4M0VA 4GEQB 2LGKA 3HTKC 4A0CD 4P7DA 2E6SA 5AASA 5B78A 2MC5A 3ADJA 3O33A 4LADB 2LUQA 2VNFA 3N9NA 3KWRA 3DPLR 5LL6R 4B3ME 5D1MB 5KH3A 3RPGB 4X65E 1K2FA 2M7QA 3ZVZB 4S3OC 3VK6A 2E1MA 4I7CA 5BR8E 3O34A 4I7DA 3C4TA 2KREA 3ASLA 3AV0A 4DR5E 2LXHC 2LE2A 1DVPA 1JM7A 2E6RA 2WZOA 4WA6A 1ZBTA 2RSDA 4GNGA 5AIUA 1U6GB 5C11A 4JI0E 5LKZA 4KZSA 3DQVR 4R03A 1YYWA 2JOXA 2VJFA 4UP0A 4WZ3B 5IWAE 3M62A 3J7AG 2N3HA 3SOXA 5D1LB 1T1HA 1V87A 4DV4E 2LGLA 1HR0E 3OTOE 4K0KE 1WFKA 4FJCA 2FSAA 4X62E 3RTRB 1LDKC 1HNXE 5TBNA 3PHDA 5AITA 2H0DB 1Z6UA 2KE1A 5D1KB 4MVTA 4AUQB 2MD8C 2V86A 1J5EE 4QF3A 5DNYA 3T1YE 3EB5A 4PTBA 3ZNIA 2C2VS 2KGGA 1UILA 2KOUA 2ZETC 2JY9A 2CPNA 2M85A 3HXLA 5LKUA 1X4JA 2YYRA 1HNWE 4GNDA 5DINA 5EYAF 3DF6A 2CSZA 2MIQA 2IDAA 2UZGA 5H1TA 1UHZA 3AUZA 4P78A 2LXPC 2LBSB 4LLBA 5G05B 2L75A 2B9DA 2YW8A 2V89A 2YQLA 4YAXA 2F42A 2YT4A 2MC6A 2LV9A 2VPEA 2JWOA 3LQHA 5G04B 2YSJA 2YREA 2PNXA 1FBVA 1VD4A 3LMLA 5B77A 2VE7C 5DKAA 3O37A 4UP5A 2JRJA 2FV4B 1T4LB 1JOCA 1ZBQA 1WEPA 2NAAA 2L8TA 2L3CA 2NUGA 2G43A 2I50A 4JI6E 1ZBDB 2UXDE 4WZ2A 2V88A 2QJ0A 1O0WA 4A4CA 3JTZA 4LFCE 2H36X 2KWOA 4ZQLA 4LFBE 1Z60A 4OOGC 1RQ0A 2KU3A 2V87A 4M30A 4LF7E 2JR1A 4W4UA 2RS7A 2DB2A 2MA5A 1WGMA 4UI9B 1FKAE 2DIXA 4PPEA 2FGGA 2G45A 4B86C 2YUCA 5G0FA 4X64E 4LF6E 1IBKE 2RI7A 4S3OB 1J26A 5FB1A 3L1XA 1XWHA 2C2LA 4WYQB 5FEYA 5TABA 2YT5A 4A49A 4ZDTA 4X8WA 3ZYQA 1WEOA 4JI4E 3U5NA 1X4UA 5H9MA 1MM3A 3LQJA 1WENA 5A2QC 2L5UA 2KFTA 1X49A 2RSMA 4ZUXU 2ODRD 3F6HA 2EZ6A 4B3RE 4NXNE 2V83A 2Y1MA 3SOUA 4DKKA 1WHQA 2KIZA 2EGPA 2VJFB 3HPSA 4GNEA 2VJEA 1WIMA 5ADZA 2L0BA 4L5NC 3N9LA 4LJNA 4R8OA 4JV5E 2CKLB 2L2MA 4WPYA 2L2NA 2XEUA 2ECWA 4AQYE 1X47A 4Q6FA 4X3GA 4AP4A 3V43A 2LGGA 4R2YA 2Y43A 4I8OA 2IHR1 2K4VA 1N32E 2UXBE 1T4NA 2DX8A 4OX9E 3KV6A 2H0DA 1GQEA 4BMJA 5I3LA 1RC7A 2LTSA 4BS9A 2ODRC 1PKPA 4YHHE 2JMDA 4JI8E 1WXRA 2UUBE 3U5PA 3DJWA 5B8DA 4GKKE 4L8NA 3ZOQB 1WHNA 1RMDA 2FUIA 2LUPB 3QZVA 2MNZA 4TUIA 2ECVA 2KGIA 2M1SA 5IT9C 4YC9A 4DV7E 5F3WA 1CHCA 4DR6E 1HYJA 2V8QB 2KR4A 5TDRA 4XI1A 2M1RA 3SHBA 4N4FA 2VPBA 2B7VA 2HDPA 3N9MA 3T6RA 1DQ3A 2KWKA 1IBLE 3F6GA 2F6JA 2L43A 4R7EA 3O70A 4FK5A 2YHNA 1F62A 4J8ZA 5B76A 4F52B 1XNRE 5B75A 5T6JA 3HTXA 4LFAE 2BAYA 2ECTA 1WEVA 4V3LC 3GV4A 4QF2A 4BBQA 4YADA 4AYCA 5C13A 2DMYA 1X4IA 2RS6A 3KNVA 4DR3E 1Z2QA 2N3GA 2DSYA 2K1JA 2E5LE 4WFTA 2VP7A 4WZ0A 4FO9A 2MDRA 1FP0A 2LDRA 1SR9A 2UUCE 1DI2A 2L6MA 3O7AA 5LMNE 2K17A 2CT2A 1EKZA 2LMZA 4LTYA 4NN2A 3HPZA 2LN0A 2VPDA 1WEMA 2MUMA 4C9ZA 4F9AB 4LF5E 2VF1A 1YYKA 3MSWA 2B3TB 3FIGA 5TRBA 4YBTA 4LKAA 2QIZA 4LF4E 5CFFE 4YBSA 3ZTGA 2ECNA 1N36E 4DV5E 3P1XA 2LJHA 3J80C 2F6NA 4L7XA 4F54A 2JVAA 4M2ZA 4X66E 2JOBA 1IYMA 2NUEA 4DR7E 1XMOE 1WEQA 1N33E 4DV3E 1XNQE 4YY3E 5JG6A 2L2KB 5LKTA 2QICA 2ECIA 2F8BA 4F9CB 4LU9A 1FJGE 3RPGC 2M3HA 3N9OA 1WE9A 3H09A 3O36A 2LGVA 3J81C 1VYXA 4LF9E 1JM7B 4WSPA 3PUQA 2MT5A 3GL6A 5FB0A 4TKPB 3KQIA 4DUZE 3VYYA 1LDJB 3O35A 1HYIA 2L33A 2YQMA 2LQ6A 4BC7A 1WEUA 4JI5E 5H1UA 3ZPV1 2G7HA 5TDWA 2EWLA 4JI2E 2LTRA 3C6WA 1WEWA 4AVXA 3OMLA 2VJEB 4F9BB 4N3WA 4GB0A 2CKLA 3U5OA 2M4IA 2LRIC 3ZPVE 4IC2A 1I94E 1WEEA 2ZM6E 1QU6A 2G6QA 4CA1A 3IWDA 4LK9A 1IBME 3N9PA 2VPGA 2D8SA 3PURA 5KH9A 4DR1E 4YBMA 2KONA 3N9QA 1HNZE 1N87A 4DV6E 4JYAE 3RMPA 4O64A 5AE3A 3C5KA 2UUAE 1YZ9A 2KWJA 4P5OB 3JAMC 4Q28A 2YURA 3LRQA 4JI1E 4DR4E 4DV2E 3L11A 1VFYA 2L92A 1X48A 2HYED 4V3KC 2K4DA 2Y1NA 4DV1E 2ECJA 1WILA 3IWBA 4GKJE 3HCTA 4NXME 1N34E 3K6QA 3MHSA 3NG2A 4IC3A 4YATA 5AE1A 2L80A 2YHOA 3JU0A 2EODA 2CSYA 4I7BA 2NA2A 3U5MA 2UXCE 2V85A 4FIPA 3ADIA 4YABA 3C4BA 3IWCA 4KHPE 4BBYA 3EB6A 5LMUE 2VQFE 5H1VA 3I2DA 5LCWB 4AYCB 2LRSA 1YYOA 4DMIA 2M6MA 4A4BA 4GNFA 1MM2A 5LKXA 2FTXB 4JI7E 2MNYA 4L58A 2ECGA 2JMJA 4DR2E 2KWNA 3HCSA 3HCUA 1WESA 2KYUA 2B7TA 2RTXA 4MSXA 3L1ZB 3FL2A 1G25A 2AN6A 4R8PK 2KHXA 1T4OA 3HQ1A 5FERA 1STUA 5B79A 4BHWA 2HHHE 2UU9E 4BCAA 2YZTA 4B7YC 3LLHA 4DV0E 2EA6A 3KV5A 1XMQE 4LF8E 4B3SE 2YSMA 3SOWA 2XB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQI A;  3T7L A;  3M99 A;  3ZVY A;  3M63 A;  2MA6 A;  5J3X A;  1E4U A;  2OXQ C;  2MD7 B;  2JMI A;  1BOR A;  2K16 A;  5KH7 A;  4CCG X;  3IHP A;  3MHH A;  2PUY A;  2YU4 A;  2FUU A;  2LGK A;  3HTK C;  4A0C D;  2E6S A;  5B78 A;  3O33 A;  4LAD B;  2VNF A;  3N9N A;  3DPL R;  5D1M B;  5KH3 A;  3RPG B;  1K2F A;  3ZVZ B;  4S3O C;  3VK6 A;  4I7C A;  3O34 A;  4I7D A;  2KRE A;  3ASL A;  2LXH C;  1DVP A;  1JM7 A;  2E6R A;  4WA6 A;  2RSD A;  4GNG A;  5AIU A;  1U6G B;  5C11 A;  5LKZ A;  3DQV R;  2VJF A;  4UP0 A;  4WZ3 B;  3M62 A;  3SOX A;  5D1L B;  1T1H A;  1V87 A;  2LGL A;  1WFK A;  4FJC A;  2FSA A;  3RTR B;  1LDK C;  5TBN A;  3PHD A;  5AIT A;  2H0D B;  1Z6U A;  2KE1 A;  5D1K B;  4MVT A;  4AUQ B;  2MD8 C;  4QF3 A;  3EB5 A;  4PTB A;  3ZNI A;  2C2V S;  2KGG A;  2ZET C;  2M85 A;  5LKU A;  1X4J A;  2YYR A;  4GND A;  5DIN A;  5EYA F;  2CSZ A;  2MIQ A;  2IDA A;  2UZG A;  5H1T A;  2LXP C;  4LLB A;  5G05 B;  2L75 A;  2YW8 A;  2YQL A;  4YAX A;  2F42 A;  2LV9 A;  2VPE A;  3LQH A;  5G04 B;  2YSJ A;  2YRE A;  2PNX A;  1FBV A;  1VD4 A;  5B77 A;  5DKA A;  3O37 A;  4UP5 A;  2JRJ A;  1JOC A;  1WEP A;  2NAA A;  2G43 A;  2I50 A;  1ZBD B;  4WZ2 A;  2QJ0 A;  4A4C A;  2KWO A;  4ZQL A;  1Z60 A;  2KU3 A;  4W4U A;  2MA5 A;  1WGM A;  4UI9 B;  4PPE A;  2G45 A;  4B86 C;  2YUC A;  5G0F A;  2RI7 A;  4S3O B;  5FB1 A;  3L1X A;  1XWH A;  2C2L A;  5FEY A;  5TAB A;  2YT5 A;  4A49 A;  4ZDT A;  3ZYQ A;  1WEO A;  3U5N A;  1X4U A;  5H9M A;  1MM3 A;  3LQJ A;  1WEN A;  2L5U A;  2KFT A;  4ZUX U;  2Y1M A;  3SOU A;  2KIZ A;  2EGP A;  2VJF B;  4GNE A;  2VJE A;  1WIM A;  2L0B A;  3N9L A;  4LJN A;  2CKL B;  2XEU A;  2ECW A;  4Q6F A;  4X3G A;  4AP4 A;  3V43 A;  2LGG A;  4R2Y A;  2Y43 A;  2DX8 A;  3KV6 A;  2H0D A;  5I3L A;  2JMD A;  3U5P A;  5B8D A;  1RMD A;  2FUI A;  3QZV A;  2MNZ A;  2ECV A;  2KGI A;  4YC9 A;  1CHC A;  1HYJ A;  2KR4 A;  5TDR A;  4XI1 A;  2M1R A;  3SHB A;  4N4F A;  2VPB A;  2HDP A;  3N9M A;  3T6R A;  2KWK A;  2F6J A;  2L43 A;  4R7E A;  3O70 A;  4FK5 A;  2YHN A;  1F62 A;  5B76 A;  4F52 B;  5B75 A;  2BAY A;  2ECT A;  1WEV A;  4V3L C;  3GV4 A;  4QF2 A;  4BBQ A;  4YAD A;  4AYC A;  5C13 A;  1X4I A;  3KNV A;  1Z2Q A;  2K1J A;  2VP7 A;  4WZ0 A;  4FO9 A;  1FP0 A;  2LDR A;  3O7A A;  2K17 A;  2CT2 A;  4NN2 A;  2LN0 A;  2VPD A;  1WEM A;  2MUM A;  4C9Z A;  5TRB A;  4YBT A;  4LKA A;  2QIZ A;  4YBS A;  3ZTG A;  2ECN A;  2F6N A;  4L7X A;  1IYM A;  1WEQ A;  5JG6 A;  5LKT A;  2QIC A;  2ECI A;  3RPG C;  2M3H A;  3N9O A;  1WE9 A;  3O36 A;  2LGV A;  1VYX A;  1JM7 B;  3PUQ A;  2MT5 A;  3GL6 A;  5FB0 A;  4TKP B;  3KQI A;  1LDJ B;  3O35 A;  1HYI A;  2YQM A;  2LQ6 A;  1WEU A;  5H1U A;  3ZPV 1;  5TDW A;  3C6W A;  1WEW A;  4AVX A;  2VJE B;  4N3W A;  4GB0 A;  2CKL A;  3U5O A;  2LRI C;  3ZPV E;  4IC2 A;  1WEE A;  2G6Q A;  4CA1 A;  4LK9 A;  3N9P A;  2VPG A;  2D8S A;  3PUR A;  5KH9 A;  4YBM A;  3N9Q A;  1N87 A;  4O64 A;  3C5K A;  2KWJ A;  4P5O B;  2YUR A;  3LRQ A;  3L11 A;  1VFY A;  2HYE D;  4V3K C;  2K4D A;  2Y1N A;  2ECJ A;  1WIL A;  3HCT A;  3MHS A;  3NG2 A;  4IC3 A;  4YAT A;  2L80 A;  2YHO A;  2EOD A;  2CSY A;  4I7B A;  3U5M A;  4FIP A;  4YAB A;  3EB6 A;  5H1V A;  3I2D A;  5LCW B;  4AYC B;  2M6M A;  4A4B A;  4GNF A;  1MM2 A;  5LKX A;  2MNY A;  4L58 A;  2ECG A;  2JMJ A;  2KWN A;  3HCS A;  3HCU A;  1WES A;  2KYU A;  4MSX A;  3L1Z B;  3FL2 A;  1G25 A;  2AN6 A;  4R8P K;  5FER A;  5B79 A;  4BHW A;  4B7Y C;  2EA6 A;  3KV5 A;  2YSM A;  3SOW A;  2XB1 A; 
#chains in the Genus database with same CATH topology
 3T1H E;  2EMC A;  3ADG A;  1GZ6 A;  1KJK A;  2YTJ A;  4R2P A;  4R2D A;  2EOZ A;  4B3T E;  3LQI A;  3T7L A;  3M99 A;  1A1F A;  2NUF A;  3ZVY A;  3VYX A;  3M63 A;  2BBG A;  4HTG A;  2F4V E;  2MA6 A;  3J7Y p;  5J3X A;  1E4U A;  2OXQ C;  1N3G A;  3ADL A;  4DUY E;  1BBO A;  2YTO A;  4BC9 A;  5FLX C;  2MD7 B;  1ZAA C;  2CT1 A;  2JM3 A;  2JMI A;  4TUG A;  1BOR A;  2K16 A;  3E2D A;  5AE2 A;  5A69 A;  5KH7 A;  3FJU B;  4F2J C;  2E61 A;  4CCG X;  4JI3 E;  2JYA A;  2L3J A;  2VQE E;  3IHP A;  3MHH A;  3LVR E;  2PUY A;  2YU4 A;  2FUU A;  2EPM X;  1L4S A;  4M0V A;  4GEQ B;  2LGK A;  2JXP A;  3HTK C;  4A0C D;  4O4K A;  4P7D A;  2E6S A;  2ENA A;  3MHH C;  5B78 A;  2EM9 A;  5AAS A;  2MC5 A;  3ADJ A;  3O33 A;  3H7H A;  4LAD B;  2LUQ A;  2VRD A;  2VNF A;  3FAN A;  3N9N A;  3KWR A;  3DPL R;  2YRM A;  5LL6 R;  4B3M E;  2EM7 A;  2M13 A;  5D1M B;  5KH3 A;  3RPG B;  4X65 E;  1A1J A;  2I9I A;  3C6K A;  4F1P A;  2LJU A;  2YU5 A;  1K2F A;  4KWY A;  2M7Q A;  3EPK A;  3ZVZ B;  2K7I A;  4S3O C;  3VK6 A;  2E1M A;  5SVX A;  4I7C A;  2EPP A;  4RHB B;  5BR8 E;  3O34 A;  1BB8 A;  4I7D A;  1A1K A;  3C4T A;  2KRE A;  3ASL A;  3AV0 A;  4DR5 E;  2LXH C;  2LE2 A;  1DVP A;  1JM7 A;  4BHB A;  2E6R A;  2WZO A;  4WA6 A;  2EMG A;  1F2I G;  1ZBT A;  2YTD A;  4ZYD A;  2RSD A;  4GNG A;  5AIU A;  1U6G B;  5C11 A;  4JI0 E;  5LKZ A;  4KZS A;  3DQV R;  4R03 A;  1YYW A;  2DLQ A;  2JOX A;  4ZYG A;  5A6J A;  2VJF A;  4UP0 A;  4WZ3 B;  5IWA E;  3M62 A;  3J7A G;  2N3H A;  3SOX A;  5D1L B;  1TF6 A;  1T1H A;  3VHT B;  2PRT A;  1V87 A;  4DV4 E;  2LGL A;  2GHF A;  3OTO E;  1HR0 E;  1DCQ A;  4K0K E;  1WFK A;  4FJC A;  2FSA A;  2FD4 A;  3RTR B;  4X62 E;  1LDK C;  1HNX E;  5TBN A;  3PHD A;  5AIT A;  1SFE A;  4M9V C;  2MDG A;  5IXM B;  2H0D B;  1Z6U A;  2KE1 A;  3MHS C;  5D1K B;  4MVT A;  4AUQ B;  2MD8 C;  2V86 A;  1J5E E;  2N8X A;  4QF3 A;  5DNY A;  3T1Y E;  2EPL X;  3EB5 A;  4PTB A;  3ZNI A;  2C2V S;  2KGG A;  1G2D C;  1UIL A;  2EPN A;  2KOU A;  2EM5 A;  2ZET C;  2JY9 A;  1IQS A;  2M85 A;  2CPN A;  3HXL A;  3FM8 C;  5LKU A;  4ZYH A;  1X4J A;  2EOE A;  2R76 A;  2YYR A;  2EM6 A;  1HNW E;  4GND A;  5DIN A;  5EYA F;  3DF6 A;  2ELY A;  2CSZ A;  2MIQ A;  2EPA A;  3KDE C;  2YTN A;  5SVI B;  2XOZ A;  2IDA A;  2EN1 A;  2UZG A;  5H1T A;  1UHZ A;  3AUZ A;  4HEI A;  4MLQ A;  3T9K A;  4P78 A;  2LXP C;  2LBS B;  2EOO A;  4LLB A;  2GPI A;  5G05 B;  3THN A;  1UBD C;  2L75 A;  2B9D A;  2YW8 A;  3M7K A;  2EPZ A;  2V89 A;  4R2E A;  2YQL A;  4YAX A;  2F42 A;  5A6B D;  1MGT A;  2EN7 A;  2YT4 A;  2MC6 A;  4Z0O A;  2LV9 A;  3BF2 A;  2VPE A;  2EL6 A;  2JWO A;  3LQH A;  1BBG A;  5G04 B;  2YSJ A;  2YRE A;  2PNX A;  4Z0R A;  1FBV A;  2CTD A;  2EPR A;  2DRP A;  1VD4 A;  3LML A;  3EPJ A;  5B77 A;  2VE7 C;  5DKA A;  3O37 A;  1YUI A;  4UP5 A;  2JRJ A;  2FV4 B;  1T4L B;  2YTE A;  1JOC A;  1ZBQ A;  1WEP A;  5KL3 A;  2NAA A;  2L8T A;  1ZR9 A;  2L3C A;  2CRR A;  4QQ4 A;  2NUG A;  1IQO A;  2Q8U A;  2G43 A;  2I50 A;  2EPK X;  4JI6 E;  1ZBD B;  3C6M A;  2UXD E;  2WBS A;  4WZ2 A;  2EOQ A;  2V88 A;  2QJ0 A;  1T39 A;  2HJJ A;  1O0W A;  4A4C A;  2JUN A;  2EMZ A;  2YTG A;  3JTZ A;  1EH7 A;  4LFC E;  2H36 X;  2KWO A;  4ZQL A;  4LFB E;  1Z60 A;  1PJQ A;  4OOG C;  1RQ0 A;  2KU3 A;  2V87 A;  4M30 A;  2KKY A;  4LF7 E;  2EOH A;  2JR1 A;  4O24 A;  4W4U A;  3L00 A;  2RS7 A;  2DB2 A;  2MA5 A;  1WGM A;  4UI9 B;  1FKA E;  2LAU A;  2DIX A;  4PPE A;  2EPC A;  4NHR A;  2FGG A;  2YSP A;  1PJS A;  4R2R A;  2LT7 A;  2G45 A;  4WXC A;  4B86 C;  2ENC A;  1MEY C;  1YUJ A;  2YSO A;  2YUC A;  5G0F A;  4OGE A;  4MLV A;  4X64 E;  4LF6 E;  1IBK E;  1X5W A;  2EMA A;  2RI7 A;  2EM4 A;  4S3O B;  1YFH A;  2HC5 A;  1J26 A;  3PLW A;  1QNT A;  5FB1 A;  2EQ0 A;  1B69 A;  3L1X A;  1XWH A;  2C2L A;  3M99 B;  4WYQ B;  5FEY A;  4WX9 A;  5TAB A;  1G2F C;  2YT5 A;  4A49 A;  2EMH A;  2XOC A;  4ZDT A;  4X8W A;  1A1I A;  3ZYQ A;  1WEO A;  4JI4 E;  2EXU A;  5A6K A;  2EOM A;  1ZU1 A;  4X9J A;  5A6A A;  3U5N A;  4IS1 C;  1TN9 A;  1X4U A;  5H9M A;  1MM3 A;  3LQJ A;  1GTK A;  1WEN A;  5A2Q C;  2L5U A;  2KFT A;  2P57 A;  3DWD A;  1X49 A;  1X6F A;  2RSM A;  2YTF A;  4ZUX U;  3QG5 C;  2ODR D;  3F6H A;  2EZ6 A;  1UN6 B;  4B3R E;  4NXN E;  2V83 A;  5AC5 A;  2Y1M A;  3SOU A;  2D9H A;  4DKK A;  1WHQ A;  2KIZ A;  2EGP A;  2VJF B;  2EN4 A;  4Q35 B;  4GZN C;  2D8U A;  3HPS A;  1YSA C;  4GNE A;  2VJE A;  1WIM A;  5ADZ A;  4R2S A;  2L0B A;  4L5N C;  3N9L A;  4LJN A;  4R8O A;  4JV5 E;  2EOS A;  2CKL B;  2R1F A;  5KL2 A;  1PJT A;  2L2M A;  4WPY A;  2L2N A;  2XEU A;  4BHC A;  2ECW A;  4AQY E;  1X47 A;  4Q6F A;  4X3G A;  2LGG A;  3V43 A;  4AP4 A;  4R2Y A;  2Y43 A;  4I8O A;  3LJU X;  2IHR 1;  2EM8 A;  2K4V A;  5KL4 A;  1N32 E;  2UXB E;  1T4N A;  2DX8 A;  4OX9 E;  2EE8 A;  2EPX A;  3KV6 A;  2JP9 A;  2H0D A;  1GQE A;  4BMJ A;  5I3L A;  1RC7 A;  2LTS A;  4BS9 A;  2ODR C;  1PKP A;  4YHH E;  2JMD A;  4JI8 E;  1WXR A;  1JK2 A;  2UUB E;  2DJA A;  3U5P A;  2HGH A;  3DJW A;  5LLQ A;  5B8D A;  4GKK E;  4L8N A;  3ZOQ B;  1WHN A;  1RMD A;  2FUI A;  2LUP B;  3QZV A;  3EPH A;  5SVI A;  3KZZ A;  2MNZ A;  2IQJ A;  4R2Q A;  2ECV A;  4TUI A;  2KGI A;  2M1S A;  5IT9 C;  4YC9 A;  4DV7 E;  5F3W A;  2EL4 A;  1CHC A;  3SUB A;  4DR6 E;  2EMB A;  1HYJ A;  2EMI A;  2KR4 A;  2V8Q B;  1A1L A;  4NZV A;  2JPA A;  5TDR A;  2MKN A;  4XI1 A;  2M1R A;  2RPC A;  3SHB A;  2YPN A;  4N4F A;  1IMU A;  2VPB A;  2B7V A;  2B0O E;  2HDP A;  3N9M A;  3T6R A;  1DQ3 A;  2KWK A;  2EOJ A;  3F6G A;  2F6J A;  2L43 A;  4IJD A;  1T38 A;  4R7E A;  3O70 A;  4FK5 A;  5KL5 A;  2YHN A;  4H9D A;  1F62 A;  4J8Z A;  5B76 A;  2FFW A;  4F52 B;  2LV2 A;  3KZY A;  1XNR E;  2EPU A;  5B75 A;  5T6J A;  3HTX A;  4LFA E;  2EOX A;  2DLK A;  2EMF A;  4O43 A;  2GLI A;  2BAY A;  2ECT A;  1WEV A;  4V3L C;  3GV4 A;  5KL7 A;  4QF2 A;  4BBQ A;  4YAD A;  4AYC A;  2MKE A;  5C13 A;  2DMY A;  1X4I A;  2EMK A;  2RS6 A;  3KNV A;  4DR3 E;  1Z2Q A;  2N3G A;  2DSY A;  2K1J A;  3FEH A;  2E5L E;  4WFT A;  2VP7 A;  4WZ0 A;  4FO9 A;  2MDR A;  1FP0 A;  2LDR A;  1SR9 A;  2UUC E;  1DI2 A;  2L6M A;  2M9A A;  2RR4 A;  3O7A A;  2K17 A;  5LMN E;  2CT2 A;  1EKZ A;  2LMZ A;  3LVQ E;  2E72 A;  3ECR A;  4NN2 A;  3HPZ A;  3FAO A;  2LN0 A;  4LTY A;  2VPD A;  1WEM A;  2MUM A;  4N4R B;  4C9Z A;  2EN2 A;  1PDA A;  4F9A B;  4LF5 E;  2VF1 A;  1YYK A;  3MSW A;  2B3T B;  1LLM C;  3FIG A;  5TRB A;  4YBT A;  4LKA A;  2QIZ A;  4F6M A;  4LF4 E;  2DSM A;  2YVR A;  5CFF E;  4YBS A;  3ZTG A;  2ECN A;  1N36 E;  4DV5 E;  3P1X A;  2LJH A;  4R2C A;  3J80 C;  2F6N A;  4L7X A;  4F54 A;  2JVA A;  4M2Z A;  4X66 E;  2JOB A;  1IYM A;  2NUE A;  4RH8 A;  4DR7 E;  1WJP A;  1WEQ A;  1XMO E;  1N33 E;  2LVH A;  4DV3 E;  1XNQ E;  3Q1D A;  4YY3 E;  5JG6 A;  2EOF A;  5LKT A;  2L2K B;  2QIC A;  2EQ3 A;  2YRH A;  2ECI A;  2L7P A;  2F8B A;  4LU9 A;  4F9C B;  1FJG E;  3RPG C;  4WSG A;  2M3H A;  1WRJ A;  3N9O A;  1WE9 A;  3H09 A;  3O36 A;  2LGV A;  3J81 C;  1VYX A;  2DMI A;  4LF9 E;  1JM7 B;  1NCS A;  2EML A;  4WSP A;  3BGH A;  2YTQ A;  5SVY A;  1EH6 A;  1MBM A;  3PUQ A;  2MT5 A;  3GL6 A;  5FB0 A;  4TKP B;  3KQI A;  2YTP A;  4DUZ E;  3VYY A;  1LDJ B;  3O35 A;  1HYI A;  2L33 A;  1Z1B A;  2YQM A;  2LQ6 A;  4BC7 A;  1WEU A;  1A1G A;  5H1U A;  3ZPV 1;  2EN8 A;  5TDW A;  2G7H A;  4OGC A;  2EOR A;  2EM0 A;  4FK5 C;  2EWL A;  4O5G A;  4JI2 E;  2LTR A;  2WBU A;  3C6W A;  1WEW A;  4AVX A;  3OML A;  1KYQ A;  2VJE B;  4F9B B;  4N3W A;  1AH5 A;  4GB0 A;  2CKL A;  5K3Q A;  3U5O A;  2A25 A;  2M4I A;  2MKD A;  5A6B A;  1X6E A;  2LO3 A;  2LRI C;  2EJ4 A;  3ZPV E;  4IC2 A;  1I94 E;  1WEE A;  2ZM6 E;  1QU6 A;  4R2A A;  2G6Q A;  4CA1 A;  3IWD A;  4LK9 A;  4O62 A;  2ENH A;  1IBM E;  3N9P A;  1DGC A;  5KL6 A;  2EMY A;  2J7J A;  2VPG A;  2ADR A;  2D8S A;  3PUR A;  2LCE A;  5KH9 A;  2EPO A;  4DR1 E;  4YBM A;  2KON A;  3N9Q A;  1HNZ E;  1N87 A;  4DV6 E;  2CRW A;  1NEI A;  4JYA E;  3RMP A;  1TF3 A;  4O64 A;  5AE3 A;  3BBG A;  2WBT A;  3C5K A;  1AAY A;  2UUA E;  1YZ9 A;  2KWJ A;  4P5O B;  3JAM C;  2DGC A;  4Q28 A;  2YUR A;  3LRQ A;  2RSI A;  4JI1 E;  2EGM A;  3TQM A;  4DR4 E;  2EP3 A;  4DV2 E;  3L11 A;  2YWQ A;  1P47 A;  1VFY A;  1A1H A;  1EH8 A;  2XP0 A;  2L92 A;  1X48 A;  2WCC 3;  2EN3 A;  2HYE D;  4V3K C;  2K4D A;  2Y1N A;  1YPN A;  4DV1 E;  1X6H A;  2ECJ A;  1WIL A;  3BID A;  3IWB A;  5AC4 A;  4JI5 E;  4GKJ E;  2YTI A;  2CSV A;  3HCT A;  3JUE A;  4NXM E;  3THO B;  2YU8 A;  1N34 E;  2EMW A;  2NAB A;  3MHS A;  3K6Q A;  3NG2 A;  4IC3 A;  4YAT A;  5AE1 A;  2L80 A;  2YHO A;  3JU0 A;  2EOD A;  2CSY A;  4I7B A;  2EOI A;  2NA2 A;  3U5M A;  2UXC E;  2V85 A;  4FIP A;  3ADI A;  4YAB A;  3C4B A;  3IWC A;  4KHP E;  4BBY A;  3EB6 A;  5LMU E;  2VQF E;  1JK1 A;  5H1V A;  2YRK A;  3I2D A;  2EL5 A;  3DDT A;  5LCW B;  4AYC B;  2CSH A;  2LRS A;  4F6N A;  1YYO A;  4DMI A;  2M6M A;  4A4B A;  4GNF A;  1MM2 A;  5LKX A;  1X3C A;  2EM3 A;  2FTX B;  4JI7 E;  2MNY A;  1IBL E;  2XOY A;  3UK3 C;  2I13 A;  4L58 A;  2ECG A;  2JMJ A;  4DR2 E;  2KWN A;  3HCU A;  3HCS A;  1WES A;  2KYU A;  2B7T A;  3EPL A;  3O47 A;  2RTX A;  2EM2 A;  3MDB C;  4MSX A;  2CON A;  3L1Z B;  3LDY A;  3FL2 A;  3EQ1 A;  1G25 A;  2AN6 A;  4R8P K;  2ELZ A;  1T4O A;  2KHX A;  5FER A;  3HQ1 A;  1STU A;  5B79 A;  4WXD A;  4BHW A;  2HHH E;  2EN6 A;  2UU9 E;  2RQL A;  4BCA A;  2YZT A;  4B7Y C;  3LLH A;  2OWA A;  2EA6 A;  2KKX A;  5IV8 B;  4DV0 E;  2BB8 A;  3KV5 A;  2EQ1 A;  1XMQ E;  4LF8 E;  5TSE A;  2EMX A;  4ZYE A;  4B3S E;  2YSM A;  2EOY A;  3SOW A;  2XB1 A; 
#chains in the Genus database with same CATH homology
 3T1H E;  3ADG A;  1GZ6 A;  4B3T E;  3LQI A;  3T7L A;  3M99 A;  2NUF A;  3VYX A;  3ZVY A;  3M63 A;  2F4V E;  2MA6 A;  3J7Y p;  5J3X A;  1E4U A;  2OXQ C;  3ADL A;  4DUY E;  4BC9 A;  5FLX C;  2MD7 B;  2JMI A;  4TUG A;  1BOR A;  2K16 A;  5AE2 A;  5KH7 A;  4CCG X;  4JI3 E;  2L3J A;  2VQE E;  3IHP A;  3MHH A;  2PUY A;  2YU4 A;  2FUU A;  4M0V A;  4GEQ B;  2LGK A;  3HTK C;  4A0C D;  4P7D A;  2E6S A;  5AAS A;  5B78 A;  2MC5 A;  3ADJ A;  3O33 A;  4LAD B;  2LUQ A;  2VNF A;  3N9N A;  3KWR A;  3DPL R;  5LL6 R;  4B3M E;  5D1M B;  5KH3 A;  3RPG B;  4X65 E;  1K2F A;  2M7Q A;  3ZVZ B;  4S3O C;  3VK6 A;  2E1M A;  4I7C A;  5BR8 E;  3O34 A;  4I7D A;  3C4T A;  2KRE A;  3ASL A;  3AV0 A;  4DR5 E;  2LXH C;  2LE2 A;  1DVP A;  1JM7 A;  2E6R A;  2WZO A;  4WA6 A;  1ZBT A;  2RSD A;  4GNG A;  5AIU A;  1U6G B;  5C11 A;  4JI0 E;  5LKZ A;  4KZS A;  3DQV R;  4R03 A;  1YYW A;  2JOX A;  2VJF A;  4UP0 A;  4WZ3 B;  5IWA E;  3M62 A;  3J7A G;  2N3H A;  3SOX A;  5D1L B;  1T1H A;  1V87 A;  4DV4 E;  2LGL A;  1HR0 E;  3OTO E;  4K0K E;  1WFK A;  4FJC A;  2FSA A;  4X62 E;  3RTR B;  1LDK C;  1HNX E;  5TBN A;  3PHD A;  5AIT A;  2H0D B;  1Z6U A;  2KE1 A;  5D1K B;  4MVT A;  4AUQ B;  2MD8 C;  2V86 A;  1J5E E;  4QF3 A;  5DNY A;  3T1Y E;  3EB5 A;  4PTB A;  3ZNI A;  2C2V S;  2KGG A;  1UIL A;  2KOU A;  2ZET C;  2JY9 A;  2CPN A;  2M85 A;  3HXL A;  5LKU A;  1X4J A;  2YYR A;  1HNW E;  4GND A;  5DIN A;  5EYA F;  3DF6 A;  2CSZ A;  2MIQ A;  2IDA A;  2UZG A;  5H1T A;  1UHZ A;  3AUZ A;  4P78 A;  2LXP C;  2LBS B;  4LLB A;  5G05 B;  2L75 A;  2B9D A;  2YW8 A;  2V89 A;  2YQL A;  4YAX A;  2F42 A;  2YT4 A;  2MC6 A;  2LV9 A;  2VPE A;  2JWO A;  3LQH A;  5G04 B;  2YSJ A;  2YRE A;  2PNX A;  1FBV A;  1VD4 A;  3LML A;  5B77 A;  2VE7 C;  5DKA A;  3O37 A;  4UP5 A;  2JRJ A;  2FV4 B;  1T4L B;  1JOC A;  1ZBQ A;  1WEP A;  2NAA A;  2L8T A;  2L3C A;  2NUG A;  2G43 A;  2I50 A;  4JI6 E;  1ZBD B;  2UXD E;  4WZ2 A;  2V88 A;  2QJ0 A;  1O0W A;  4A4C A;  3JTZ A;  4LFC E;  2H36 X;  2KWO A;  4ZQL A;  4LFB E;  1Z60 A;  4OOG C;  1RQ0 A;  2KU3 A;  2V87 A;  4M30 A;  4LF7 E;  2JR1 A;  4W4U A;  2RS7 A;  2DB2 A;  2MA5 A;  1WGM A;  4UI9 B;  1FKA E;  2DIX A;  4PPE A;  2FGG A;  2G45 A;  4B86 C;  2YUC A;  5G0F A;  4X64 E;  4LF6 E;  1IBK E;  2RI7 A;  4S3O B;  1J26 A;  5FB1 A;  3L1X A;  1XWH A;  2C2L A;  4WYQ B;  5FEY A;  5TAB A;  2YT5 A;  4A49 A;  4ZDT A;  4X8W A;  3ZYQ A;  1WEO A;  4JI4 E;  3U5N A;  1X4U A;  5H9M A;  1MM3 A;  3LQJ A;  1WEN A;  5A2Q C;  2L5U A;  2KFT A;  1X49 A;  2RSM A;  4ZUX U;  2ODR D;  3F6H A;  2EZ6 A;  4B3R E;  4NXN E;  2V83 A;  2Y1M A;  3SOU A;  4DKK A;  1WHQ A;  2KIZ A;  2EGP A;  2VJF B;  3HPS A;  4GNE A;  2VJE A;  1WIM A;  5ADZ A;  2L0B A;  4L5N C;  3N9L A;  4LJN A;  4R8O A;  4JV5 E;  2CKL B;  2L2M A;  4WPY A;  2L2N A;  2XEU A;  2ECW A;  4AQY E;  1X47 A;  4Q6F A;  4X3G A;  4AP4 A;  3V43 A;  2LGG A;  4R2Y A;  2Y43 A;  4I8O A;  2IHR 1;  2K4V A;  1N32 E;  2UXB E;  1T4N A;  2DX8 A;  4OX9 E;  3KV6 A;  2H0D A;  1GQE A;  4BMJ A;  5I3L A;  1RC7 A;  2LTS A;  4BS9 A;  2ODR C;  1PKP A;  4YHH E;  2JMD A;  4JI8 E;  1WXR A;  2UUB E;  3U5P A;  3DJW A;  5B8D A;  4GKK E;  4L8N A;  3ZOQ B;  1WHN A;  1RMD A;  2FUI A;  2LUP B;  3QZV A;  2MNZ A;  4TUI A;  2ECV A;  2KGI A;  2M1S A;  5IT9 C;  4YC9 A;  4DV7 E;  5F3W A;  1CHC A;  4DR6 E;  1HYJ A;  2V8Q B;  2KR4 A;  5TDR A;  4XI1 A;  2M1R A;  3SHB A;  4N4F A;  2VPB A;  2B7V A;  2HDP A;  3N9M A;  3T6R A;  1DQ3 A;  2KWK A;  1IBL E;  3F6G A;  2F6J A;  2L43 A;  4R7E A;  3O70 A;  4FK5 A;  2YHN A;  1F62 A;  4J8Z A;  5B76 A;  4F52 B;  1XNR E;  5B75 A;  5T6J A;  3HTX A;  4LFA E;  2BAY A;  2ECT A;  1WEV A;  4V3L C;  3GV4 A;  4QF2 A;  4BBQ A;  4YAD A;  4AYC A;  5C13 A;  2DMY A;  1X4I A;  2RS6 A;  3KNV A;  4DR3 E;  1Z2Q A;  2N3G A;  2DSY A;  2K1J A;  2E5L E;  4WFT A;  2VP7 A;  4WZ0 A;  4FO9 A;  2MDR A;  1FP0 A;  2LDR A;  1SR9 A;  2UUC E;  1DI2 A;  2L6M A;  3O7A A;  5LMN E;  2K17 A;  2CT2 A;  1EKZ A;  2LMZ A;  4LTY A;  4NN2 A;  3HPZ A;  2LN0 A;  2VPD A;  1WEM A;  2MUM A;  4C9Z A;  4F9A B;  4LF5 E;  2VF1 A;  1YYK A;  3MSW A;  2B3T B;  3FIG A;  5TRB A;  4YBT A;  4LKA A;  2QIZ A;  4LF4 E;  5CFF E;  4YBS A;  3ZTG A;  2ECN A;  1N36 E;  4DV5 E;  3P1X A;  2LJH A;  3J80 C;  2F6N A;  4L7X A;  4F54 A;  2JVA A;  4M2Z A;  4X66 E;  2JOB A;  1IYM A;  2NUE A;  4DR7 E;  1XMO E;  1WEQ A;  1N33 E;  4DV3 E;  1XNQ E;  4YY3 E;  5JG6 A;  2L2K B;  5LKT A;  2QIC A;  2ECI A;  2F8B A;  4F9C B;  4LU9 A;  1FJG E;  3RPG C;  2M3H A;  3N9O A;  1WE9 A;  3H09 A;  3O36 A;  2LGV A;  3J81 C;  1VYX A;  4LF9 E;  1JM7 B;  4WSP A;  3PUQ A;  2MT5 A;  3GL6 A;  5FB0 A;  4TKP B;  3KQI A;  4DUZ E;  3VYY A;  1LDJ B;  3O35 A;  1HYI A;  2L33 A;  2YQM A;  2LQ6 A;  4BC7 A;  1WEU A;  4JI5 E;  5H1U A;  3ZPV 1;  2G7H A;  5TDW A;  2EWL A;  4JI2 E;  2LTR A;  3C6W A;  1WEW A;  4AVX A;  3OML A;  2VJE B;  4F9B B;  4N3W A;  4GB0 A;  2CKL A;  3U5O A;  2M4I A;  2LRI C;  3ZPV E;  4IC2 A;  1I94 E;  1WEE A;  2ZM6 E;  1QU6 A;  2G6Q A;  4CA1 A;  3IWD A;  4LK9 A;  1IBM E;  3N9P A;  2VPG A;  2D8S A;  3PUR A;  5KH9 A;  4DR1 E;  4YBM A;  2KON A;  3N9Q A;  1HNZ E;  1N87 A;  4DV6 E;  4JYA E;  3RMP A;  4O64 A;  5AE3 A;  3C5K A;  2UUA E;  1YZ9 A;  2KWJ A;  4P5O B;  3JAM C;  4Q28 A;  2YUR A;  3LRQ A;  4JI1 E;  4DR4 E;  4DV2 E;  3L11 A;  1VFY A;  2L92 A;  1X48 A;  2HYE D;  4V3K C;  2K4D A;  2Y1N A;  4DV1 E;  2ECJ A;  1WIL A;  3IWB A;  4GKJ E;  3HCT A;  4NXM E;  1N34 E;  3K6Q A;  3MHS A;  3NG2 A;  4IC3 A;  4YAT A;  5AE1 A;  2L80 A;  2YHO A;  3JU0 A;  2EOD A;  2CSY A;  4I7B A;  2NA2 A;  3U5M A;  2UXC E;  2V85 A;  4FIP A;  3ADI A;  4YAB A;  3C4B A;  3IWC A;  4KHP E;  4BBY A;  3EB6 A;  5LMU E;  2VQF E;  5H1V A;  3I2D A;  5LCW B;  4AYC B;  2LRS A;  1YYO A;  4DMI A;  2M6M A;  4A4B A;  4GNF A;  1MM2 A;  5LKX A;  2FTX B;  4JI7 E;  2MNY A;  4L58 A;  2ECG A;  2JMJ A;  4DR2 E;  2KWN A;  3HCS A;  3HCU A;  1WES A;  2KYU A;  2B7T A;  2RTX A;  4MSX A;  3L1Z B;  3FL2 A;  1G25 A;  2AN6 A;  4R8P K;  2KHX A;  1T4O A;  3HQ1 A;  5FER A;  1STU A;  5B79 A;  4BHW A;  2HHH E;  2UU9 E;  4BCA A;  2YZT A;  4B7Y C;  3LLH A;  4DV0 E;  2EA6 A;  3KV5 A;  1XMQ E;  4LF8 E;  4B3S E;  2YSM A;  3SOW A;  2XB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...