3VK6A

Crystal structure of a phosphotyrosine binding domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase Hakai
publication title Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 20
structure length 96
sequence length 96
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18408 zf_Hakai C2H2 Hakai zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3vk6A01
3.30.160.640 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vk6A02
2DX8A 1WIMA 3L1XA 4W4UA 2VPBA 4FO9A 4S3OC 3IHPA 2RSDA 1MM2A 2KE1A 2PUYA 2KGIA 2RI7A 2LV9A 4O64A 3EB6A 4YBSA 3N9NA 1WEOA 5I3LA 2ZETC 1WEEA 4GNFA 1MM3A 2HYED 2JRJA 2K4DA 2M85A 4LKAA 2CSZA 4P5OB 4R2YA 5FB1A 1X4JA 3N9PA 3V43A 4V3KC 1X4UA 1DVPA 3U5MA 1HYIA 5KH7A 4A49A 1CHCA 2H0DB 2MNZA 1LDKC 2NAAA 5TDWA 3U5NA 2Y43A 5B79A 4UP5A 2MA5A 1BORA 3T6RA 1WILA 2VJFB 1WEUA 2CSYA 4L58A 3C5KA 2L75A 5DKAA 2VNFA 2KR4A 2FUUA 2Y1NA 2K16A 3SOUA 3ZPVE 3ZVZB 5D1MB 2VPDA 1E4UA 5C13A 4GNEA 2KWJA 4QF3A 4X3GA 4AYCA 2F42A 2OXQC 5B76A 4BHWA 2LGLA 5TBNA 4YC9A 2Y1MA 2MNYA 3M99A 2KIZA 3ZNIA 1WEWA 2MD8C 3DQVR 3LQHA 3KNVA 3MHHA 4MSXA 4N4FA 2EA6A 2HDPA 3DPLR 4XI1A 3GV4A 2VJEB 5B78A 3N9MA 3QZVA 3O36A 5TABA 4AUQB 1XWHA 2KWOA 4YABA 5FERA 1V87A 2BAYA 4PTBA 4LLBA 2JMDA 2YU4A 1G25A 2KGGA 2YW8A 4MVTA 5J3XA 4NN2A 2QIZA 4LK9A 4FJCA 2L80A 2M3HA 4FK5A 3N9QA 5G0FA 3RPGB 2ECTA 2YUCA 3N9OA 1VFYA 5AIUA 5TDRA 5B77A 5B75A 4UI9B 5H1TA 1WEPA 3C6WA 2K17A 4ZQLA 2LXPC 3KV6A 4F52B 2XEUA 1RMDA 3U5PA 3FL2A 2YREA 2KWKA 2LDRA 2QJ0A 2G45A 1T1HA 2M1RA 4I7CA 1FBVA 2KREA 3HTKC 4A4CA 4AP4A 5FB0A 1JM7B 5DINA 2L5UA 2YSJA 5D1LB 5AITA 1WE9A 2G6QA 2CKLB 2F6NA 2ECVA 2VPGA 4GNDA 2KU3A 4IC3A 5LKXA 3VK6A 2C2VS 3I2DA 2EODA 4ZDTA 2YURA 2JMIA 2E6RA 4UP0A 4A0CD 2VP7A 2AN6A 3KV5A 4YBTA 2ECIA 4S3OB 1JOCA 1VYXA 3O35A 2L0BA 5LKUA 3ZPV1 3N9LA 5G04B 2H0DA 3KQIA 3O37A 1FP0A 2LQ6A 4Q6FA 2MUMA 2FSAA 2F6JA 2LXHC 1Z60A 5TRBA 5LKZA 4CA1A 2VPEA 1K2FA 2VJFA 2YHNA 2M6MA 5FEYA 4L7XA 4CCGX 4R7EA 1N87A 4WZ2A 4YBMA 4ZUXU 2ECWA 3L1ZB 2MA6A 1Z6UA 3ZYQA 1WEMA 3O70A 3HCUA 2K1JA 2MD7B 3PURA 3GL6A 4BBQA 4C9ZA 3L11A 2I50A 5LCWB 3SHBA 1IYMA 2MT5A 4AYCB 5LKTA 3PHDA 3PUQA 3O34A 4B86C 2YT5A 5B8DA 2ECNA 5EYAF 2VJEA 2YHOA 4AVXA 3LQJA 2L43A 2KFTA 4FIPA 4GB0A 2IDAA 1WESA 5C11A 4WZ3B 2ECJA 3T7LA 5H1VA 1ZBDB 1WGMA 5JG6A 3SOXA 3RPGC 2LGKA 2FUIA 2E6SA 1WEVA 3LQIA 3EB5A 2YYRA 5H1UA 2KYUA 2CT2A 5H9MA 1WENA 4YATA 4YADA 1Z2QA 2UZGA 3O7AA 2QICA 2XB1A 3M62A 3HCTA 5D1KB 4TKPB 4WA6A 1HYJA 3ZVYA 3ASLA 3NG2A 4A4BA 4N3WA 4I7DA 1F62A 2LGVA 2LRIC 4PPEA 3ZTGA 4V3LC 3M63A 4IC2A 4WZ0A 1U6GB 4LADB 4QF2A 2D8SA 2JMJA 4LJNA 2MIQA 3SOWA 1VD4A 4R8PK 4B7YC 1WEQA 2YQLA 1LDJB 5KH9A 4GNGA 2YQMA 3O33A 2KWNA 3RTRB 3MHSA 2LGGA 2ECGA 1JM7A 2EGPA 4I7BA 5G05B 3U5OA 5KH3A 2YSMA 1X4IA 3HCSA 1WFKA 2PNXA 2LN0A 3LRQA 2C2LA 2G43A 2CKLA 4YAXA
chains in the Genus database with same CATH superfamily
2DX8A 1WIMA 3L1XA 4W4UA 4NXNE 2B3TB 2JM3A 3FAOA 2VPBA 2EMBA 4FO9A 3ADLA 4S3OC 3IHPA 1UN6B 5KL7A 2RSDA 2DSMA 3HPSA 1MM2A 2EM5A 2KE1A 4X62E 2PUYA 2DRPA 3ADJA 2EOHA 4M2ZA 1RQ0A 1QU6A 2LVHA 2KGIA 4M9VC 2RI7A 2LV9A 2EM2A 1UILA 2L92A 4O64A 2LCEA 3EB6A 4JI5E 4YBSA 1MBMA 4LF5E 4J8ZA 3N9NA 1WEOA 5I3LA 4ZYDA 2ZETC 1WEEA 4GNFA 3FIGA 2E72A 1G2DC 3DF6A 2MDRA 2KKYA 2KONA 1YYWA 3LVQE 1MM3A 2VF1A 4AQYE 2EM3A 2M7QA 2UXBE 2LBSB 4LF8E 2UXDE 2HYED 2JRJA 2JOXA 1L4SA 2K4DA 2MC6A 2HJJA 2YRHA 4IJDA 2M85A 4LKAA 2CSZA 2YTGA 4P5OB 2CRWA 4R2YA 5FB1A 2DIXA 5AE1A 4WYQB 1X4JA 2L8TA 4F9CB 3N9PA 5A6BD 3V43A 4V3KC 1X4UA 1DVPA 4GKJE 3U5MA 4DV6E 1GTKA 4P7DA 3ZOQB 5AC4A 4JI6E 1HYIA 5KH7A 2MC5A 3THOB 2EJ4A 2YTNA 4DR4E 2ADRA 2VRDA 5KL2A 4BBYA 3HTXA 1X48A 1ZBQA 2XP0A 4A49A 2N8XA 4N4RB 1CHCA 2UU9E 2BBGA 4X65E 5KL5A 2H0DB 1ZR9A 4F6MA 4GKKE 2MNZA 1LDKC 1ZAAC 2NAAA 4LTYA 3ADGA 3FANA 2MDGA 1GQEA 5TDWA 3DDTA 2EN3A 3AV0A 5T6JA 4YHHE 3ADIA 3U5NA 2Y43A 4O62A 4ZYEA 2EQ0A 5AE3A 1T38A 2EMAA 4LF7E 5B79A 4UP5A 4B3TE 2MA5A 1BORA 2F4VE 2MKNA 1JK2A 3T6RA 3P1XA 1WILA 2VJFB 1WEUA 3EPLA 2YTOA 4JYAE 2CSYA 4WXCA 4OOGC 4L58A 3C5KA 3RMPA 2L75A 2VNFA 2KR4A 5DKAA 2LO3A 2HGHA 2FUUA 2Y1NA 2K16A 1WHNA 2JXPA 2KKXA 2YT4A 3SOUA 3J80C 3ZPVE 1SR9A 3ZVZB 2YTFA 5D1MB 3F6GA 2KOUA 2VPDA 1E4UA 5C13A 2DMYA 4O43A 4WSPA 4GNEA 2DSYA 5ADZA 1A1GA 2RQLA 2CPNA 4DV4E 2KWJA 4QF3A 4X3GA 4BS9A 1N33E 4KWYA 4AYCA 1X6FA 2JR1A 5IWAE 4KHPE 3MHHC 1IBLE 4LFAE 2F42A 2OXQC 4DV3E 3MSWA 2JWOA 5B76A 1EH6A 1EH7A 2YSOA 4BHWA 1T4LB 2LGLA 5TBNA 4YC9A 2Y1MA 2G7HA 2MKDA 2MNYA 3M99A 2KIZA 3ZNIA 1WEWA 2MD8C 4DV2E 1JK1A 2DJAA 2EN8A 2NUFA 1X49A 1IMUA 2YU8A 3EQ1A 3DQVR 3LQHA 3KNVA 2EPOA 4KZSA 1YFHA 4L8NA 3MHHA 4MSXA 4R2RA 3VYXA 4N4FA 1HR0E 2EA6A 2YTPA 2J7JA 1YSAC 2DB2A 2EPZA 2HDPA 2L33A 3DPLR 4IS1C 2L6MA 4XI1A 2EMIA 1YUJA 3GV4A 5F3WA 3E2DA 2VJEB 5B78A 3N9MA 2FGGA 3QZVA 3L00A 1Z1BA 3O36A 4F9AB 2LUPB 1B69A 4RHBB 3J81C 4MLQA 5TABA 4LF9E 2EM0A 2YTEA 5A69A 4AUQB 3IWBA 4B3ME 1XWHA 4NZVA 2KWOA 2EM8A 4FK5C 3EPKA 2DGCA 4YABA 4DMIA 3Q1DA 4DV5E 4L5NC 3THNA 2EOIA 5FERA 3M7KA 1V87A 3K6QA 2LUQA 2ELZA 1HNZE 2BAYA 4PTBA 2WBTA 3BF2A 1WRJA 4LLBA 2B7TA 2XOCA 2EMHA 2FD4A 2EN1A 2JMDA 2YU4A 1G25A 4M0VA 2KGGA 1WXRA 2V85A 2CONA 2EPAA 2EOXA 4F6NA 2YW8A 4MVTA 5J3XA 4NN2A 2QIZA 4LK9A 4Q28A 2EOSA 5CFFE 4QQ4A 2PRTA 4FJCA 2L80A 5SVYA 2M3HA 2EPKX 5SVIA 2EOEA 4BCAA 4NHRA 2EN7A 4FK5A 3N9QA 5G0FA 2N3HA 3RPGB 2YTDA 4JI4E 2ECTA 2LJUA 2YUCA 4BMJA 1X47A 2EMCA 2V8QB 3N9OA 1GZ6A 4YY3E 4K0KE 4F2JC 1VFYA 1BBGA 2ENHA 2KHXA 2M13A 5AIUA 5TDRA 5B77A 2EL4A 2N3GA 1RC7A 2WCC3 5B75A 4RH8A 3JTZA 2JP9A 4UI9B 5H1TA 1WEPA 3C6WA 2EPPA 2K17A 4ZQLA 3LDYA 2DLQA 2LXPC 4WSGA 2I9IA 3KV6A 2EP3A 2EMKA 2B7VA 3C4BA 1FKAE 1TF3A 4F52B 3TQMA 3AUZA 2XEUA 1RMDA 4JI1E 3U5PA 5LMUE 1DQ3A 3FL2A 2YREA 4BC7A 1AAYA 3IWCA 2IQJA 1QNTA 2KWKA 2LDRA 1UHZA 2ODRD 4WXDA 2QJ0A 2D9HA 3JAMC 4F54A 2EOFA 2G45A 2YWQA 2L7PA 3BGHA 1T1HA 2HC5A 2EOZA 2HHHE 4R2QA 4DUYE 2M1RA 3LLHA 2WZOA 4I7CA 1FBVA 3QG5C 2RTXA 3PLWA 2KREA 3HTKC 5IT9C 4A4CA 4AP4A 4OGCA 5FB0A 4Z0RA 1JM7B 4DR1E 1YUIA 1O0WA 2RSIA 4BHBA 2V87A 5DINA 4DR7E 2L5UA 2YSJA 2FTXB 1A1JA 4BHCA 5D1LB 5FLXC 3J7Yp 1STUA 5AITA 2EORA 3IWDA 3UK3C 1WE9A 2G6QA 2R76A 1KJKA 1A1IA 4X8WA 2RR4A 2UUCE 2CKLB 1F2IG 2EMLA 2EPUA 2L2NA 4JI0E 2F6NA 2ECVA 2VPGA 4GNDA 2LTSA 2V86A 2KU3A 4IC3A 5LKXA 2EQ3A 3VK6A 3HXLA 2P57A 2EQ1A 2C2VS 3I2DA 2EODA 4ZDTA 2YURA 2EZ6A 3H7HA 4DKKA 2JMIA 1KYQA 1YPNA 4HEIA 4ZYGA 2YVRA 3DJWA 2EMGA 4X64E 2JUNA 2YTIA 2LTRA 1T39A 2I13A 2E6RA 4UP0A 3FEHA 2LAUA 2LV2A 5AC5A 1DCQA 1G2FC 4A0CD 4OX9E 2VP7A 2AN6A 3KV5A 4P78A 4YBTA 3OTOE 2NABA 2ENCA 2EMXA 2DLKA 2L3JA 2ECIA 2EWLA 4ZYHA 4S3OB 2VQFE 1JOCA 1VYXA 2EOYA 3O35A 3VHTB 2EMWA 5LMNE 2L0BA 5LKUA 3ZPV1 3N9LA 2H36X 3MHSC 1DGCA 5G04B 5IXMB 2EM6A 2H0DA 3JU0A 1UBDC 3KQIA 3O37A 4DR2E 2UUAE 2JYAA 2DMIA 2EPMX 1X6HA 5TSEA 5BR8E 4R2PA 4DR3E 4O4KA 2XOYA 3HPZA 2YPNA 2EL6A 1FP0A 5A6BA 2LQ6A 1T4NA 4Q6FA 2MUMA 1ZU1A 2BB8A 2FSAA 2F6JA 4R2DA 2LXHC 2YTJA 2EN6A 3KZYA 1Z60A 5TRBA 5LKZA 4CA1A 2VPEA 1MGTA 1WHQA 1K2FA 4GZNC 2VJFA 4DV0E 1T4OA 2YHNA 2EL5A 2K7IA 2RPCA 2A25A 3VYYA 2M6MA 5FEYA 4L7XA 4R2EA 4TUIA 4CCGX 2WBUA 2EXUA 2IHR1 4R7EA 1N87A 2EOOA 4WZ2A 1EKZA 3KDEC 4YBMA 3KWRA 1A1FA 4X66E 4ZUXU 3LMLA 1IQSA 2ECWA 2K4VA 2CRRA 4OGEA 2JPAA 3L1ZB 2MA6A 1Z6UA 2EN4A 5A6KA 2EPRA 3ZYQA 3SUBA 1WEMA 3O70A 2F8BA 3HCUA 1LLMC 2EN2A 2V83A 3KZZA 2K1JA 4M30A 2MD7B 2VE7C 1PDAA 4R2AA 2EOJA 1IBKE 3PURA 3GL6A 4B3SE 2OWAA 2V88A 4BBQA 4C9ZA 1NEIA 3L11A 2I50A 5LCWB 2YZTA 2UUBE 2EPNA 4DV7E 3SHBA 2LRSA 1IYMA 3DWDA 2EMZA 2RS7A 2ZM6E 2MT5A 1XMQE 1XNQE 4AYCB 2VQEE 5DNYA 2LJHA 2LMZA 4H9DA 5LKTA 4R2SA 2L3CA 3T1YE 1A1LA 4JV5E 1PJTA 2EMFA 2LE2A 3PHDA 3PUQA 4LU9A 3O34A 4B86C 2EPLX 2YT5A 5B8DA 1WJPA 2NUEA 3M99B 2ECNA 5A2QC 5EYAF 2ENAA 1FJGE 4WX9A 2VJEA 2WBSA 2GHFA 2YHOA 2CTDA 4AVXA 3LQJA 2L43A 3HQ1A 2KFTA 4FIPA 5A6AA 4NXME 4DUZE 4R2CA 4JI7E 4GB0A 2IDAA 1MEYC 3EPJA 3T1HE 1WESA 5C11A 1NCSA 1J5EE 4WZ3B 2ECJA 5H1VA 3T7LA 4LF4E 1ZBDB 1WGMA 1P47A 5JG6A 2NA2A 3SOXA 1A1HA 2XOZA 2LGKA 2FUIA 3RPGC 2EE8A 2E6SA 4BC9A 4DR5E 3ECRA 1DI2A 2CSVA 3H09A 2E5LE 2EGMA 2V89A 3F6HA 1WEVA 3LQIA 4GEQB 5IV8B 4DR6E 4R03A 3EB5A 1BBOA 3JUEA 2YYRA 3FM8C 5H1UA 1YYOA 2E61A 4R8OA 2KYUA 2YSPA 3C6MA 1YYKA 2CT2A 2RS6A 2L2MA 5H9MA 4LFCE 3FJUB 4TUGA 5A6JA 1WENA 1X3CA 4YATA 2EMYA 4YADA 3J7AG 5KL3A 4HTGA 1BB8A 1Z2QA 2MKEA 3EPHA 2GPIA 2UZGA 2E1MA 3O7AA 2L2KB 1IBME 2QICA 2XB1A 2GLIA 3M62A 5K3QA 1ZBTA 4WFTA 1HNXE 4B3RE 2B9DA 1N36E 2RSMA 3HCTA 4WPYA 3MDBC 3O47A 1X5WA 5D1KB 4TKPB 4F1PA 4LF6E 4WA6A 2JVAA 2M4IA 4MLVA 4F9BB 1I94E 1HYJA 3ZVYA 4O5GA 3ASLA 1AH5A 4Q35B 2M9AA 5SVIB 2EM4A 2Q8UA 2LT7A 3C4TA 3NG2A 4I8OA 3BBGA 4A4BA 1PKPA 4N3WA 2EM7A 4LFBE 3LVRE 4I7DA 1F62A 2LGVA 2LRIC 4JI2E 4PPEA 3ZTGA 4V3LC 5AASA 3M63A 4JI8E 5LLQA 4IC2A 4WZ0A 1X6EA 1U6GB 2EOQA 3C6KA 2YRMA 1N34E 5KL4A 4LADB 1N3GA 2EPCA 4QF2A 2ODRC 2D8SA 1YZ9A 1HNWE 2JMJA 4LJNA 2MIQA 2EPXA 3SOWA 5KL6A 4JI3E 1VD4A 1TF6A 4R8PK 4B7YC 1WEQA 2YQLA 1LDJB 1XMOE 4DV1E 1TN9A 5AE2A 3T9KA 5KH9A 4GNGA 2YQMA 3O33A 2KWNA 2FV4B 3RTRB 3BIDA 5LL6R 1N32E 3MHSA 2LGGA 1XNRE 2D8UA 2ECGA 1JM7A 2EGPA 5SVXA 1PJQA 1PJSA 2EOMA 1EH8A 4I7BA 2YRKA 2UXCE 3OMLA 5G05B 2NUGA 2M1SA 2R1FA 3U5OA 5KH3A 1J26A 2YSMA 1X4IA 2JOBA 2JY9A 3HCSA 1SFEA 4X9JA 1WFKA 2CT1A 2YTQA 3LJUX 2PNXA 2LN0A 2YU5A 3LRQA 2C2LA 2G43A 2B0OE 2CKLA 2CSHA 2FFWA 4YAXA 2EM9A 1A1KA 4Z0OA 2ELYA 1IQOA 4O24A
chains in the Genus database with same CATH topology
2DX8A 1WIMA 3L1XA 4W4UA 4NXNE 2B3TB 2VPBA 4FO9A 3ADLA 4S3OC 3IHPA 2RSDA 3HPSA 1MM2A 2KE1A 4X62E 2PUYA 3ADJA 4M2ZA 1RQ0A 1QU6A 2KGIA 2RI7A 2LV9A 1UILA 2L92A 4O64A 3EB6A 4JI5E 4YBSA 4LF5E 4J8ZA 3N9NA 1WEOA 5I3LA 2ZETC 1WEEA 4GNFA 3FIGA 3DF6A 2MDRA 2KONA 1YYWA 1MM3A 2VF1A 4AQYE 2M7QA 2UXBE 2LBSB 4LF8E 2UXDE 2HYED 2JRJA 2JOXA 2K4DA 2MC6A 2M85A 4LKAA 2CSZA 4P5OB 4R2YA 5AE1A 5FB1A 2DIXA 4WYQB 1X4JA 2L8TA 4F9CB 3N9PA 3V43A 4V3KC 1X4UA 1DVPA 4GKJE 3U5MA 4DV6E 4P7DA 3ZOQB 4JI6E 1HYIA 5KH7A 2MC5A 4DR4E 4BBYA 3HTXA 1X48A 1ZBQA 4A49A 1CHCA 2UU9E 4X65E 2H0DB 4GKKE 2MNZA 1LDKC 2NAAA 4LTYA 3ADGA 1GQEA 5TDWA 5T6JA 4YHHE 3AV0A 3ADIA 3U5NA 2Y43A 5AE3A 4LF7E 5B79A 4UP5A 4B3TE 2MA5A 1BORA 2F4VE 3T6RA 3P1XA 1WILA 2VJFB 1WEUA 4JYAE 2CSYA 4OOGC 4L58A 3C5KA 3RMPA 2L75A 5DKAA 2VNFA 2KR4A 2FUUA 2Y1NA 2K16A 1WHNA 2YT4A 3SOUA 3J80C 3ZPVE 1SR9A 3ZVZB 3F6GA 5D1MB 2KOUA 2VPDA 1E4UA 5C13A 2DMYA 4WSPA 4GNEA 2DSYA 5ADZA 4DV4E 2CPNA 2KWJA 4QF3A 4X3GA 4BS9A 1N33E 4AYCA 2JR1A 5IWAE 4KHPE 1IBLE 4LFAE 2F42A 2OXQC 4DV3E 3MSWA 2JWOA 5B76A 4BHWA 1T4LB 2LGLA 5TBNA 4YC9A 2Y1MA 2G7HA 2MNYA 3M99A 2KIZA 3ZNIA 1WEWA 2MD8C 4DV2E 2NUFA 1X49A 3DQVR 3LQHA 3KNVA 4KZSA 4L8NA 3MHHA 4MSXA 3VYXA 4N4FA 1HR0E 2EA6A 2DB2A 2HDPA 2L33A 3DPLR 2L6MA 4XI1A 3GV4A 5F3WA 2VJEB 5B78A 3N9MA 2FGGA 3QZVA 3O36A 4F9AB 2LUPB 3J81C 4LF9E 5TABA 4AUQB 3IWBA 4B3ME 1XWHA 2KWOA 4YABA 4DMIA 4DV5E 4L5NC 5FERA 1V87A 3K6QA 2LUQA 1HNZE 2BAYA 4PTBA 4LLBA 2B7TA 1WXRA 2JMDA 2YU4A 1G25A 4M0VA 2KGGA 2V85A 2YW8A 4MVTA 5J3XA 4NN2A 2QIZA 4LK9A 4Q28A 5CFFE 4FJCA 2L80A 2M3HA 4BCAA 4FK5A 3N9QA 5G0FA 2N3HA 3RPGB 4JI4E 2ECTA 2YUCA 4BMJA 1X47A 2V8QB 3N9OA 1GZ6A 4YY3E 4K0KE 1VFYA 2KHXA 5AIUA 5TDRA 5B77A 2N3GA 1RC7A 5B75A 3JTZA 4UI9B 5H1TA 1WEPA 3C6WA 2K17A 4ZQLA 2LXPC 3KV6A 2B7VA 3C4BA 1FKAE 4F52B 3AUZA 2XEUA 1RMDA 4JI1E 3U5PA 5LMUE 1DQ3A 3FL2A 2YREA 4BC7A 3IWCA 2KWKA 2LDRA 1UHZA 2ODRD 2QJ0A 3JAMC 4F54A 2G45A 1T1HA 2HHHE 4DUYE 2M1RA 3LLHA 2WZOA 4I7CA 1FBVA 2RTXA 2KREA 3HTKC 5IT9C 4A4CA 4AP4A 5FB0A 1JM7B 4DR1E 1O0WA 2V87A 5DINA 4DR7E 2L5UA 2YSJA 2FTXB 5D1LB 5FLXC 3J7Yp 1STUA 5AITA 3IWDA 1WE9A 2G6QA 4X8WA 2UUCE 2CKLB 2L2NA 4JI0E 2F6NA 2ECVA 2VPGA 4GNDA 2LTSA 2V86A 2KU3A 4IC3A 5LKXA 3HXLA 3VK6A 2C2VS 3I2DA 2EODA 4ZDTA 2YURA 2EZ6A 4DKKA 2JMIA 4X64E 3DJWA 2LTRA 2E6RA 4UP0A 4A0CD 4OX9E 2VP7A 2AN6A 3KV5A 4P78A 4YBTA 3OTOE 2L3JA 2ECIA 2EWLA 4S3OB 2VQFE 1JOCA 1VYXA 3O35A 5LMNE 2L0BA 5LKUA 3ZPV1 3N9LA 2H36X 5G04B 3JU0A 2H0DA 3KQIA 3O37A 4DR2E 2UUAE 4DR3E 5BR8E 3HPZA 1FP0A 2LQ6A 1T4NA 4Q6FA 2MUMA 2FSAA 2F6JA 2LXHC 1Z60A 5TRBA 5LKZA 4CA1A 2VPEA 1WHQA 1K2FA 2VJFA 4DV0E 1T4OA 2YHNA 3VYYA 2M6MA 5FEYA 4L7XA 4TUIA 4CCGX 2IHR1 4R7EA 1N87A 4WZ2A 1EKZA 4YBMA 3KWRA 4X66E 4ZUXU 3LMLA 2K4VA 2ECWA 3L1ZB 2MA6A 1Z6UA 3ZYQA 1WEMA 3O70A 2F8BA 3HCUA 2V83A 2K1JA 4M30A 2MD7B 2VE7C 1IBKE 3PURA 3GL6A 4B3SE 2V88A 4BBQA 4C9ZA 3L11A 2I50A 5LCWB 2YZTA 2UUBE 4DV7E 3SHBA 2LRSA 1IYMA 2ZM6E 2RS7A 2MT5A 1XMQE 1XNQE 4AYCB 2VQEE 5DNYA 2LJHA 2LMZA 5LKTA 2L3CA 3T1YE 4JV5E 2LE2A 3PHDA 3PUQA 4LU9A 3O34A 4B86C 2YT5A 5B8DA 2NUEA 2ECNA 5A2QC 5EYAF 1FJGE 2VJEA 2YHOA 4AVXA 3LQJA 2L43A 3HQ1A 2KFTA 4FIPA 4NXME 4DUZE 4JI7E 4GB0A 2IDAA 3T1HE 1WESA 5C11A 1J5EE 4WZ3B 2ECJA 3T7LA 5H1VA 4LF4E 1ZBDB 1WGMA 5JG6A 2NA2A 3SOXA 3RPGC 2LGKA 2FUIA 4DR5E 4BC9A 2E6SA 1DI2A 2E5LE 3H09A 2V89A 3F6HA 4GEQB 1WEVA 3LQIA 4DR6E 4R03A 3EB5A 2YYRA 5H1UA 1YYOA 4R8OA 2KYUA 1YYKA 2CT2A 2RS6A 2L2MA 5H9MA 4LFCE 4TUGA 1WENA 4YATA 3J7AG 4YADA 1Z2QA 2UZGA 2E1MA 3O7AA 2L2KB 1IBME 2QICA 2XB1A 4B3RE 3M62A 4WFTA 1ZBTA 1HNXE 2B9DA 1N36E 2RSMA 3HCTA 4WPYA 5D1KB 4TKPB 4LF6E 4WA6A 2JVAA 2M4IA 4F9BB 1I94E 1HYJA 3ZVYA 3ASLA 3C4TA 3NG2A 4I8OA 4A4BA 1PKPA 4N3WA 4LFBE 4I7DA 1F62A 2LGVA 2LRIC 4JI2E 4PPEA 3ZTGA 4V3LC 5AASA 3M63A 4JI8E 4IC2A 4WZ0A 1N34E 1U6GB 4LADB 1HNWE 1YZ9A 4QF2A 2ODRC 2D8SA 2JMJA 4LJNA 2MIQA 3SOWA 4JI3E 1VD4A 4R8PK 4B7YC 1WEQA 2YQLA 1LDJB 1XMOE 4DV1E 5AE2A 5KH9A 4GNGA 2YQMA 3O33A 2KWNA 2FV4B 3RTRB 5LL6R 1N32E 3MHSA 2LGGA 1XNRE 2ECGA 1JM7A 2EGPA 4I7BA 2UXCE 3OMLA 5G05B 2NUGA 2M1SA 1J26A 3U5OA 5KH3A 2YSMA 1X4IA 2JOBA 2JY9A 3HCSA 1WFKA 2PNXA 2LN0A 3LRQA 2C2LA 2G43A 2CKLA 4YAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX8 A;  1WIM A;  3L1X A;  4W4U A;  2VPB A;  4FO9 A;  4S3O C;  3IHP A;  2RSD A;  1MM2 A;  2KE1 A;  2PUY A;  2KGI A;  2RI7 A;  2LV9 A;  4O64 A;  3EB6 A;  4YBS A;  3N9N A;  1WEO A;  5I3L A;  2ZET C;  1WEE A;  4GNF A;  1MM3 A;  2HYE D;  2JRJ A;  2K4D A;  2M85 A;  4LKA A;  2CSZ A;  4P5O B;  4R2Y A;  5FB1 A;  1X4J A;  3N9P A;  3V43 A;  4V3K C;  1X4U A;  1DVP A;  3U5M A;  1HYI A;  5KH7 A;  4A49 A;  1CHC A;  2H0D B;  2MNZ A;  1LDK C;  2NAA A;  5TDW A;  3U5N A;  2Y43 A;  5B79 A;  4UP5 A;  2MA5 A;  1BOR A;  3T6R A;  1WIL A;  2VJF B;  1WEU A;  2CSY A;  4L58 A;  3C5K A;  2L75 A;  5DKA A;  2VNF A;  2KR4 A;  2FUU A;  2Y1N A;  2K16 A;  3SOU A;  3ZPV E;  3ZVZ B;  5D1M B;  2VPD A;  1E4U A;  5C13 A;  4GNE A;  2KWJ A;  4QF3 A;  4X3G A;  4AYC A;  2F42 A;  2OXQ C;  5B76 A;  4BHW A;  2LGL A;  5TBN A;  4YC9 A;  2Y1M A;  2MNY A;  3M99 A;  2KIZ A;  3ZNI A;  1WEW A;  2MD8 C;  3DQV R;  3LQH A;  3KNV A;  3MHH A;  4MSX A;  4N4F A;  2EA6 A;  2HDP A;  3DPL R;  4XI1 A;  3GV4 A;  2VJE B;  5B78 A;  3N9M A;  3QZV A;  3O36 A;  5TAB A;  4AUQ B;  1XWH A;  2KWO A;  4YAB A;  5FER A;  1V87 A;  2BAY A;  4PTB A;  4LLB A;  2JMD A;  2YU4 A;  1G25 A;  2KGG A;  2YW8 A;  4MVT A;  5J3X A;  4NN2 A;  2QIZ A;  4LK9 A;  4FJC A;  2L80 A;  2M3H A;  4FK5 A;  3N9Q A;  5G0F A;  3RPG B;  2ECT A;  2YUC A;  3N9O A;  1VFY A;  5AIU A;  5TDR A;  5B77 A;  5B75 A;  4UI9 B;  5H1T A;  1WEP A;  3C6W A;  2K17 A;  4ZQL A;  2LXP C;  3KV6 A;  4F52 B;  2XEU A;  1RMD A;  3U5P A;  3FL2 A;  2YRE A;  2KWK A;  2LDR A;  2QJ0 A;  2G45 A;  1T1H A;  2M1R A;  4I7C A;  1FBV A;  2KRE A;  3HTK C;  4A4C A;  4AP4 A;  5FB0 A;  1JM7 B;  5DIN A;  2L5U A;  2YSJ A;  5D1L B;  5AIT A;  1WE9 A;  2G6Q A;  2CKL B;  2F6N A;  2ECV A;  2VPG A;  4GND A;  2KU3 A;  4IC3 A;  5LKX A;  3VK6 A;  2C2V S;  3I2D A;  2EOD A;  4ZDT A;  2YUR A;  2JMI A;  2E6R A;  4UP0 A;  4A0C D;  2VP7 A;  2AN6 A;  3KV5 A;  4YBT A;  2ECI A;  4S3O B;  1JOC A;  1VYX A;  3O35 A;  2L0B A;  5LKU A;  3ZPV 1;  3N9L A;  5G04 B;  2H0D A;  3KQI A;  3O37 A;  1FP0 A;  2LQ6 A;  4Q6F A;  2MUM A;  2FSA A;  2F6J A;  2LXH C;  1Z60 A;  5TRB A;  5LKZ A;  4CA1 A;  2VPE A;  1K2F A;  2VJF A;  2YHN A;  2M6M A;  5FEY A;  4L7X A;  4CCG X;  4R7E A;  1N87 A;  4WZ2 A;  4YBM A;  4ZUX U;  2ECW A;  3L1Z B;  2MA6 A;  1Z6U A;  3ZYQ A;  1WEM A;  3O70 A;  3HCU A;  2K1J A;  2MD7 B;  3PUR A;  3GL6 A;  4BBQ A;  4C9Z A;  3L11 A;  2I50 A;  5LCW B;  3SHB A;  1IYM A;  2MT5 A;  4AYC B;  5LKT A;  3PHD A;  3PUQ A;  3O34 A;  4B86 C;  2YT5 A;  5B8D A;  2ECN A;  5EYA F;  2VJE A;  2YHO A;  4AVX A;  3LQJ A;  2L43 A;  2KFT A;  4FIP A;  4GB0 A;  2IDA A;  1WES A;  5C11 A;  4WZ3 B;  2ECJ A;  3T7L A;  5H1V A;  1ZBD B;  1WGM A;  5JG6 A;  3SOX A;  3RPG C;  2LGK A;  2FUI A;  2E6S A;  1WEV A;  3LQI A;  3EB5 A;  2YYR A;  5H1U A;  2KYU A;  2CT2 A;  5H9M A;  1WEN A;  4YAT A;  4YAD A;  1Z2Q A;  2UZG A;  3O7A A;  2QIC A;  2XB1 A;  3M62 A;  3HCT A;  5D1K B;  4TKP B;  4WA6 A;  1HYJ A;  3ZVY A;  3ASL A;  3NG2 A;  4A4B A;  4N3W A;  4I7D A;  1F62 A;  2LGV A;  2LRI C;  4PPE A;  3ZTG A;  4V3L C;  3M63 A;  4IC2 A;  4WZ0 A;  1U6G B;  4LAD B;  4QF2 A;  2D8S A;  2JMJ A;  4LJN A;  2MIQ A;  3SOW A;  1VD4 A;  4R8P K;  4B7Y C;  1WEQ A;  2YQL A;  1LDJ B;  5KH9 A;  4GNG A;  2YQM A;  3O33 A;  2KWN A;  3RTR B;  3MHS A;  2LGG A;  2ECG A;  1JM7 A;  2EGP A;  4I7B A;  5G05 B;  3U5O A;  5KH3 A;  2YSM A;  1X4I A;  3HCS A;  1WFK A;  2PNX A;  2LN0 A;  3LRQ A;  2C2L A;  2G43 A;  2CKL A;  4YAX A; 
#chains in the Genus database with same CATH topology
 2DX8 A;  1WIM A;  3L1X A;  4W4U A;  4NXN E;  2B3T B;  2JM3 A;  3FAO A;  2VPB A;  2EMB A;  4FO9 A;  3ADL A;  4S3O C;  3IHP A;  1UN6 B;  5KL7 A;  2RSD A;  2DSM A;  3HPS A;  1MM2 A;  2EM5 A;  2KE1 A;  4X62 E;  2PUY A;  2DRP A;  3ADJ A;  2EOH A;  4M2Z A;  1RQ0 A;  1QU6 A;  2LVH A;  2KGI A;  4M9V C;  2RI7 A;  2LV9 A;  2EM2 A;  1UIL A;  2L92 A;  4O64 A;  2LCE A;  3EB6 A;  4JI5 E;  4YBS A;  1MBM A;  4LF5 E;  4J8Z A;  3N9N A;  1WEO A;  5I3L A;  4ZYD A;  2ZET C;  1WEE A;  4GNF A;  3FIG A;  2E72 A;  1G2D C;  3DF6 A;  2MDR A;  2KKY A;  2KON A;  1YYW A;  3LVQ E;  1MM3 A;  2VF1 A;  4AQY E;  2EM3 A;  2M7Q A;  2UXB E;  2LBS B;  4LF8 E;  2UXD E;  2HYE D;  2JRJ A;  2JOX A;  1L4S A;  2K4D A;  2MC6 A;  2HJJ A;  2YRH A;  4IJD A;  2M85 A;  4LKA A;  2CSZ A;  2YTG A;  4P5O B;  2CRW A;  4R2Y A;  5FB1 A;  2DIX A;  5AE1 A;  4WYQ B;  1X4J A;  2L8T A;  4F9C B;  3N9P A;  5A6B D;  3V43 A;  4V3K C;  1X4U A;  1DVP A;  4GKJ E;  3U5M A;  4DV6 E;  1GTK A;  4P7D A;  3ZOQ B;  5AC4 A;  4JI6 E;  1HYI A;  5KH7 A;  2MC5 A;  3THO B;  2EJ4 A;  2YTN A;  4DR4 E;  2ADR A;  2VRD A;  5KL2 A;  4BBY A;  3HTX A;  1X48 A;  1ZBQ A;  2XP0 A;  4A49 A;  2N8X A;  4N4R B;  1CHC A;  2UU9 E;  2BBG A;  4X65 E;  5KL5 A;  2H0D B;  1ZR9 A;  4F6M A;  4GKK E;  2MNZ A;  1LDK C;  1ZAA C;  2NAA A;  4LTY A;  3ADG A;  3FAN A;  2MDG A;  1GQE A;  5TDW A;  3DDT A;  2EN3 A;  3AV0 A;  5T6J A;  4YHH E;  3ADI A;  3U5N A;  2Y43 A;  4O62 A;  4ZYE A;  2EQ0 A;  5AE3 A;  1T38 A;  2EMA A;  4LF7 E;  5B79 A;  4UP5 A;  4B3T E;  2MA5 A;  1BOR A;  2F4V E;  2MKN A;  1JK2 A;  3T6R A;  3P1X A;  1WIL A;  2VJF B;  1WEU A;  3EPL A;  2YTO A;  4JYA E;  2CSY A;  4WXC A;  4OOG C;  4L58 A;  3C5K A;  3RMP A;  2L75 A;  2VNF A;  2KR4 A;  5DKA A;  2LO3 A;  2HGH A;  2FUU A;  2Y1N A;  2K16 A;  1WHN A;  2JXP A;  2KKX A;  2YT4 A;  3SOU A;  3J80 C;  3ZPV E;  1SR9 A;  3ZVZ B;  2YTF A;  5D1M B;  3F6G A;  2KOU A;  2VPD A;  1E4U A;  5C13 A;  2DMY A;  4O43 A;  4WSP A;  4GNE A;  2DSY A;  5ADZ A;  1A1G A;  2RQL A;  2CPN A;  4DV4 E;  2KWJ A;  4QF3 A;  4X3G A;  4BS9 A;  1N33 E;  4KWY A;  4AYC A;  1X6F A;  2JR1 A;  5IWA E;  4KHP E;  3MHH C;  1IBL E;  4LFA E;  2F42 A;  2OXQ C;  4DV3 E;  3MSW A;  2JWO A;  5B76 A;  1EH6 A;  1EH7 A;  2YSO A;  4BHW A;  1T4L B;  2LGL A;  5TBN A;  4YC9 A;  2Y1M A;  2G7H A;  2MKD A;  2MNY A;  3M99 A;  2KIZ A;  3ZNI A;  1WEW A;  2MD8 C;  4DV2 E;  1JK1 A;  2DJA A;  2EN8 A;  2NUF A;  1X49 A;  1IMU A;  2YU8 A;  3EQ1 A;  3DQV R;  3LQH A;  3KNV A;  2EPO A;  4KZS A;  1YFH A;  4L8N A;  3MHH A;  4MSX A;  4R2R A;  3VYX A;  4N4F A;  1HR0 E;  2EA6 A;  2YTP A;  2J7J A;  1YSA C;  2DB2 A;  2EPZ A;  2HDP A;  2L33 A;  3DPL R;  4IS1 C;  2L6M A;  4XI1 A;  2EMI A;  1YUJ A;  3GV4 A;  5F3W A;  3E2D A;  2VJE B;  5B78 A;  3N9M A;  2FGG A;  3QZV A;  3L00 A;  1Z1B A;  3O36 A;  4F9A B;  2LUP B;  1B69 A;  4RHB B;  3J81 C;  4MLQ A;  5TAB A;  4LF9 E;  2EM0 A;  2YTE A;  5A69 A;  4AUQ B;  3IWB A;  4B3M E;  1XWH A;  4NZV A;  2KWO A;  2EM8 A;  4FK5 C;  3EPK A;  2DGC A;  4YAB A;  4DMI A;  3Q1D A;  4DV5 E;  4L5N C;  3THN A;  2EOI A;  5FER A;  3M7K A;  1V87 A;  3K6Q A;  2LUQ A;  2ELZ A;  1HNZ E;  2BAY A;  4PTB A;  2WBT A;  3BF2 A;  1WRJ A;  4LLB A;  2B7T A;  2XOC A;  2EMH A;  2FD4 A;  2EN1 A;  2JMD A;  2YU4 A;  1G25 A;  4M0V A;  2KGG A;  1WXR A;  2V85 A;  2CON A;  2EPA A;  2EOX A;  4F6N A;  2YW8 A;  4MVT A;  5J3X A;  4NN2 A;  2QIZ A;  4LK9 A;  4Q28 A;  2EOS A;  5CFF E;  4QQ4 A;  2PRT A;  4FJC A;  2L80 A;  5SVY A;  2M3H A;  2EPK X;  5SVI A;  2EOE A;  4BCA A;  4NHR A;  2EN7 A;  4FK5 A;  3N9Q A;  5G0F A;  2N3H A;  3RPG B;  2YTD A;  4JI4 E;  2ECT A;  2LJU A;  2YUC A;  4BMJ A;  1X47 A;  2EMC A;  2V8Q B;  3N9O A;  1GZ6 A;  4YY3 E;  4K0K E;  4F2J C;  1VFY A;  1BBG A;  2ENH A;  2KHX A;  2M13 A;  5AIU A;  5TDR A;  5B77 A;  2EL4 A;  2N3G A;  1RC7 A;  2WCC 3;  5B75 A;  4RH8 A;  3JTZ A;  2JP9 A;  4UI9 B;  5H1T A;  1WEP A;  3C6W A;  2EPP A;  2K17 A;  4ZQL A;  3LDY A;  2DLQ A;  2LXP C;  4WSG A;  2I9I A;  3KV6 A;  2EP3 A;  2EMK A;  2B7V A;  3C4B A;  1FKA E;  1TF3 A;  4F52 B;  3TQM A;  3AUZ A;  2XEU A;  1RMD A;  4JI1 E;  3U5P A;  5LMU E;  1DQ3 A;  3FL2 A;  2YRE A;  4BC7 A;  1AAY A;  3IWC A;  2IQJ A;  1QNT A;  2KWK A;  2LDR A;  1UHZ A;  2ODR D;  4WXD A;  2QJ0 A;  2D9H A;  3JAM C;  4F54 A;  2EOF A;  2G45 A;  2YWQ A;  2L7P A;  3BGH A;  1T1H A;  2HC5 A;  2EOZ A;  2HHH E;  4R2Q A;  4DUY E;  2M1R A;  3LLH A;  2WZO A;  4I7C A;  1FBV A;  3QG5 C;  2RTX A;  3PLW A;  2KRE A;  3HTK C;  5IT9 C;  4A4C A;  4AP4 A;  4OGC A;  5FB0 A;  4Z0R A;  1JM7 B;  4DR1 E;  1YUI A;  1O0W A;  2RSI A;  4BHB A;  2V87 A;  5DIN A;  4DR7 E;  2L5U A;  2YSJ A;  2FTX B;  1A1J A;  4BHC A;  5D1L B;  5FLX C;  3J7Y p;  1STU A;  5AIT A;  2EOR A;  3IWD A;  3UK3 C;  1WE9 A;  2G6Q A;  2R76 A;  1KJK A;  1A1I A;  4X8W A;  2RR4 A;  2UUC E;  2CKL B;  1F2I G;  2EML A;  2EPU A;  2L2N A;  4JI0 E;  2F6N A;  2ECV A;  2VPG A;  4GND A;  2LTS A;  2V86 A;  2KU3 A;  4IC3 A;  5LKX A;  2EQ3 A;  3VK6 A;  3HXL A;  2P57 A;  2EQ1 A;  2C2V S;  3I2D A;  2EOD A;  4ZDT A;  2YUR A;  2EZ6 A;  3H7H A;  4DKK A;  2JMI A;  1KYQ A;  1YPN A;  4HEI A;  4ZYG A;  2YVR A;  3DJW A;  2EMG A;  4X64 E;  2JUN A;  2YTI A;  2LTR A;  1T39 A;  2I13 A;  2E6R A;  4UP0 A;  3FEH A;  2LAU A;  2LV2 A;  5AC5 A;  1DCQ A;  1G2F C;  4A0C D;  4OX9 E;  2VP7 A;  2AN6 A;  3KV5 A;  4P78 A;  4YBT A;  3OTO E;  2NAB A;  2ENC A;  2EMX A;  2DLK A;  2L3J A;  2ECI A;  2EWL A;  4ZYH A;  4S3O B;  2VQF E;  1JOC A;  1VYX A;  2EOY A;  3O35 A;  3VHT B;  2EMW A;  5LMN E;  2L0B A;  5LKU A;  3ZPV 1;  3N9L A;  2H36 X;  3MHS C;  1DGC A;  5G04 B;  5IXM B;  2EM6 A;  2H0D A;  3JU0 A;  1UBD C;  3KQI A;  3O37 A;  4DR2 E;  2UUA E;  2JYA A;  2DMI A;  2EPM X;  1X6H A;  5TSE A;  5BR8 E;  4R2P A;  4DR3 E;  4O4K A;  2XOY A;  3HPZ A;  2YPN A;  2EL6 A;  1FP0 A;  5A6B A;  2LQ6 A;  1T4N A;  4Q6F A;  2MUM A;  1ZU1 A;  2BB8 A;  2FSA A;  2F6J A;  4R2D A;  2LXH C;  2YTJ A;  2EN6 A;  3KZY A;  1Z60 A;  5TRB A;  5LKZ A;  4CA1 A;  2VPE A;  1MGT A;  1WHQ A;  1K2F A;  4GZN C;  2VJF A;  4DV0 E;  1T4O A;  2YHN A;  2EL5 A;  2K7I A;  2RPC A;  2A25 A;  3VYY A;  2M6M A;  5FEY A;  4L7X A;  4R2E A;  4TUI A;  4CCG X;  2WBU A;  2EXU A;  2IHR 1;  4R7E A;  1N87 A;  2EOO A;  4WZ2 A;  1EKZ A;  3KDE C;  4YBM A;  3KWR A;  1A1F A;  4X66 E;  4ZUX U;  3LML A;  1IQS A;  2ECW A;  2K4V A;  2CRR A;  4OGE A;  2JPA A;  3L1Z B;  2MA6 A;  1Z6U A;  2EN4 A;  5A6K A;  2EPR A;  3ZYQ A;  3SUB A;  1WEM A;  3O70 A;  2F8B A;  3HCU A;  1LLM C;  2EN2 A;  2V83 A;  3KZZ A;  2K1J A;  4M30 A;  2MD7 B;  2VE7 C;  1PDA A;  4R2A A;  2EOJ A;  1IBK E;  3PUR A;  3GL6 A;  4B3S E;  2OWA A;  2V88 A;  4BBQ A;  4C9Z A;  1NEI A;  3L11 A;  2I50 A;  5LCW B;  2YZT A;  2UUB E;  2EPN A;  4DV7 E;  3SHB A;  2LRS A;  1IYM A;  3DWD A;  2EMZ A;  2RS7 A;  2ZM6 E;  2MT5 A;  1XMQ E;  1XNQ E;  4AYC B;  2VQE E;  5DNY A;  2LJH A;  2LMZ A;  4H9D A;  5LKT A;  4R2S A;  2L3C A;  3T1Y E;  1A1L A;  4JV5 E;  1PJT A;  2EMF A;  2LE2 A;  3PHD A;  3PUQ A;  4LU9 A;  3O34 A;  4B86 C;  2EPL X;  2YT5 A;  5B8D A;  1WJP A;  2NUE A;  3M99 B;  2ECN A;  5A2Q C;  5EYA F;  2ENA A;  1FJG E;  4WX9 A;  2VJE A;  2WBS A;  2GHF A;  2YHO A;  2CTD A;  4AVX A;  3LQJ A;  2L43 A;  3HQ1 A;  2KFT A;  4FIP A;  5A6A A;  4NXM E;  4DUZ E;  4R2C A;  4JI7 E;  4GB0 A;  2IDA A;  1MEY C;  3EPJ A;  3T1H E;  1WES A;  5C11 A;  1NCS A;  1J5E E;  4WZ3 B;  2ECJ A;  5H1V A;  3T7L A;  4LF4 E;  1ZBD B;  1WGM A;  1P47 A;  5JG6 A;  2NA2 A;  3SOX A;  1A1H A;  2XOZ A;  2LGK A;  2FUI A;  3RPG C;  2EE8 A;  2E6S A;  4BC9 A;  4DR5 E;  3ECR A;  1DI2 A;  2CSV A;  3H09 A;  2E5L E;  2EGM A;  2V89 A;  3F6H A;  1WEV A;  3LQI A;  4GEQ B;  5IV8 B;  4DR6 E;  4R03 A;  3EB5 A;  1BBO A;  3JUE A;  2YYR A;  3FM8 C;  5H1U A;  1YYO A;  2E61 A;  4R8O A;  2KYU A;  2YSP A;  3C6M A;  1YYK A;  2CT2 A;  2RS6 A;  2L2M A;  5H9M A;  4LFC E;  3FJU B;  4TUG A;  5A6J A;  1WEN A;  1X3C A;  4YAT A;  2EMY A;  4YAD A;  3J7A G;  5KL3 A;  4HTG A;  1BB8 A;  1Z2Q A;  2MKE A;  3EPH A;  2GPI A;  2UZG A;  2E1M A;  3O7A A;  2L2K B;  1IBM E;  2QIC A;  2XB1 A;  2GLI A;  3M62 A;  5K3Q A;  1ZBT A;  4WFT A;  1HNX E;  4B3R E;  2B9D A;  1N36 E;  2RSM A;  3HCT A;  4WPY A;  3MDB C;  3O47 A;  1X5W A;  5D1K B;  4TKP B;  4F1P A;  4LF6 E;  4WA6 A;  2JVA A;  2M4I A;  4MLV A;  4F9B B;  1I94 E;  1HYJ A;  3ZVY A;  4O5G A;  3ASL A;  1AH5 A;  4Q35 B;  2M9A A;  5SVI B;  2EM4 A;  2Q8U A;  2LT7 A;  3C4T A;  3NG2 A;  4I8O A;  3BBG A;  4A4B A;  1PKP A;  4N3W A;  2EM7 A;  4LFB E;  3LVR E;  4I7D A;  1F62 A;  2LGV A;  2LRI C;  4JI2 E;  4PPE A;  3ZTG A;  4V3L C;  5AAS A;  3M63 A;  4JI8 E;  5LLQ A;  4IC2 A;  4WZ0 A;  1X6E A;  1U6G B;  2EOQ A;  3C6K A;  2YRM A;  1N34 E;  5KL4 A;  4LAD B;  1N3G A;  2EPC A;  4QF2 A;  2ODR C;  2D8S A;  1YZ9 A;  1HNW E;  2JMJ A;  4LJN A;  2MIQ A;  2EPX A;  3SOW A;  5KL6 A;  4JI3 E;  1VD4 A;  1TF6 A;  4R8P K;  4B7Y C;  1WEQ A;  2YQL A;  1LDJ B;  1XMO E;  4DV1 E;  1TN9 A;  5AE2 A;  3T9K A;  5KH9 A;  4GNG A;  2YQM A;  3O33 A;  2KWN A;  2FV4 B;  3RTR B;  3BID A;  5LL6 R;  1N32 E;  3MHS A;  2LGG A;  1XNR E;  2D8U A;  2ECG A;  1JM7 A;  2EGP A;  5SVX A;  1PJQ A;  1PJS A;  2EOM A;  1EH8 A;  4I7B A;  2YRK A;  2UXC E;  3OML A;  5G05 B;  2NUG A;  2M1S A;  2R1F A;  3U5O A;  5KH3 A;  1J26 A;  2YSM A;  1X4I A;  2JOB A;  2JY9 A;  3HCS A;  1SFE A;  4X9J A;  1WFK A;  2CT1 A;  2YTQ A;  3LJU X;  2PNX A;  2LN0 A;  2YU5 A;  3LRQ A;  2C2L A;  2G43 A;  2B0O E;  2CKL A;  2CSH A;  2FFW A;  4YAX A;  2EM9 A;  1A1K A;  4Z0O A;  2ELY A;  1IQO A;  4O24 A; 
#chains in the Genus database with same CATH homology
 2DX8 A;  1WIM A;  3L1X A;  4W4U A;  4NXN E;  2B3T B;  2VPB A;  4FO9 A;  3ADL A;  4S3O C;  3IHP A;  2RSD A;  3HPS A;  1MM2 A;  2KE1 A;  4X62 E;  2PUY A;  3ADJ A;  4M2Z A;  1RQ0 A;  1QU6 A;  2KGI A;  2RI7 A;  2LV9 A;  1UIL A;  2L92 A;  4O64 A;  3EB6 A;  4JI5 E;  4YBS A;  4LF5 E;  4J8Z A;  3N9N A;  1WEO A;  5I3L A;  2ZET C;  1WEE A;  4GNF A;  3FIG A;  3DF6 A;  2MDR A;  2KON A;  1YYW A;  1MM3 A;  2VF1 A;  4AQY E;  2M7Q A;  2UXB E;  2LBS B;  4LF8 E;  2UXD E;  2HYE D;  2JRJ A;  2JOX A;  2K4D A;  2MC6 A;  2M85 A;  4LKA A;  2CSZ A;  4P5O B;  4R2Y A;  5AE1 A;  5FB1 A;  2DIX A;  4WYQ B;  1X4J A;  2L8T A;  4F9C B;  3N9P A;  3V43 A;  4V3K C;  1X4U A;  1DVP A;  4GKJ E;  3U5M A;  4DV6 E;  4P7D A;  3ZOQ B;  4JI6 E;  1HYI A;  5KH7 A;  2MC5 A;  4DR4 E;  4BBY A;  3HTX A;  1X48 A;  1ZBQ A;  4A49 A;  1CHC A;  2UU9 E;  4X65 E;  2H0D B;  4GKK E;  2MNZ A;  1LDK C;  2NAA A;  4LTY A;  3ADG A;  1GQE A;  5TDW A;  5T6J A;  4YHH E;  3AV0 A;  3ADI A;  3U5N A;  2Y43 A;  5AE3 A;  4LF7 E;  5B79 A;  4UP5 A;  4B3T E;  2MA5 A;  1BOR A;  2F4V E;  3T6R A;  3P1X A;  1WIL A;  2VJF B;  1WEU A;  4JYA E;  2CSY A;  4OOG C;  4L58 A;  3C5K A;  3RMP A;  2L75 A;  5DKA A;  2VNF A;  2KR4 A;  2FUU A;  2Y1N A;  2K16 A;  1WHN A;  2YT4 A;  3SOU A;  3J80 C;  3ZPV E;  1SR9 A;  3ZVZ B;  3F6G A;  5D1M B;  2KOU A;  2VPD A;  1E4U A;  5C13 A;  2DMY A;  4WSP A;  4GNE A;  2DSY A;  5ADZ A;  4DV4 E;  2CPN A;  2KWJ A;  4QF3 A;  4X3G A;  4BS9 A;  1N33 E;  4AYC A;  2JR1 A;  5IWA E;  4KHP E;  1IBL E;  4LFA E;  2F42 A;  2OXQ C;  4DV3 E;  3MSW A;  2JWO A;  5B76 A;  4BHW A;  1T4L B;  2LGL A;  5TBN A;  4YC9 A;  2Y1M A;  2G7H A;  2MNY A;  3M99 A;  2KIZ A;  3ZNI A;  1WEW A;  2MD8 C;  4DV2 E;  2NUF A;  1X49 A;  3DQV R;  3LQH A;  3KNV A;  4KZS A;  4L8N A;  3MHH A;  4MSX A;  3VYX A;  4N4F A;  1HR0 E;  2EA6 A;  2DB2 A;  2HDP A;  2L33 A;  3DPL R;  2L6M A;  4XI1 A;  3GV4 A;  5F3W A;  2VJE B;  5B78 A;  3N9M A;  2FGG A;  3QZV A;  3O36 A;  4F9A B;  2LUP B;  3J81 C;  4LF9 E;  5TAB A;  4AUQ B;  3IWB A;  4B3M E;  1XWH A;  2KWO A;  4YAB A;  4DMI A;  4DV5 E;  4L5N C;  5FER A;  1V87 A;  3K6Q A;  2LUQ A;  1HNZ E;  2BAY A;  4PTB A;  4LLB A;  2B7T A;  1WXR A;  2JMD A;  2YU4 A;  1G25 A;  4M0V A;  2KGG A;  2V85 A;  2YW8 A;  4MVT A;  5J3X A;  4NN2 A;  2QIZ A;  4LK9 A;  4Q28 A;  5CFF E;  4FJC A;  2L80 A;  2M3H A;  4BCA A;  4FK5 A;  3N9Q A;  5G0F A;  2N3H A;  3RPG B;  4JI4 E;  2ECT A;  2YUC A;  4BMJ A;  1X47 A;  2V8Q B;  3N9O A;  1GZ6 A;  4YY3 E;  4K0K E;  1VFY A;  2KHX A;  5AIU A;  5TDR A;  5B77 A;  2N3G A;  1RC7 A;  5B75 A;  3JTZ A;  4UI9 B;  5H1T A;  1WEP A;  3C6W A;  2K17 A;  4ZQL A;  2LXP C;  3KV6 A;  2B7V A;  3C4B A;  1FKA E;  4F52 B;  3AUZ A;  2XEU A;  1RMD A;  4JI1 E;  3U5P A;  5LMU E;  1DQ3 A;  3FL2 A;  2YRE A;  4BC7 A;  3IWC A;  2KWK A;  2LDR A;  1UHZ A;  2ODR D;  2QJ0 A;  3JAM C;  4F54 A;  2G45 A;  1T1H A;  2HHH E;  4DUY E;  2M1R A;  3LLH A;  2WZO A;  4I7C A;  1FBV A;  2RTX A;  2KRE A;  3HTK C;  5IT9 C;  4A4C A;  4AP4 A;  5FB0 A;  1JM7 B;  4DR1 E;  1O0W A;  2V87 A;  5DIN A;  4DR7 E;  2L5U A;  2YSJ A;  2FTX B;  5D1L B;  5FLX C;  3J7Y p;  1STU A;  5AIT A;  3IWD A;  1WE9 A;  2G6Q A;  4X8W A;  2UUC E;  2CKL B;  2L2N A;  4JI0 E;  2F6N A;  2ECV A;  2VPG A;  4GND A;  2LTS A;  2V86 A;  2KU3 A;  4IC3 A;  5LKX A;  3HXL A;  3VK6 A;  2C2V S;  3I2D A;  2EOD A;  4ZDT A;  2YUR A;  2EZ6 A;  4DKK A;  2JMI A;  4X64 E;  3DJW A;  2LTR A;  2E6R A;  4UP0 A;  4A0C D;  4OX9 E;  2VP7 A;  2AN6 A;  3KV5 A;  4P78 A;  4YBT A;  3OTO E;  2L3J A;  2ECI A;  2EWL A;  4S3O B;  2VQF E;  1JOC A;  1VYX A;  3O35 A;  5LMN E;  2L0B A;  5LKU A;  3ZPV 1;  3N9L A;  2H36 X;  5G04 B;  3JU0 A;  2H0D A;  3KQI A;  3O37 A;  4DR2 E;  2UUA E;  4DR3 E;  5BR8 E;  3HPZ A;  1FP0 A;  2LQ6 A;  1T4N A;  4Q6F A;  2MUM A;  2FSA A;  2F6J A;  2LXH C;  1Z60 A;  5TRB A;  5LKZ A;  4CA1 A;  2VPE A;  1WHQ A;  1K2F A;  2VJF A;  4DV0 E;  1T4O A;  2YHN A;  3VYY A;  2M6M A;  5FEY A;  4L7X A;  4TUI A;  4CCG X;  2IHR 1;  4R7E A;  1N87 A;  4WZ2 A;  1EKZ A;  4YBM A;  3KWR A;  4X66 E;  4ZUX U;  3LML A;  2K4V A;  2ECW A;  3L1Z B;  2MA6 A;  1Z6U A;  3ZYQ A;  1WEM A;  3O70 A;  2F8B A;  3HCU A;  2V83 A;  2K1J A;  4M30 A;  2MD7 B;  2VE7 C;  1IBK E;  3PUR A;  3GL6 A;  4B3S E;  2V88 A;  4BBQ A;  4C9Z A;  3L11 A;  2I50 A;  5LCW B;  2YZT A;  2UUB E;  4DV7 E;  3SHB A;  2LRS A;  1IYM A;  2ZM6 E;  2RS7 A;  2MT5 A;  1XMQ E;  1XNQ E;  4AYC B;  2VQE E;  5DNY A;  2LJH A;  2LMZ A;  5LKT A;  2L3C A;  3T1Y E;  4JV5 E;  2LE2 A;  3PHD A;  3PUQ A;  4LU9 A;  3O34 A;  4B86 C;  2YT5 A;  5B8D A;  2NUE A;  2ECN A;  5A2Q C;  5EYA F;  1FJG E;  2VJE A;  2YHO A;  4AVX A;  3LQJ A;  2L43 A;  3HQ1 A;  2KFT A;  4FIP A;  4NXM E;  4DUZ E;  4JI7 E;  4GB0 A;  2IDA A;  3T1H E;  1WES A;  5C11 A;  1J5E E;  4WZ3 B;  2ECJ A;  3T7L A;  5H1V A;  4LF4 E;  1ZBD B;  1WGM A;  5JG6 A;  2NA2 A;  3SOX A;  3RPG C;  2LGK A;  2FUI A;  4DR5 E;  4BC9 A;  2E6S A;  1DI2 A;  2E5L E;  3H09 A;  2V89 A;  3F6H A;  4GEQ B;  1WEV A;  3LQI A;  4DR6 E;  4R03 A;  3EB5 A;  2YYR A;  5H1U A;  1YYO A;  4R8O A;  2KYU A;  1YYK A;  2CT2 A;  2RS6 A;  2L2M A;  5H9M A;  4LFC E;  4TUG A;  1WEN A;  4YAT A;  3J7A G;  4YAD A;  1Z2Q A;  2UZG A;  2E1M A;  3O7A A;  2L2K B;  1IBM E;  2QIC A;  2XB1 A;  4B3R E;  3M62 A;  4WFT A;  1ZBT A;  1HNX E;  2B9D A;  1N36 E;  2RSM A;  3HCT A;  4WPY A;  5D1K B;  4TKP B;  4LF6 E;  4WA6 A;  2JVA A;  2M4I A;  4F9B B;  1I94 E;  1HYJ A;  3ZVY A;  3ASL A;  3C4T A;  3NG2 A;  4I8O A;  4A4B A;  1PKP A;  4N3W A;  4LFB E;  4I7D A;  1F62 A;  2LGV A;  2LRI C;  4JI2 E;  4PPE A;  3ZTG A;  4V3L C;  5AAS A;  3M63 A;  4JI8 E;  4IC2 A;  4WZ0 A;  1N34 E;  1U6G B;  4LAD B;  1HNW E;  1YZ9 A;  4QF2 A;  2ODR C;  2D8S A;  2JMJ A;  4LJN A;  2MIQ A;  3SOW A;  4JI3 E;  1VD4 A;  4R8P K;  4B7Y C;  1WEQ A;  2YQL A;  1LDJ B;  1XMO E;  4DV1 E;  5AE2 A;  5KH9 A;  4GNG A;  2YQM A;  3O33 A;  2KWN A;  2FV4 B;  3RTR B;  5LL6 R;  1N32 E;  3MHS A;  2LGG A;  1XNR E;  2ECG A;  1JM7 A;  2EGP A;  4I7B A;  2UXC E;  3OML A;  5G05 B;  2NUG A;  2M1S A;  1J26 A;  3U5O A;  5KH3 A;  2YSM A;  1X4I A;  2JOB A;  2JY9 A;  3HCS A;  1WFK A;  2PNX A;  2LN0 A;  3LRQ A;  2C2L A;  2G43 A;  2CKL A;  4YAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...