3VK6A

Crystal structure of a phosphotyrosine binding domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase Hakai
publication title Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 96
sequence length 96
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18408 zf_Hakai C2H2 Hakai zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3vk6A01
3.30.160.640 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vk6A02
4MSXA 5FB1A 2MNYA 3ASLA 5TDWA 2M85A 3MHHA 4XI1A 2BAYA 2MA6A 4BBQA 5B8DA 2F6JA 2E6RA 4P5OB 3V43A 2YQLA 4B7YC 2PUYA 4FJCA 2VJFA 4ZDTA 1V87A 2F42A 2VPGA 4R7EA 5KH9A 2XEUA 3U5NA 5B78A 2F6NA 2ECTA 2K16A 4QF2A 4ZQLA 4WA6A 5I3LA 2KU3A 5TDRA 5G05B 4YATA 2Y1MA 4C9ZA 3DPLR 4W4UA 2MT5A 3M63A 2YU4A 1FP0A 5AITA 3I2DA 1F62A 2CKLA 2VJEB 1DVPA 3ZTGA 2JMJA 2LDRA 3N9OA 4V3LC 2MIQA 3T7LA 3O34A 3ZVYA 2RI7A 4YBMA 2DX8A 1WESA 1WEVA 2OXQC 3N9QA 4WZ2A 4NN2A 5DINA 4PPEA 5TRBA 2K17A 4ZUXU 2VPBA 2NAAA 2VPEA 3VK6A 3L1ZB 1VD4A 2QIZA 2Y43A 2G45A 4S3OC 4R8PK 1FBVA 1RMDA 1LDJB 1WFKA 2YHOA 2G43A 3O70A 4BHWA 3C6WA 2LN0A 1VFYA 2LQ6A 4TKPB 2ECWA 3HCUA 3U5OA 1HYIA 5JG6A 3KV6A 1WEWA 2LXPC 2KWOA 4CA1A 1ZBDB 2YSJA 1WEUA 2JMIA 2LGVA 3O36A 4YAXA 1Z2QA 3SOXA 5LKZA 3RPGC 3GV4A 1Z6UA 2L5UA 3FL2A 2LV9A 3PHDA 2YSMA 4UI9B 1WEOA 2M6MA 4GB0A 4YABA 5C13A 5AIUA 2YW8A 4I7DA 2D8SA 5B76A 4L7XA 5D1KB 4CCGX 3ZNIA 5J3XA 4AYCB 2VJFB 5B75A 2MD7B 1WIMA 2KIZA 4A4BA 4UP5A 3LQIA 2YYRA 1WEPA 1BORA 1X4IA 2CSZA 4X3GA 4FK5A 1T1HA 1WE9A 1X4JA 3KQIA 3M62A 3GL6A 2EODA 2C2VS 2VPDA 5B79A 4I7CA 2YQMA 2H0DB 3N9MA 2UZGA 3SOUA 2AN6A 1MM2A 4GNDA 4LADB 5C11A 4A49A 4V3KC 2LGGA 4N4FA 5LKUA 4IC3A 2EGPA 4A4CA 1CHCA 3EB5A 3QZVA 1JM7A 2L43A 5H9MA 3ZVZB 4GNFA 2QJ0A 4B86C 2RSDA 5FEYA 2ECJA 5FB0A 3U5PA 4YBTA 3U5MA 3SOWA 4YBSA 4LKAA 4AP4A 5G04B 2L80A 3O7AA 2ECIA 1WGMA 2KGIA 3SHBA 2FUUA 5DKAA 4MVTA 1N87A 3EB6A 2KFTA 2LXHC 3N9PA 2HDPA 2MA5A 2KWJA 5H1VA 2M1RA 4YC9A 2JRJA 3ZYQA 2MNZA 3HTKC 3LRQA 4IC2A 4F52B 3N9LA 2YUCA 3HCSA 1HYJA 4FIPA 4AUQB 3C5KA 5G0FA 1X4UA 2FUIA 2MD8C 4GNGA 4WZ0A 2KREA 1WEMA 2ECGA 5H1TA 3O33A 1Z60A 5TABA 4LK9A 5D1LB 1G25A 2XB1A 4QF3A 3T6RA 5B77A 4WZ3B 3ZPVE 1WILA 4LLBA 3KV5A 2HYED 4AYCA 4O64A 5D1MB 5LKTA 3DQVR 3ZPV1 5KH3A 5FERA 3PURA 1WENA 1K2FA 4S3OB 3LQHA 2KE1A 2KGGA 2CKLB 2FSAA 5KH7A 5H1UA 1LDKC 2Y1NA 1IYMA 3LQJA 3IHPA 2G6QA 3KNVA 2ECNA 2VJEA 2KYUA 2ZETC 2K4DA 4R2YA 2PNXA 4A0CD 2E6SA 2H0DA 4FO9A 2L75A 1MM3A 3NG2A 1JOCA 3L1XA 4N3WA 1JM7B 5EYAF 1XWHA 2KR4A 3RPGB 2C2LA 2YREA 5TBNA 2KWKA 3N9NA 4AVXA 2VNFA 2CT2A 2M3HA 2CSYA 1VYXA 2EA6A 2YT5A 2KWNA 3RTRB 3L11A 2YHNA 2VP7A 1U6GB 2LGKA 4I7BA 4UP0A 3O35A 3O37A 5LCWB 2LRIC 5LKXA 4LJNA 4PTBA 4GNEA 1WEQA 2L0BA 2LGLA 3MHSA 2JMDA 2YURA 2K1JA 2IDAA 3M99A 4Q6FA 2I50A 2QICA 3PUQA 2MUMA 1WEEA 2ECVA 4YADA 1E4UA 4L58A 3HCTA
chains in the Genus database with same CATH superfamily
4MSXA 5FB1A 1HNWE 3F6GA 2MNYA 2D9HA 1FKAE 2LUPB 3HTXA 2MKEA 3ASLA 1XMOE 3THOB 2UU9E 4Q35B 4KHPE 5TDWA 2YTNA 2M85A 4GKJE 2KOUA 1B69A 3MHHA 4XI1A 2BAYA 5SVYA 2EGMA 2LMZA 1DI2A 2MA6A 1AH5A 4KZSA 2RSIA 5KL6A 4BBQA 5B8DA 2F6JA 3UK3C 3SUBA 3T1HE 2E6RA 2EMBA 2YTJA 4P5OB 3V43A 4RH8A 5LMNE 2ENHA 2YQLA 4B7YC 2PUYA 3FANA 2EOZA 3DJWA 5A6JA 3OTOE 2DSMA 1JK1A 5A2QC 4FJCA 2VJFA 1RC7A 4ZDTA 1V87A 2EPAA 2F42A 1YPNA 2WBUA 2VPGA 4R7EA 5KH9A 2XEUA 3U5NA 3EQ1A 2H36X 4N4RB 5B78A 2J7JA 2ENCA 2F6NA 2YTGA 3FEHA 1I94E 2ECTA 2K16A 5F3WA 4QF2A 4ZQLA 4WA6A 2YTPA 1F2IG 2B3TB 3J81C 4Z0RA 2NUEA 5I3LA 2EPLX 2EMHA 3C4TA 2FD4A 2KKYA 2KU3A 2R76A 1N34E 2EN7A 5AC5A 1YFHA 2DMIA 5TDRA 2IHR1 5G05B 4JYAE 2EM2A 1GTKA 3ZOQB 2EMKA 1IBME 4YATA 1STUA 5IV8B 3H09A 2B7TA 2Y1MA 4C9ZA 2M7QA 3DPLR 4W4UA 2MT5A 3M63A 2I13A 3F6HA 5A69A 4LF5E 2YU4A 1FP0A 3DWDA 2EM8A 5AITA 2V87A 4JI4E 4M2ZA 1XNQE 3AUZA 2VQFE 3I2DA 3J7Yp 4DUYE 1F62A 1YSAC 2CKLA 2VJEB 1DVPA 3ZTGA 2GLIA 2JMJA 2LDRA 3N9OA 4R2CA 4V3LC 2L2MA 2DB2A 2LBSB 2KONA 2V85A 4DV5E 4F9BB 1QU6A 2EN1A 2MIQA 4ZYHA 5AC4A 2EM5A 3VHTB 3T7LA 2L92A 3O34A 2XP0A 3ZVYA 3LMLA 1NCSA 2JY9A 2M9AA 4LFBE 3LVRE 4ZYGA 4P7DA 2RI7A 2L2NA 5FLXC 1N33E 4YBMA 2DX8A 1WESA 5KL7A 1WEVA 2E72A 2OXQC 3N9QA 4B3ME 3EPKA 4DR2E 4NZVA 4WZ2A 3QG5C 1T4OA 3ADGA 4DR5E 4NN2A 5DINA 2EWLA 2LRSA 2YRMA 4DR6E 4OOGC 4PPEA 5IWAE 2N3HA 2MKNA 5TRBA 4R2SA 4B3TE 4NXNE 1G2DC 2K17A 1WRJA 3TQMA 4JI6E 4ZUXU 2JR1A 2VPBA 1DGCA 2EOOA 1X6EA 1ZU1A 2EMWA 2DSYA 1N32E 4JI1E 3H7HA 2LAUA 1P47A 2NAAA 2IQJA 2VPEA 3VK6A 2EOEA 3L1ZB 3EPJA 1VD4A 2QIZA 2Y43A 2YTOA 2YTDA 2G45A 4S3OC 3DDTA 2EN8A 4LF9E 2P57A 2WZOA 2EMXA 4DUZE 1HNXE 4FK5C 4R8PK 3HQ1A 1FBVA 1RMDA 2CTDA 4DV4E 1LDJB 1WFKA 3P1XA 4DR3E 1IBLE 2YHOA 1X3CA 3PLWA 4Z0OA 2K4VA 2G43A 3O70A 1HNZE 1IQOA 2LTRA 1MEYC 2DMYA 3ADJA 2CONA 4F1PA 4DV1E 4BHWA 2EPRA 2EPPA 4DV0E 3C6WA 2LN0A 1VFYA 1T4LB 2YU8A 2EOXA 3LJUX 2RR4A 2LQ6A 3FM8C 4YHHE 2Q8UA 2LT7A 4TKPB 3E2DA 2FV4B 2YT4A 2ECWA 3ECRA 3HCUA 2EOIA 2EOMA 3K6QA 2EPZA 3C6KA 3M99B 3U5OA 3T1YE 1BB8A 1HYIA 4ZYEA 4GKKE 5JG6A 3KV6A 1WEWA 2B7VA 3OMLA 4BC7A 2LXPC 1BBGA 1A1FA 2CRRA 2JPAA 2KWOA 4F54A 4CA1A 4H9DA 4DR1E 1A1KA 1ZBDB 4B3RE 1RQ0A 1YYKA 2YSJA 1WEUA 2L7PA 3FJUB 2FFWA 2JMIA 2LGVA 3O36A 1Z2QA 4YAXA 1X47A 3SOXA 5LKZA 2MKDA 3RPGC 4HTGA 4R03A 5A6BA 3GV4A 5A6BD 2EOHA 1Z6UA 2L5UA 2B9DA 2EZ6A 2D8UA 3FL2A 1EH7A 2EOSA 1UILA 2HHHE 3C4BA 4O24A 2LV9A 3PHDA 2YSMA 2V88A 2UUBE 1WEOA 2M6MA 4UI9B 4GB0A 3LVQE 4YABA 1PJTA 5C13A 5AIUA 2YW8A 4I7DA 2D8SA 4I8OA 2UXDE 1J26A 3O47A 5LL6R 5B76A 4L7XA 5D1KB 4CCGX 2GHFA 1SFEA 2YSOA 1J5EE 3ZNIA 4BHBA 5J3XA 4AYCB 3IWDA 4KWYA 3EPHA 2EM7A 2VJFB 5B75A 2MD7B 1WIMA 2YVRA 2EM4A 4GEQB 4M30A 2L3CA 2KIZA 3KWRA 4A4BA 2N3GA 4DV2E 4BMJA 2K7IA 4UP5A 2EQ3A 2I9IA 2L6MA 5AASA 2YRHA 3LQIA 1N36E 2YYRA 1EH6A 1X6FA 3ADLA 4R2PA 2ELZA 2EL5A 2EM0A 1T39A 4JI2E 1GQEA 1ZBTA 2EQ0A 4IJDA 1WEPA 1BORA 1X4IA 1YUJA 2CSZA 3IWBA 4X3GA 2JVAA 2EM6A 4FK5A 1T1HA 1X5WA 1WE9A 1X4JA 1MGTA 2EOYA 3KQIA 2EPUA 1T38A 2EN3A 3M62A 4R2DA 3GL6A 5AE2A 5KL4A 2EN4A 5CFFE 4DKKA 2EODA 3VYYA 2C2VS 2VPDA 2EMFA 4LFCE 5B79A 2LJHA 1A1LA 1YZ9A 4I7CA 2JWOA 2YQMA 2H0DB 3N9MA 3J7AG 2UZGA 3SOUA 2ADRA 5AE1A 2AN6A 2MDRA 2NABA 1MM2A 2G7HA 4JV5E 2EPOA 2ZM6E 4GNDA 4LADB 2YRKA 1KYQA 5C11A 2ODRC 3KZYA 4A49A 4V3KC 2LGGA 4TUIA 4JI7E 4N4FA 5LKUA 3EPLA 2A25A 2YPNA 1MBMA 2E61A 4QQ4A 4IC3A 2EGPA 4A4CA 3BBGA 4DV3E 1CHCA 4NXME 2EP3A 3EB5A 4JI5E 1BBOA 1GZ6A 1PJQA 3QZVA 4L5NC 2LO3A 2LUQA 4J8ZA 1JM7A 1NEIA 2L43A 5H9MA 3ZVZB 2JYAA 4GNFA 4R2RA 1EKZA 3MDBC 2QJ0A 4B86C 2RSDA 5FEYA 4BHCA 4F6NA 3L00A 4OGCA 2EMCA 2E5LE 2ECJA 2RS7A 5FB0A 3U5PA 4YBTA 2EMAA 3LLHA 4NHRA 5DNYA 1X6HA 3U5MA 2EL6A 2YSPA 2JOBA 1KJKA 3SOWA 4YBSA 2V89A 2UUAE 2RSMA 2CSVA 4LKAA 4AP4A 5G04B 5SVIA 2EJ4A 3MSWA 2L80A 2EE8A 1DQ3A 4DMIA 3O7AA 2ECIA 3BF2A 3BIDA 2DRPA 3Q1DA 4X62E 2CSHA 1WGMA 2WBTA 2VRDA 2KGIA 4LF7E 5KL5A 1SR9A 4HEIA 4WXDA 2NUGA 3ADIA 3SHBA 2HJJA 2KHXA 2FUUA 5DKAA 4MVTA 4BC9A 4X9JA 1HR0E 1N87A 3EB6A 2MDGA 1A1GA 2KFTA 2LXHC 2YTFA 3N9PA 1DCQA 2HDPA 2MA5A 2KWJA 2JUNA 1IBKE 4M0VA 4MLQA 5H1VA 5AE3A 1JK2A 4R8OA 1N3GA 2M1RA 4YC9A 2JRJA 3ZYQA 4BS9A 4OX9E 2MNZA 2ELYA 3HTKC 3LRQA 4TUGA 1TF6A 1O0WA 2EMZA 1ZR9A 5A6AA 4IC2A 2UXBE 4F52B 3N9LA 2YUCA 2UXCE 4JI3E 2YZTA 3HCSA 2ENAA 1HYJA 2EPXA 4FIPA 2JOXA 2EPMX 4AUQB 4P78A 2BBGA 2L33A 3C5KA 5G0FA 4AQYE 1X4UA 2FGGA 4R2QA 4JI0E 1T4NA 2FUIA 2VE7C 2MD8C 2WBSA 3JAMC 3FIGA 2EMLA 4GNGA 4JI8E 4O62A 3JUEA 4WZ0A 2KREA 1WEMA 3DF6A 2UUCE 2ECGA 2ODRD 5ADZA 2EL4A 2EQ1A 1IQSA 2YTEA 3RMPA 2EMIA 2F8BA 2FTXB 5H1TA 1WJPA 1G2FC 3HPSA 1PDAA 2LV2A 3O33A 2HC5A 5BR8E 1Z60A 4ZYDA 5TABA 1XMQE 4LK9A 2JM3A 5D1LB 1G25A 4WSPA 2XB1A 4LF8E 1UHZA 1YYWA 4QF3A 2EPNA 3T6RA 5B77A 2KKXA 4WZ3B 3ZPVE 1WILA 1FJGE 2VQEE 4LLBA 1A1HA 3T9KA 3KV5A 2HYED 4AYCA 4O64A 5D1MB 5LKTA 2EPKX 2YTQA 4O5GA 4DR4E 3KZZA 3DQVR 5A6KA 2RS6A 3ZPV1 5KH3A 2CRWA 4O43A 4O4KA 5FERA 3PURA 4WYQB 1WENA 1K2FA 4S3OB 2DGCA 3LQHA 3KDEC 2M1SA 1X48A 4L8NA 4R2AA 4M9VC 1IMUA 2KE1A 2EM3A 4WSGA 2KGGA 4WXCA 4WFTA 5KL2A 2CT1A 2CKLB 2FSAA 5KH7A 2VF1A 5H1UA 3MHSC 4B3SE 1LDKC 2Y1NA 1IYMA 1PKPA 5IXMB 2EPCA 2HGHA 1L4SA 3LQJA 3IHPA 4DR7E 2V8QB 2G6QA 2RQLA 4DV7E 3KNVA 1EH8A 2EORA 2ECNA 4LTYA 2OWAA 2YU5A 2EOJA 3HPZA 2VJEA 5K3QA 2L2KB 2KYUA 3VYXA 3J80C 4X65E 2EOQA 3BGHA 2CPNA 2ZETC 1ZBQA 1TF3A 2K4DA 2JP9A 2B0OE 2EXUA 4R2YA 3C6MA 2L8TA 1WXRA 4X66E 2PNXA 4A0CD 4FO9A 2E6SA 2H0DA 2L75A 3MHHC 2EN2A 1MM3A 4F2JC 3NG2A 1JOCA 4WPYA 5KL3A 3FAOA 3L1XA 1WHQA 2LVHA 5LMUE 4N3WA 4BCAA 1A1IA 2EN6A 2V86A 2MC5A 4WX9A 4Q28A 1JM7B 3IWCA 5EYAF 1X49A 2EMYA 2DLKA 1XWHA 1AAYA 2KR4A 3RPGB 1PJSA 5TSEA 2C2LA 3AV0A 2YREA 4LF6E 5TBNA 2KWKA 2F4VE 3N9NA 1YUIA 4OGEA 4AVXA 2VNFA 2CT2A 2M3HA 4DV6E 2CSYA 4BBYA 2DJAA 2EMGA 2XOZA 5SVXA 1VYXA 2EA6A 2YWQA 4X64E 4YY3E 2YT5A 1UN6B 2XOYA 2KWNA 3RTRB 4MLVA 1QNTA 4F6MA 4IS1C 2EM9A 4F9CB 3L11A 1TN9A 5SVIB 5T6JA 2NUFA 2YHNA 2MC6A 2BB8A 2VP7A 4GZNC 1U6GB 2M4IA 2LGKA 4I7BA 3JTZA 2LTSA 2JXPA 2LCEA 1LLMC 4UP0A 2L3JA 2XOCA 3O35A 2RTXA 2RPCA 2LE2A 3O37A 5LCWB 3JU0A 2LRIC 4LFAE 2EOFA 4LF4E 5LKXA 2DIXA 4LJNA 4PTBA 2WCC3 4GNEA 1UBDC 5IT9C 1ZAAC 2E1MA 1Z1BA 1WEQA 3LDYA 4LU9A 2DLQA 2YTIA 4X8WA 2PRTA 1A1JA 2L0BA 3THNA 2LGLA 1WHNA 1XNRE 4RHBB 3MHSA 2JMDA 2YURA 2K1JA 2R1FA 2IDAA 5LLQA 1YYOA 3M99A 4K0KE 2GPIA 2M13A 4Q6FA 2I50A 2QICA 3PUQA 2LJUA 2MUMA 1WEEA 2ECVA 3HXLA 2V83A 2N8XA 4YADA 3M7KA 1E4UA 4F9AB 4L58A 2NA2A 3HCTA 4R2EA
chains in the Genus database with same CATH topology
4MSXA 5FB1A 1HNWE 3F6GA 2MNYA 1FKAE 2LUPB 3HTXA 3ASLA 1XMOE 2UU9E 4KHPE 5TDWA 2M85A 4GKJE 2KOUA 3MHHA 4XI1A 2BAYA 2LMZA 1DI2A 2MA6A 4KZSA 4BBQA 5B8DA 2F6JA 3T1HE 2E6RA 4P5OB 3V43A 5LMNE 2YQLA 4B7YC 2PUYA 3DJWA 3OTOE 5A2QC 4FJCA 2VJFA 1RC7A 4ZDTA 1V87A 4JI3E 2F42A 2VPGA 4R7EA 5KH9A 2XEUA 3U5NA 2H36X 5B78A 2F6NA 1I94E 2ECTA 2K16A 5F3WA 4QF2A 4ZQLA 4WA6A 2B3TB 3J81C 2NUEA 5I3LA 3C4TA 2KU3A 1N34E 4JYAE 5TDRA 2IHR1 5G05B 3ZOQB 1IBME 4YATA 1STUA 3H09A 2B7TA 2Y1MA 4C9ZA 2M7QA 3DPLR 4W4UA 2MT5A 3M63A 3F6HA 4LF5E 2YU4A 1FP0A 2V87A 1XNQE 5AITA 4JI4E 4M2ZA 3AUZA 2VQFE 3I2DA 3J7Yp 4DUYE 1F62A 2CKLA 2VJEB 1DVPA 3ZTGA 2JMJA 2LDRA 3N9OA 4V3LC 2L2MA 2DB2A 2LBSB 2KONA 2V85A 4DV5E 4F9BB 1QU6A 2MIQA 3T7LA 2L92A 3O34A 3ZVYA 3LMLA 2JY9A 4LFBE 4P7DA 2RI7A 2L2NA 5FLXC 1N33E 4YBMA 2DX8A 1WESA 1WEVA 2OXQC 3N9QA 4B3ME 4DR2E 4WZ2A 1T4OA 3ADGA 4DR5E 4NN2A 5DINA 2EWLA 2LRSA 4DR6E 4OOGC 4PPEA 5IWAE 2N3HA 4NXNE 5TRBA 4B3TE 2K17A 4JI6E 4ZUXU 2JR1A 2VPBA 2DSYA 1N32E 4JI1E 2NAAA 2VPEA 3VK6A 3L1ZB 1VD4A 2QIZA 2Y43A 2G45A 4S3OC 4LF9E 2WZOA 4DUZE 1HNXE 4R8PK 3HQ1A 1FBVA 1RMDA 4DV4E 1LDJB 1WFKA 3P1XA 4DR3E 1IBLE 2YHOA 2K4VA 2G43A 3O70A 1HNZE 2LTRA 2DMYA 3ADJA 4DV0E 4DV1E 4BHWA 3C6WA 2LN0A 1VFYA 1T4LB 2LQ6A 4YHHE 4TKPB 2FV4B 2YT4A 2ECWA 3HCUA 3K6QA 3T1YE 3U5OA 1HYIA 4GKKE 5JG6A 3KV6A 1WEWA 2B7VA 3OMLA 4BC7A 2LXPC 2KWOA 4F54A 4CA1A 4DR1E 1ZBDB 4B3RE 1RQ0A 1YYKA 2YSJA 1WEUA 2JMIA 2LGVA 3O36A 4YAXA 1Z2QA 1X47A 4R03A 3SOXA 5LKZA 3RPGC 3GV4A 1Z6UA 2L5UA 2B9DA 2EZ6A 3FL2A 1UILA 2HHHE 3C4BA 2LV9A 3PHDA 2YSMA 2V88A 2UUBE 4UI9B 1WEOA 2M6MA 4GB0A 4YABA 5C13A 5AIUA 2YW8A 4I7DA 2D8SA 4I8OA 2UXDE 1J26A 5LL6R 5B76A 4L7XA 5D1KB 4CCGX 1J5EE 3ZNIA 5J3XA 4AYCB 3IWDA 2VJFB 5B75A 2MD7B 1WIMA 4GEQB 4M30A 2L3CA 2KIZA 3KWRA 4A4BA 2N3GA 4DV2E 4BMJA 4UP5A 2L6MA 5AASA 3LQIA 1N36E 2YYRA 3ADLA 4JI2E 1GQEA 1ZBTA 1WEPA 1BORA 1X4IA 2CSZA 3IWBA 4X3GA 2JVAA 4FK5A 1T1HA 1WE9A 1X4JA 3KQIA 3M62A 3GL6A 5AE2A 5CFFE 4DKKA 2EODA 3VYYA 2C2VS 2VPDA 4LFCE 5B79A 2LJHA 1YZ9A 4I7CA 2JWOA 2YQMA 2H0DB 3N9MA 3J7AG 2UZGA 3SOUA 5AE1A 2AN6A 2MDRA 1MM2A 2G7HA 4JV5E 2ZM6E 4GNDA 4LADB 5C11A 2ODRC 4A49A 4V3KC 2LGGA 4TUIA 4N4FA 5LKUA 4IC3A 2EGPA 4A4CA 4DV3E 1CHCA 4NXME 3EB5A 4JI5E 1GZ6A 3QZVA 4L5NC 4J8ZA 2LUQA 1JM7A 2L43A 5H9MA 3ZVZB 4GNFA 1EKZA 2QJ0A 4B86C 2RSDA 5FEYA 2E5LE 2ECJA 2RS7A 5FB0A 3U5PA 4YBTA 3LLHA 5DNYA 3U5MA 2JOBA 3SOWA 4YBSA 2V89A 2UUAE 2RSMA 4LKAA 4AP4A 5G04B 3MSWA 2L80A 1DQ3A 4DMIA 3O7AA 2ECIA 4X62E 1WGMA 4LF7E 2KGIA 2NUGA 3ADIA 1SR9A 3SHBA 2KHXA 2FUUA 5DKAA 4MVTA 4BC9A 1HR0E 1N87A 3EB6A 2KFTA 2LXHC 3N9PA 2HDPA 2MA5A 2KWJA 1IBKE 4M0VA 5AE3A 5H1VA 4R8OA 2M1RA 4YC9A 2JRJA 3ZYQA 4BS9A 4OX9E 2MNZA 3HTKC 3LRQA 4TUGA 1O0WA 2UXBE 4IC2A 4F52B 3N9LA 2YUCA 2UXCE 2YZTA 3HCSA 1HYJA 4FIPA 2JOXA 4P78A 4AUQB 2L33A 3C5KA 5G0FA 4AQYE 1X4UA 2FGGA 4JI0E 1T4NA 2FUIA 2VE7C 2MD8C 3JAMC 3FIGA 4GNGA 4JI8E 4WZ0A 2KREA 1WEMA 3DF6A 2UUCE 2ECGA 2ODRD 5ADZA 3RMPA 2F8BA 2FTXB 5H1TA 3HPSA 5BR8E 3O33A 1Z60A 5TABA 1XMQE 4LK9A 5D1LB 1G25A 4WSPA 4LF8E 2XB1A 1YYWA 1UHZA 4QF3A 3T6RA 5B77A 4WZ3B 3ZPVE 1WILA 1FJGE 2VQEE 4LLBA 3KV5A 2HYED 4AYCA 4O64A 5D1MB 5LKTA 4DR4E 3DQVR 2RS6A 3ZPV1 5KH3A 5FERA 3PURA 4WYQB 1WENA 1K2FA 4S3OB 3LQHA 2M1SA 1X48A 4L8NA 2KE1A 2KGGA 4WFTA 2CKLB 2FSAA 5KH7A 2VF1A 5H1UA 4B3SE 1LDKC 2Y1NA 1IYMA 1PKPA 3LQJA 3IHPA 4DR7E 2V8QB 2G6QA 4DV7E 3KNVA 2ECNA 4LTYA 3HPZA 2VJEA 2L2KB 2KYUA 3VYXA 3J80C 4X65E 2CPNA 2ZETC 1ZBQA 2K4DA 4R2YA 2L8TA 1WXRA 4X66E 2PNXA 4A0CD 2E6SA 2H0DA 4FO9A 2L75A 1MM3A 3NG2A 1JOCA 4WPYA 3L1XA 1WHQA 5LMUE 4N3WA 4BCAA 2V86A 2MC5A 4Q28A 1JM7B 3IWCA 5EYAF 1X49A 1XWHA 2KR4A 3RPGB 2C2LA 3AV0A 2YREA 4LF6E 5TBNA 2KWKA 2F4VE 3N9NA 4AVXA 2VNFA 2CT2A 2M3HA 4DV6E 2CSYA 4BBYA 1VYXA 2EA6A 4X64E 4YY3E 2YT5A 2KWNA 3RTRB 4F9CB 3L11A 5T6JA 2NUFA 2YHNA 2MC6A 2VP7A 1U6GB 2M4IA 2LGKA 4I7BA 3JTZA 2LTSA 4UP0A 2L3JA 3O35A 2RTXA 2LE2A 3O37A 5LCWB 3JU0A 2LRIC 4LFAE 4LF4E 5LKXA 2DIXA 4LJNA 4PTBA 4GNEA 5IT9C 2E1MA 1WEQA 4LU9A 4X8WA 2L0BA 1XNRE 2LGLA 1WHNA 3MHSA 2JMDA 2YURA 2K1JA 2IDAA 1YYOA 3M99A 4K0KE 4Q6FA 2I50A 2QICA 3PUQA 2MUMA 1WEEA 2ECVA 3HXLA 2V83A 4YADA 1E4UA 4F9AB 4L58A 2NA2A 3HCTA 4JI7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  5FB1 A;  2MNY A;  3ASL A;  5TDW A;  2M85 A;  3MHH A;  4XI1 A;  2BAY A;  2MA6 A;  4BBQ A;  5B8D A;  2F6J A;  2E6R A;  4P5O B;  3V43 A;  2YQL A;  4B7Y C;  2PUY A;  4FJC A;  2VJF A;  4ZDT A;  1V87 A;  2F42 A;  2VPG A;  4R7E A;  5KH9 A;  2XEU A;  3U5N A;  5B78 A;  2F6N A;  2ECT A;  2K16 A;  4QF2 A;  4ZQL A;  4WA6 A;  5I3L A;  2KU3 A;  5TDR A;  5G05 B;  4YAT A;  2Y1M A;  4C9Z A;  3DPL R;  4W4U A;  2MT5 A;  3M63 A;  2YU4 A;  1FP0 A;  5AIT A;  3I2D A;  1F62 A;  2CKL A;  2VJE B;  1DVP A;  3ZTG A;  2JMJ A;  2LDR A;  3N9O A;  4V3L C;  2MIQ A;  3T7L A;  3O34 A;  3ZVY A;  2RI7 A;  4YBM A;  2DX8 A;  1WES A;  1WEV A;  2OXQ C;  3N9Q A;  4WZ2 A;  4NN2 A;  5DIN A;  4PPE A;  5TRB A;  2K17 A;  4ZUX U;  2VPB A;  2NAA A;  2VPE A;  3VK6 A;  3L1Z B;  1VD4 A;  2QIZ A;  2Y43 A;  2G45 A;  4S3O C;  4R8P K;  1FBV A;  1RMD A;  1LDJ B;  1WFK A;  2YHO A;  2G43 A;  3O70 A;  4BHW A;  3C6W A;  2LN0 A;  1VFY A;  2LQ6 A;  4TKP B;  2ECW A;  3HCU A;  3U5O A;  1HYI A;  5JG6 A;  3KV6 A;  1WEW A;  2LXP C;  2KWO A;  4CA1 A;  1ZBD B;  2YSJ A;  1WEU A;  2JMI A;  2LGV A;  3O36 A;  4YAX A;  1Z2Q A;  3SOX A;  5LKZ A;  3RPG C;  3GV4 A;  1Z6U A;  2L5U A;  3FL2 A;  2LV9 A;  3PHD A;  2YSM A;  4UI9 B;  1WEO A;  2M6M A;  4GB0 A;  4YAB A;  5C13 A;  5AIU A;  2YW8 A;  4I7D A;  2D8S A;  5B76 A;  4L7X A;  5D1K B;  4CCG X;  3ZNI A;  5J3X A;  4AYC B;  2VJF B;  5B75 A;  2MD7 B;  1WIM A;  2KIZ A;  4A4B A;  4UP5 A;  3LQI A;  2YYR A;  1WEP A;  1BOR A;  1X4I A;  2CSZ A;  4X3G A;  4FK5 A;  1T1H A;  1WE9 A;  1X4J A;  3KQI A;  3M62 A;  3GL6 A;  2EOD A;  2C2V S;  2VPD A;  5B79 A;  4I7C A;  2YQM A;  2H0D B;  3N9M A;  2UZG A;  3SOU A;  2AN6 A;  1MM2 A;  4GND A;  4LAD B;  5C11 A;  4A49 A;  4V3K C;  2LGG A;  4N4F A;  5LKU A;  4IC3 A;  2EGP A;  4A4C A;  1CHC A;  3EB5 A;  3QZV A;  1JM7 A;  2L43 A;  5H9M A;  3ZVZ B;  4GNF A;  2QJ0 A;  4B86 C;  2RSD A;  5FEY A;  2ECJ A;  5FB0 A;  3U5P A;  4YBT A;  3U5M A;  3SOW A;  4YBS A;  4LKA A;  4AP4 A;  5G04 B;  2L80 A;  3O7A A;  2ECI A;  1WGM A;  2KGI A;  3SHB A;  2FUU A;  5DKA A;  4MVT A;  1N87 A;  3EB6 A;  2KFT A;  2LXH C;  3N9P A;  2HDP A;  2MA5 A;  2KWJ A;  5H1V A;  2M1R A;  4YC9 A;  2JRJ A;  3ZYQ A;  2MNZ A;  3HTK C;  3LRQ A;  4IC2 A;  4F52 B;  3N9L A;  2YUC A;  3HCS A;  1HYJ A;  4FIP A;  4AUQ B;  3C5K A;  5G0F A;  1X4U A;  2FUI A;  2MD8 C;  4GNG A;  4WZ0 A;  2KRE A;  1WEM A;  2ECG A;  5H1T A;  3O33 A;  1Z60 A;  5TAB A;  4LK9 A;  5D1L B;  1G25 A;  2XB1 A;  4QF3 A;  3T6R A;  5B77 A;  4WZ3 B;  3ZPV E;  1WIL A;  4LLB A;  3KV5 A;  2HYE D;  4AYC A;  4O64 A;  5D1M B;  5LKT A;  3DQV R;  3ZPV 1;  5KH3 A;  5FER A;  3PUR A;  1WEN A;  1K2F A;  4S3O B;  3LQH A;  2KE1 A;  2KGG A;  2CKL B;  2FSA A;  5KH7 A;  5H1U A;  1LDK C;  2Y1N A;  1IYM A;  3LQJ A;  3IHP A;  2G6Q A;  3KNV A;  2ECN A;  2VJE A;  2KYU A;  2ZET C;  2K4D A;  4R2Y A;  2PNX A;  4A0C D;  2E6S A;  2H0D A;  4FO9 A;  2L75 A;  1MM3 A;  3NG2 A;  1JOC A;  3L1X A;  4N3W A;  1JM7 B;  5EYA F;  1XWH A;  2KR4 A;  3RPG B;  2C2L A;  2YRE A;  5TBN A;  2KWK A;  3N9N A;  4AVX A;  2VNF A;  2CT2 A;  2M3H A;  2CSY A;  1VYX A;  2EA6 A;  2YT5 A;  2KWN A;  3RTR B;  3L11 A;  2YHN A;  2VP7 A;  1U6G B;  2LGK A;  4I7B A;  4UP0 A;  3O35 A;  3O37 A;  5LCW B;  2LRI C;  5LKX A;  4LJN A;  4PTB A;  4GNE A;  1WEQ A;  2L0B A;  2LGL A;  3MHS A;  2JMD A;  2YUR A;  2K1J A;  2IDA A;  3M99 A;  4Q6F A;  2I50 A;  2QIC A;  3PUQ A;  2MUM A;  1WEE A;  2ECV A;  4YAD A;  1E4U A;  4L58 A;  3HCT A; 
#chains in the Genus database with same CATH topology
 4MSX A;  5FB1 A;  1HNW E;  3F6G A;  2MNY A;  2D9H A;  1FKA E;  2LUP B;  3HTX A;  2MKE A;  3ASL A;  1XMO E;  3THO B;  2UU9 E;  4Q35 B;  4KHP E;  5TDW A;  2YTN A;  2M85 A;  4GKJ E;  2KOU A;  1B69 A;  3MHH A;  4XI1 A;  2BAY A;  5SVY A;  2EGM A;  2LMZ A;  1DI2 A;  2MA6 A;  1AH5 A;  4KZS A;  2RSI A;  5KL6 A;  4BBQ A;  5B8D A;  2F6J A;  3UK3 C;  3SUB A;  3T1H E;  2E6R A;  2EMB A;  2YTJ A;  4P5O B;  3V43 A;  4RH8 A;  5LMN E;  2ENH A;  2YQL A;  4B7Y C;  2PUY A;  3FAN A;  2EOZ A;  3DJW A;  5A6J A;  3OTO E;  2DSM A;  1JK1 A;  5A2Q C;  4FJC A;  2VJF A;  1RC7 A;  4ZDT A;  1V87 A;  2EPA A;  2F42 A;  1YPN A;  2WBU A;  2VPG A;  4R7E A;  5KH9 A;  2XEU A;  3U5N A;  3EQ1 A;  2H36 X;  4N4R B;  5B78 A;  2J7J A;  2ENC A;  2F6N A;  2YTG A;  3FEH A;  1I94 E;  2ECT A;  2K16 A;  5F3W A;  4QF2 A;  4ZQL A;  4WA6 A;  2YTP A;  1F2I G;  2B3T B;  3J81 C;  4Z0R A;  2NUE A;  5I3L A;  2EPL X;  2EMH A;  3C4T A;  2FD4 A;  2KKY A;  2KU3 A;  2R76 A;  1N34 E;  2EN7 A;  5AC5 A;  1YFH A;  2DMI A;  5TDR A;  2IHR 1;  5G05 B;  4JYA E;  2EM2 A;  1GTK A;  3ZOQ B;  2EMK A;  1IBM E;  4YAT A;  1STU A;  5IV8 B;  3H09 A;  2B7T A;  2Y1M A;  4C9Z A;  2M7Q A;  3DPL R;  4W4U A;  2MT5 A;  3M63 A;  2I13 A;  3F6H A;  5A69 A;  4LF5 E;  2YU4 A;  1FP0 A;  3DWD A;  2EM8 A;  5AIT A;  2V87 A;  4JI4 E;  4M2Z A;  1XNQ E;  3AUZ A;  2VQF E;  3I2D A;  3J7Y p;  4DUY E;  1F62 A;  1YSA C;  2CKL A;  2VJE B;  1DVP A;  3ZTG A;  2GLI A;  2JMJ A;  2LDR A;  3N9O A;  4R2C A;  4V3L C;  2L2M A;  2DB2 A;  2LBS B;  2KON A;  2V85 A;  4DV5 E;  4F9B B;  1QU6 A;  2EN1 A;  2MIQ A;  4ZYH A;  5AC4 A;  2EM5 A;  3VHT B;  3T7L A;  2L92 A;  3O34 A;  2XP0 A;  3ZVY A;  3LML A;  1NCS A;  2JY9 A;  2M9A A;  4LFB E;  3LVR E;  4ZYG A;  4P7D A;  2RI7 A;  2L2N A;  5FLX C;  1N33 E;  4YBM A;  2DX8 A;  1WES A;  5KL7 A;  1WEV A;  2E72 A;  2OXQ C;  3N9Q A;  4B3M E;  3EPK A;  4DR2 E;  4NZV A;  4WZ2 A;  3QG5 C;  1T4O A;  3ADG A;  4DR5 E;  4NN2 A;  5DIN A;  2EWL A;  2LRS A;  2YRM A;  4DR6 E;  4OOG C;  4PPE A;  5IWA E;  2N3H A;  2MKN A;  5TRB A;  4R2S A;  4B3T E;  4NXN E;  1G2D C;  2K17 A;  1WRJ A;  3TQM A;  4JI6 E;  4ZUX U;  2JR1 A;  2VPB A;  1DGC A;  2EOO A;  1X6E A;  1ZU1 A;  2EMW A;  2DSY A;  1N32 E;  4JI1 E;  3H7H A;  2LAU A;  1P47 A;  2NAA A;  2IQJ A;  2VPE A;  3VK6 A;  2EOE A;  3L1Z B;  3EPJ A;  1VD4 A;  2QIZ A;  2Y43 A;  2YTO A;  2YTD A;  2G45 A;  4S3O C;  3DDT A;  2EN8 A;  4LF9 E;  2P57 A;  2WZO A;  2EMX A;  4DUZ E;  1HNX E;  4FK5 C;  4R8P K;  3HQ1 A;  1FBV A;  1RMD A;  2CTD A;  4DV4 E;  1LDJ B;  1WFK A;  3P1X A;  4DR3 E;  1IBL E;  2YHO A;  1X3C A;  3PLW A;  4Z0O A;  2K4V A;  2G43 A;  3O70 A;  1HNZ E;  1IQO A;  2LTR A;  1MEY C;  2DMY A;  3ADJ A;  2CON A;  4F1P A;  4DV1 E;  4BHW A;  2EPR A;  2EPP A;  4DV0 E;  3C6W A;  2LN0 A;  1VFY A;  1T4L B;  2YU8 A;  2EOX A;  3LJU X;  2RR4 A;  2LQ6 A;  3FM8 C;  4YHH E;  2Q8U A;  2LT7 A;  4TKP B;  3E2D A;  2FV4 B;  2YT4 A;  2ECW A;  3ECR A;  3HCU A;  2EOI A;  2EOM A;  3K6Q A;  2EPZ A;  3C6K A;  3M99 B;  3U5O A;  3T1Y E;  1BB8 A;  1HYI A;  4ZYE A;  4GKK E;  5JG6 A;  3KV6 A;  1WEW A;  2B7V A;  3OML A;  4BC7 A;  2LXP C;  1BBG A;  1A1F A;  2CRR A;  2JPA A;  2KWO A;  4F54 A;  4CA1 A;  4H9D A;  4DR1 E;  1A1K A;  1ZBD B;  4B3R E;  1RQ0 A;  1YYK A;  2YSJ A;  1WEU A;  2L7P A;  3FJU B;  2FFW A;  2JMI A;  2LGV A;  3O36 A;  1Z2Q A;  4YAX A;  1X47 A;  3SOX A;  5LKZ A;  2MKD A;  3RPG C;  4HTG A;  4R03 A;  5A6B A;  3GV4 A;  5A6B D;  2EOH A;  1Z6U A;  2L5U A;  2B9D A;  2EZ6 A;  2D8U A;  3FL2 A;  1EH7 A;  2EOS A;  1UIL A;  2HHH E;  3C4B A;  4O24 A;  2LV9 A;  3PHD A;  2YSM A;  2V88 A;  2UUB E;  1WEO A;  2M6M A;  4UI9 B;  4GB0 A;  3LVQ E;  4YAB A;  1PJT A;  5C13 A;  5AIU A;  2YW8 A;  4I7D A;  2D8S A;  4I8O A;  2UXD E;  1J26 A;  3O47 A;  5LL6 R;  5B76 A;  4L7X A;  5D1K B;  4CCG X;  2GHF A;  1SFE A;  2YSO A;  1J5E E;  3ZNI A;  4BHB A;  5J3X A;  4AYC B;  3IWD A;  4KWY A;  3EPH A;  2EM7 A;  2VJF B;  5B75 A;  2MD7 B;  1WIM A;  2YVR A;  2EM4 A;  4GEQ B;  4M30 A;  2L3C A;  2KIZ A;  3KWR A;  4A4B A;  2N3G A;  4DV2 E;  4BMJ A;  2K7I A;  4UP5 A;  2EQ3 A;  2I9I A;  2L6M A;  5AAS A;  2YRH A;  3LQI A;  1N36 E;  2YYR A;  1EH6 A;  1X6F A;  3ADL A;  4R2P A;  2ELZ A;  2EL5 A;  2EM0 A;  1T39 A;  4JI2 E;  1GQE A;  1ZBT A;  2EQ0 A;  4IJD A;  1WEP A;  1BOR A;  1X4I A;  1YUJ A;  2CSZ A;  3IWB A;  4X3G A;  2JVA A;  2EM6 A;  4FK5 A;  1T1H A;  1X5W A;  1WE9 A;  1X4J A;  1MGT A;  2EOY A;  3KQI A;  2EPU A;  1T38 A;  2EN3 A;  3M62 A;  4R2D A;  3GL6 A;  5AE2 A;  5KL4 A;  2EN4 A;  5CFF E;  4DKK A;  2EOD A;  3VYY A;  2C2V S;  2VPD A;  2EMF A;  4LFC E;  5B79 A;  2LJH A;  1A1L A;  1YZ9 A;  4I7C A;  2JWO A;  2YQM A;  2H0D B;  3N9M A;  3J7A G;  2UZG A;  3SOU A;  2ADR A;  5AE1 A;  2AN6 A;  2MDR A;  2NAB A;  1MM2 A;  2G7H A;  4JV5 E;  2EPO A;  2ZM6 E;  4GND A;  4LAD B;  2YRK A;  1KYQ A;  5C11 A;  2ODR C;  3KZY A;  4A49 A;  4V3K C;  2LGG A;  4TUI A;  4JI7 E;  4N4F A;  5LKU A;  3EPL A;  2A25 A;  2YPN A;  1MBM A;  2E61 A;  4QQ4 A;  4IC3 A;  2EGP A;  4A4C A;  3BBG A;  4DV3 E;  1CHC A;  4NXM E;  2EP3 A;  3EB5 A;  4JI5 E;  1BBO A;  1GZ6 A;  1PJQ A;  3QZV A;  4L5N C;  2LO3 A;  2LUQ A;  4J8Z A;  1JM7 A;  1NEI A;  2L43 A;  5H9M A;  3ZVZ B;  2JYA A;  4GNF A;  4R2R A;  1EKZ A;  3MDB C;  2QJ0 A;  4B86 C;  2RSD A;  5FEY A;  4BHC A;  4F6N A;  3L00 A;  4OGC A;  2EMC A;  2E5L E;  2ECJ A;  2RS7 A;  5FB0 A;  3U5P A;  4YBT A;  2EMA A;  3LLH A;  4NHR A;  5DNY A;  1X6H A;  3U5M A;  2EL6 A;  2YSP A;  2JOB A;  1KJK A;  3SOW A;  4YBS A;  2V89 A;  2UUA E;  2RSM A;  2CSV A;  4LKA A;  4AP4 A;  5G04 B;  5SVI A;  2EJ4 A;  3MSW A;  2L80 A;  2EE8 A;  1DQ3 A;  4DMI A;  3O7A A;  2ECI A;  3BF2 A;  3BID A;  2DRP A;  3Q1D A;  4X62 E;  2CSH A;  1WGM A;  2WBT A;  2VRD A;  2KGI A;  4LF7 E;  5KL5 A;  1SR9 A;  4HEI A;  4WXD A;  2NUG A;  3ADI A;  3SHB A;  2HJJ A;  2KHX A;  2FUU A;  5DKA A;  4MVT A;  4BC9 A;  4X9J A;  1HR0 E;  1N87 A;  3EB6 A;  2MDG A;  1A1G A;  2KFT A;  2LXH C;  2YTF A;  3N9P A;  1DCQ A;  2HDP A;  2MA5 A;  2KWJ A;  2JUN A;  1IBK E;  4M0V A;  4MLQ A;  5H1V A;  5AE3 A;  1JK2 A;  4R8O A;  1N3G A;  2M1R A;  4YC9 A;  2JRJ A;  3ZYQ A;  4BS9 A;  4OX9 E;  2MNZ A;  2ELY A;  3HTK C;  3LRQ A;  4TUG A;  1TF6 A;  1O0W A;  2EMZ A;  1ZR9 A;  5A6A A;  4IC2 A;  2UXB E;  4F52 B;  3N9L A;  2YUC A;  2UXC E;  4JI3 E;  2YZT A;  3HCS A;  2ENA A;  1HYJ A;  2EPX A;  4FIP A;  2JOX A;  2EPM X;  4AUQ B;  4P78 A;  2BBG A;  2L33 A;  3C5K A;  5G0F A;  4AQY E;  1X4U A;  2FGG A;  4R2Q A;  4JI0 E;  1T4N A;  2FUI A;  2VE7 C;  2MD8 C;  2WBS A;  3JAM C;  3FIG A;  2EML A;  4GNG A;  4JI8 E;  4O62 A;  3JUE A;  4WZ0 A;  2KRE A;  1WEM A;  3DF6 A;  2UUC E;  2ECG A;  2ODR D;  5ADZ A;  2EL4 A;  2EQ1 A;  1IQS A;  2YTE A;  3RMP A;  2EMI A;  2F8B A;  2FTX B;  5H1T A;  1WJP A;  1G2F C;  3HPS A;  1PDA A;  2LV2 A;  3O33 A;  2HC5 A;  5BR8 E;  1Z60 A;  4ZYD A;  5TAB A;  1XMQ E;  4LK9 A;  2JM3 A;  5D1L B;  1G25 A;  4WSP A;  2XB1 A;  4LF8 E;  1UHZ A;  1YYW A;  4QF3 A;  2EPN A;  3T6R A;  5B77 A;  2KKX A;  4WZ3 B;  3ZPV E;  1WIL A;  1FJG E;  2VQE E;  4LLB A;  1A1H A;  3T9K A;  3KV5 A;  2HYE D;  4AYC A;  4O64 A;  5D1M B;  5LKT A;  2EPK X;  2YTQ A;  4O5G A;  4DR4 E;  3KZZ A;  3DQV R;  5A6K A;  2RS6 A;  3ZPV 1;  5KH3 A;  2CRW A;  4O43 A;  4O4K A;  5FER A;  3PUR A;  4WYQ B;  1WEN A;  1K2F A;  4S3O B;  2DGC A;  3LQH A;  3KDE C;  2M1S A;  1X48 A;  4L8N A;  4R2A A;  4M9V C;  1IMU A;  2KE1 A;  2EM3 A;  4WSG A;  2KGG A;  4WXC A;  4WFT A;  5KL2 A;  2CT1 A;  2CKL B;  2FSA A;  5KH7 A;  2VF1 A;  5H1U A;  3MHS C;  4B3S E;  1LDK C;  2Y1N A;  1IYM A;  1PKP A;  5IXM B;  2EPC A;  2HGH A;  1L4S A;  3LQJ A;  3IHP A;  4DR7 E;  2V8Q B;  2G6Q A;  2RQL A;  4DV7 E;  3KNV A;  1EH8 A;  2EOR A;  2ECN A;  4LTY A;  2OWA A;  2YU5 A;  2EOJ A;  3HPZ A;  2VJE A;  5K3Q A;  2L2K B;  2KYU A;  3VYX A;  3J80 C;  4X65 E;  2EOQ A;  3BGH A;  2CPN A;  2ZET C;  1ZBQ A;  1TF3 A;  2K4D A;  2JP9 A;  2B0O E;  2EXU A;  4R2Y A;  3C6M A;  2L8T A;  1WXR A;  4X66 E;  2PNX A;  4A0C D;  4FO9 A;  2E6S A;  2H0D A;  2L75 A;  3MHH C;  2EN2 A;  1MM3 A;  4F2J C;  3NG2 A;  1JOC A;  4WPY A;  5KL3 A;  3FAO A;  3L1X A;  1WHQ A;  2LVH A;  5LMU E;  4N3W A;  4BCA A;  1A1I A;  2EN6 A;  2V86 A;  2MC5 A;  4WX9 A;  4Q28 A;  1JM7 B;  3IWC A;  5EYA F;  1X49 A;  2EMY A;  2DLK A;  1XWH A;  1AAY A;  2KR4 A;  3RPG B;  1PJS A;  5TSE A;  2C2L A;  3AV0 A;  2YRE A;  4LF6 E;  5TBN A;  2KWK A;  2F4V E;  3N9N A;  1YUI A;  4OGE A;  4AVX A;  2VNF A;  2CT2 A;  2M3H A;  4DV6 E;  2CSY A;  4BBY A;  2DJA A;  2EMG A;  2XOZ A;  5SVX A;  1VYX A;  2EA6 A;  2YWQ A;  4X64 E;  4YY3 E;  2YT5 A;  1UN6 B;  2XOY A;  2KWN A;  3RTR B;  4MLV A;  1QNT A;  4F6M A;  4IS1 C;  2EM9 A;  4F9C B;  3L11 A;  1TN9 A;  5SVI B;  5T6J A;  2NUF A;  2YHN A;  2MC6 A;  2BB8 A;  2VP7 A;  4GZN C;  1U6G B;  2M4I A;  2LGK A;  4I7B A;  3JTZ A;  2LTS A;  2JXP A;  2LCE A;  1LLM C;  4UP0 A;  2L3J A;  2XOC A;  3O35 A;  2RTX A;  2RPC A;  2LE2 A;  3O37 A;  5LCW B;  3JU0 A;  2LRI C;  4LFA E;  2EOF A;  4LF4 E;  5LKX A;  2DIX A;  4LJN A;  4PTB A;  2WCC 3;  4GNE A;  1UBD C;  5IT9 C;  1ZAA C;  2E1M A;  1Z1B A;  1WEQ A;  3LDY A;  4LU9 A;  2DLQ A;  2YTI A;  4X8W A;  2PRT A;  1A1J A;  2L0B A;  3THN A;  2LGL A;  1WHN A;  1XNR E;  4RHB B;  3MHS A;  2JMD A;  2YUR A;  2K1J A;  2R1F A;  2IDA A;  5LLQ A;  1YYO A;  3M99 A;  4K0K E;  2GPI A;  2M13 A;  4Q6F A;  2I50 A;  2QIC A;  3PUQ A;  2LJU A;  2MUM A;  1WEE A;  2ECV A;  3HXL A;  2V83 A;  2N8X A;  4YAD A;  3M7K A;  1E4U A;  4F9A B;  4L58 A;  2NA2 A;  3HCT A;  4R2E A; 
#chains in the Genus database with same CATH homology
 4MSX A;  5FB1 A;  1HNW E;  3F6G A;  2MNY A;  1FKA E;  2LUP B;  3HTX A;  3ASL A;  1XMO E;  2UU9 E;  4KHP E;  5TDW A;  2M85 A;  4GKJ E;  2KOU A;  3MHH A;  4XI1 A;  2BAY A;  2LMZ A;  1DI2 A;  2MA6 A;  4KZS A;  4BBQ A;  5B8D A;  2F6J A;  3T1H E;  2E6R A;  4P5O B;  3V43 A;  5LMN E;  2YQL A;  4B7Y C;  2PUY A;  3DJW A;  3OTO E;  5A2Q C;  4FJC A;  2VJF A;  1RC7 A;  4ZDT A;  1V87 A;  4JI3 E;  2F42 A;  2VPG A;  4R7E A;  5KH9 A;  2XEU A;  3U5N A;  2H36 X;  5B78 A;  2F6N A;  1I94 E;  2ECT A;  2K16 A;  5F3W A;  4QF2 A;  4ZQL A;  4WA6 A;  2B3T B;  3J81 C;  2NUE A;  5I3L A;  3C4T A;  2KU3 A;  1N34 E;  4JYA E;  5TDR A;  2IHR 1;  5G05 B;  3ZOQ B;  1IBM E;  4YAT A;  1STU A;  3H09 A;  2B7T A;  2Y1M A;  4C9Z A;  2M7Q A;  3DPL R;  4W4U A;  2MT5 A;  3M63 A;  3F6H A;  4LF5 E;  2YU4 A;  1FP0 A;  2V87 A;  1XNQ E;  5AIT A;  4JI4 E;  4M2Z A;  3AUZ A;  2VQF E;  3I2D A;  3J7Y p;  4DUY E;  1F62 A;  2CKL A;  2VJE B;  1DVP A;  3ZTG A;  2JMJ A;  2LDR A;  3N9O A;  4V3L C;  2L2M A;  2DB2 A;  2LBS B;  2KON A;  2V85 A;  4DV5 E;  4F9B B;  1QU6 A;  2MIQ A;  3T7L A;  2L92 A;  3O34 A;  3ZVY A;  3LML A;  2JY9 A;  4LFB E;  4P7D A;  2RI7 A;  2L2N A;  5FLX C;  1N33 E;  4YBM A;  2DX8 A;  1WES A;  1WEV A;  2OXQ C;  3N9Q A;  4B3M E;  4DR2 E;  4WZ2 A;  1T4O A;  3ADG A;  4DR5 E;  4NN2 A;  5DIN A;  2EWL A;  2LRS A;  4DR6 E;  4OOG C;  4PPE A;  5IWA E;  2N3H A;  4NXN E;  5TRB A;  4B3T E;  2K17 A;  4JI6 E;  4ZUX U;  2JR1 A;  2VPB A;  2DSY A;  1N32 E;  4JI1 E;  2NAA A;  2VPE A;  3VK6 A;  3L1Z B;  1VD4 A;  2QIZ A;  2Y43 A;  2G45 A;  4S3O C;  4LF9 E;  2WZO A;  4DUZ E;  1HNX E;  4R8P K;  3HQ1 A;  1FBV A;  1RMD A;  4DV4 E;  1LDJ B;  1WFK A;  3P1X A;  4DR3 E;  1IBL E;  2YHO A;  2K4V A;  2G43 A;  3O70 A;  1HNZ E;  2LTR A;  2DMY A;  3ADJ A;  4DV0 E;  4DV1 E;  4BHW A;  3C6W A;  2LN0 A;  1VFY A;  1T4L B;  2LQ6 A;  4YHH E;  4TKP B;  2FV4 B;  2YT4 A;  2ECW A;  3HCU A;  3K6Q A;  3T1Y E;  3U5O A;  1HYI A;  4GKK E;  5JG6 A;  3KV6 A;  1WEW A;  2B7V A;  3OML A;  4BC7 A;  2LXP C;  2KWO A;  4F54 A;  4CA1 A;  4DR1 E;  1ZBD B;  4B3R E;  1RQ0 A;  1YYK A;  2YSJ A;  1WEU A;  2JMI A;  2LGV A;  3O36 A;  4YAX A;  1Z2Q A;  1X47 A;  4R03 A;  3SOX A;  5LKZ A;  3RPG C;  3GV4 A;  1Z6U A;  2L5U A;  2B9D A;  2EZ6 A;  3FL2 A;  1UIL A;  2HHH E;  3C4B A;  2LV9 A;  3PHD A;  2YSM A;  2V88 A;  2UUB E;  4UI9 B;  1WEO A;  2M6M A;  4GB0 A;  4YAB A;  5C13 A;  5AIU A;  2YW8 A;  4I7D A;  2D8S A;  4I8O A;  2UXD E;  1J26 A;  5LL6 R;  5B76 A;  4L7X A;  5D1K B;  4CCG X;  1J5E E;  3ZNI A;  5J3X A;  4AYC B;  3IWD A;  2VJF B;  5B75 A;  2MD7 B;  1WIM A;  4GEQ B;  4M30 A;  2L3C A;  2KIZ A;  3KWR A;  4A4B A;  2N3G A;  4DV2 E;  4BMJ A;  4UP5 A;  2L6M A;  5AAS A;  3LQI A;  1N36 E;  2YYR A;  3ADL A;  4JI2 E;  1GQE A;  1ZBT A;  1WEP A;  1BOR A;  1X4I A;  2CSZ A;  3IWB A;  4X3G A;  2JVA A;  4FK5 A;  1T1H A;  1WE9 A;  1X4J A;  3KQI A;  3M62 A;  3GL6 A;  5AE2 A;  5CFF E;  4DKK A;  2EOD A;  3VYY A;  2C2V S;  2VPD A;  4LFC E;  5B79 A;  2LJH A;  1YZ9 A;  4I7C A;  2JWO A;  2YQM A;  2H0D B;  3N9M A;  3J7A G;  2UZG A;  3SOU A;  5AE1 A;  2AN6 A;  2MDR A;  1MM2 A;  2G7H A;  4JV5 E;  2ZM6 E;  4GND A;  4LAD B;  5C11 A;  2ODR C;  4A49 A;  4V3K C;  2LGG A;  4TUI A;  4N4F A;  5LKU A;  4IC3 A;  2EGP A;  4A4C A;  4DV3 E;  1CHC A;  4NXM E;  3EB5 A;  4JI5 E;  1GZ6 A;  3QZV A;  4L5N C;  4J8Z A;  2LUQ A;  1JM7 A;  2L43 A;  5H9M A;  3ZVZ B;  4GNF A;  1EKZ A;  2QJ0 A;  4B86 C;  2RSD A;  5FEY A;  2E5L E;  2ECJ A;  2RS7 A;  5FB0 A;  3U5P A;  4YBT A;  3LLH A;  5DNY A;  3U5M A;  2JOB A;  3SOW A;  4YBS A;  2V89 A;  2UUA E;  2RSM A;  4LKA A;  4AP4 A;  5G04 B;  3MSW A;  2L80 A;  1DQ3 A;  4DMI A;  3O7A A;  2ECI A;  4X62 E;  1WGM A;  4LF7 E;  2KGI A;  2NUG A;  3ADI A;  1SR9 A;  3SHB A;  2KHX A;  2FUU A;  5DKA A;  4MVT A;  4BC9 A;  1HR0 E;  1N87 A;  3EB6 A;  2KFT A;  2LXH C;  3N9P A;  2HDP A;  2MA5 A;  2KWJ A;  1IBK E;  4M0V A;  5AE3 A;  5H1V A;  4R8O A;  2M1R A;  4YC9 A;  2JRJ A;  3ZYQ A;  4BS9 A;  4OX9 E;  2MNZ A;  3HTK C;  3LRQ A;  4TUG A;  1O0W A;  2UXB E;  4IC2 A;  4F52 B;  3N9L A;  2YUC A;  2UXC E;  2YZT A;  3HCS A;  1HYJ A;  4FIP A;  2JOX A;  4P78 A;  4AUQ B;  2L33 A;  3C5K A;  5G0F A;  4AQY E;  1X4U A;  2FGG A;  4JI0 E;  1T4N A;  2FUI A;  2VE7 C;  2MD8 C;  3JAM C;  3FIG A;  4GNG A;  4JI8 E;  4WZ0 A;  2KRE A;  1WEM A;  3DF6 A;  2UUC E;  2ECG A;  2ODR D;  5ADZ A;  3RMP A;  2F8B A;  2FTX B;  5H1T A;  3HPS A;  5BR8 E;  3O33 A;  1Z60 A;  5TAB A;  1XMQ E;  4LK9 A;  5D1L B;  1G25 A;  4WSP A;  4LF8 E;  2XB1 A;  1YYW A;  1UHZ A;  4QF3 A;  3T6R A;  5B77 A;  4WZ3 B;  3ZPV E;  1WIL A;  1FJG E;  2VQE E;  4LLB A;  3KV5 A;  2HYE D;  4AYC A;  4O64 A;  5D1M B;  5LKT A;  4DR4 E;  3DQV R;  2RS6 A;  3ZPV 1;  5KH3 A;  5FER A;  3PUR A;  4WYQ B;  1WEN A;  1K2F A;  4S3O B;  3LQH A;  2M1S A;  1X48 A;  4L8N A;  2KE1 A;  2KGG A;  4WFT A;  2CKL B;  2FSA A;  5KH7 A;  2VF1 A;  5H1U A;  4B3S E;  1LDK C;  2Y1N A;  1IYM A;  1PKP A;  3LQJ A;  3IHP A;  4DR7 E;  2V8Q B;  2G6Q A;  4DV7 E;  3KNV A;  2ECN A;  4LTY A;  3HPZ A;  2VJE A;  2L2K B;  2KYU A;  3VYX A;  3J80 C;  4X65 E;  2CPN A;  2ZET C;  1ZBQ A;  2K4D A;  4R2Y A;  2L8T A;  1WXR A;  4X66 E;  2PNX A;  4A0C D;  2E6S A;  2H0D A;  4FO9 A;  2L75 A;  1MM3 A;  3NG2 A;  1JOC A;  4WPY A;  3L1X A;  1WHQ A;  5LMU E;  4N3W A;  4BCA A;  2V86 A;  2MC5 A;  4Q28 A;  1JM7 B;  3IWC A;  5EYA F;  1X49 A;  1XWH A;  2KR4 A;  3RPG B;  2C2L A;  3AV0 A;  2YRE A;  4LF6 E;  5TBN A;  2KWK A;  2F4V E;  3N9N A;  4AVX A;  2VNF A;  2CT2 A;  2M3H A;  4DV6 E;  2CSY A;  4BBY A;  1VYX A;  2EA6 A;  4X64 E;  4YY3 E;  2YT5 A;  2KWN A;  3RTR B;  4F9C B;  3L11 A;  5T6J A;  2NUF A;  2YHN A;  2MC6 A;  2VP7 A;  1U6G B;  2M4I A;  2LGK A;  4I7B A;  3JTZ A;  2LTS A;  4UP0 A;  2L3J A;  3O35 A;  2RTX A;  2LE2 A;  3O37 A;  5LCW B;  3JU0 A;  2LRI C;  4LFA E;  4LF4 E;  5LKX A;  2DIX A;  4LJN A;  4PTB A;  4GNE A;  5IT9 C;  2E1M A;  1WEQ A;  4LU9 A;  4X8W A;  2L0B A;  1XNR E;  2LGL A;  1WHN A;  3MHS A;  2JMD A;  2YUR A;  2K1J A;  2IDA A;  1YYO A;  3M99 A;  4K0K E;  4Q6F A;  2I50 A;  2QIC A;  3PUQ A;  2MUM A;  1WEE A;  2ECV A;  3HXL A;  2V83 A;  4YAD A;  1E4U A;  4F9A B;  4L58 A;  2NA2 A;  3HCT A;  4JI7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...