3VK6A

Crystal structure of a phosphotyrosine binding domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
b'VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase Hakai
publication title Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 20
structure length 96
sequence length 96
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18408 zf_Hakai C2H2 Hakai zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3vk6A01
3.30.160.640 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vk6A02
5LCWB 2AN6A 5H1TA 3IHPA 3O7AA 2LN0A 4MVTA 2H0DB 4GB0A 3M63A 4WA6A 4P5OB 2KWNA 5B79A 2LGGA 2QICA 2F6NA 5LKZA 1LDKC 1DVPA 4YBMA 4R2YA 2YT5A 4L7XA 3SOXA 1K2FA 3HTKC 4ZDTA 4AYCB 2IDAA 3DPLR 3SOUA 2LGLA 2HYED 2ECTA 2VP7A 5AITA 4UP0A 2MA5A 1LDJB 2G43A 2YU4A 3DQVR 4A0CD 1WEMA 3O70A 2K16A 1F62A 3O37A 4A4BA 1N87A 5B76A 1WIMA 2CSYA 2F6JA 4GNFA 1X4JA 5D1KB 2I50A 2L75A 1MM2A 4I7CA 2XB1A 3M99A 4IC3A 2QJ0A 1JOCA 2MD8C 1X4UA 2VPEA 2JRJA 2PNXA 2Y1MA 5H1UA 2LXPC 3HCUA 2YW8A 2VJEB 4AVXA 5C11A 3O34A 3RTRB 4IC2A 4QF2A 2MNYA 1VD4A 4WZ2A 3O36A 5EYAF 1VFYA 4YAXA 4C9ZA 1G25A 1FP0A 3ZVZB 2KGIA 2G6QA 2LQ6A 4A49A 5TRBA 3ZVYA 4R8PK 4MSXA 3FL2A 2ECGA 4I7BA 2RSDA 1WEPA 1WFKA 4PTBA 1IYMA 5C13A 4CA1A 2KGGA 3GL6A 2ECIA 3C6WA 2CKLA 1WGMA 4FK5A 3I2DA 1WEOA 2KE1A 3U5PA 4YC9A 2KR4A 5B77A 1HYJA 5FB0A 2MT5A 2MD7B 2NAAA 4YBSA 3LQJA 5G05B 5DINA 1HYIA 4TKPB 2QIZA 1ZBDB 3GV4A 5H1VA 2VJFB 5LKTA 3KQIA 4V3LC 2LGKA 1XWHA 5LKXA 3U5NA 4B86C 5TDRA 3PUQA 5H9MA 3PURA 3MHHA 4N4FA 4WZ0A 2VPGA 4B7YC 2KWKA 3VK6A 2LXHC 4FIPA 1Z2QA 1WEVA 2C2LA 5I3LA 1WENA 3RPGB 3RPGC 4R7EA 2KU3A 2YUCA 5FB1A 3HCTA 3EB5A 2K4DA 1WEQA 2CSZA 2MA6A 5TBNA 2CKLB 3SHBA 2H0DA 5DKAA 4UP5A 1BORA 2KWJA 2LGVA 2FSAA 1JM7A 4LLBA 5D1MB 3U5MA 1WE9A 1MM3A 1Z6UA 3M62A 2FUUA 4BBQA 3N9MA 2K1JA 4W4UA 4CCGX 4YADA 2JMIA 5FEYA 2YSJA 3SOWA 4BHWA 5B75A 2BAYA 1RMDA 4AYCA 3PHDA 2ECVA 4S3OB 4S3OC 2EODA 5KH9A 4LKAA 5LKUA 4LK9A 5JG6A 2MNZA 2YHOA 3EB6A 5B8DA 4GNGA 3N9OA 4L58A 2XEUA 2YQMA 3N9NA 2KYUA 2K17A 5G04B 2ZETC 4YABA 4A4CA 5B78A 4GNDA 3KV6A 2VPDA 2YURA 3MHSA 5TDWA 2PUYA 2L43A 3HCSA 2Y1NA 3O35A 2EGPA 4GNEA 1WEUA 2VPBA 1X4IA 4NN2A 3L11A 3QZVA 3ZPV1 4QF3A 4ZQLA 2CT2A 4ZUXU 1JM7B 2M3HA 3LQHA 1V87A 2ECNA 4O64A 1U6GB 1WESA 1E4UA 2LRIC 3O33A 4Q6FA 2YSMA 4LADB 2ECWA 4YBTA 4UI9B 1WILA 3ASLA 3C5KA 2JMJA 3LQIA 4V3KC 2LV9A 3N9PA 5KH3A 2EA6A 2KFTA 3KV5A 4N3WA 5FERA 4I7DA 2E6SA 4X3GA 4XI1A 2Y43A 2L0BA 2D8SA 5D1LB 2C2VS 3N9LA 2E6RA 3NG2A 3T6RA 1Z60A 3N9QA 3ZYQA 3L1XA 3KNVA 5KH7A 2HDPA 3ZNIA 3L1ZB 2G45A 1VYXA 2ECJA 1WEEA 4AP4A 2KWOA 4YATA 2VJFA 5G0FA 5TABA 3V43A 2F42A 4WZ3B 2DX8A 2M1RA 2L5UA 2M6MA 5J3XA 1T1HA 2M85A 2KREA 2YHNA 2OXQC 2JMDA 2YQLA 4LJNA 4PPEA 2MUMA 2YREA 3LRQA 4FO9A 1FBVA 2YYRA 4AUQB 3U5OA 2VNFA 2MIQA 2FUIA 4F52B 1WEWA 3T7LA 2KIZA 3ZPVE 2LDRA 3ZTGA 2L80A 2UZGA 5AIUA 4FJCA 2RI7A 2VJEA 1CHCA
chains in the Genus database with same CATH superfamily
2E5LE 1YYKA 3LVQE 4KZSA 4BC9A 3J7Yp 5LCWB 2AN6A 1N34E 5H1TA 3IHPA 3O7AA 2NUEA 2LN0A 4MVTA 2H0DB 1PDAA 4GB0A 2EOEA 2IHR1 4GEQB 2K4VA 2WBTA 4R2CA 1X47A 4YHHE 2LJUA 2LO3A 1YYOA 3FANA 2YTFA 1MBMA 4JI2E 3M63A 4WA6A 4P5OB 2KWNA 5IXMB 2N8XA 5B79A 4R8OA 5ADZA 2LGGA 1EH7A 1N3GA 4LF9E 2QICA 3LVRE 2F6NA 5LKZA 1LDKC 2UUCE 1DVPA 2RR4A 4BS9A 2EMCA 4YBMA 4R2YA 1GZ6A 2B9DA 3RMPA 5SVYA 2FD4A 2YT5A 4WSGA 3THNA 2DJAA 4DKKA 1IBLE 4L7XA 3SOXA 1K2FA 3HTKC 2EMXA 5IV8B 4ZDTA 3OMLA 5A6AA 3HXLA 4MLVA 2ODRD 1ZR9A 4LF6E 2M13A 2LJHA 4AYCB 3H7HA 2IDAA 2XP0A 3DPLR 2KOUA 2RSMA 2JPAA 2LVHA 5SVIB 3SOUA 2LGLA 2HYED 4ZYGA 2R76A 1YFHA 3IWBA 4R2AA 1EKZA 2ECTA 2VP7A 5AITA 4BHCA 1AAYA 4UP0A 2RPCA 5AASA 2MA5A 2MC6A 1LDJB 2G43A 2YU4A 3DQVR 4A0CD 1WEMA 2YZTA 2XOYA 3O70A 2JOBA 2K16A 1F62A 3O37A 2M1SA 4A4BA 1AH5A 1N87A 2FFWA 5B76A 1WIMA 2CSYA 2F6JA 2V89A 2H36X 4GNFA 4DV4E 2L7PA 4NXNE 1X4JA 2ELZA 5D1KB 4R2PA 2DRPA 4JI5E 2I50A 1XMQE 2JVAA 1WXRA 4O24A 1EH6A 2L75A 2ZM6E 5A6KA 1MM2A 4I7CA 2HC5A 2ELYA 4M0VA 1G2DC 2XB1A 4DV7E 2EE8A 2JOXA 3HPZA 3MHSC 1XMOE 3M99A 4IC3A 5A2QC 4B3SE 2UXDE 2QJ0A 1JOCA 2MD8C 4GKJE 1X4UA 2VPEA 1A1HA 2JRJA 2ENHA 2L2MA 3ZOQB 4IJDA 1BB8A 2PNXA 3C4TA 4WYQB 4GKKE 2Y1MA 5H1UA 2LXPC 3HCUA 2EPCA 2YRHA 4RH8A 2MKDA 2YW8A 2I13A 4B3TE 3C6MA 1X3CA 2VJEB 4OOGC 2RS7A 1HNXE 4AVXA 3MSWA 1P47A 5C11A 2M9AA 1SR9A 3O34A 2L92A 5A6BD 2UU9E 4F9CB 2EN6A 3RTRB 2FGGA 4IC2A 4QF2A 2MNYA 3EPLA 1VD4A 2CRWA 2KKXA 4WZ2A 3O36A 2EMGA 2EJ4A 5EYAF 1VFYA 5KL6A 4WFTA 3KZYA 4YAXA 4C9ZA 1G25A 4LTYA 2EM2A 5LLQA 2YTJA 2YTGA 2LV2A 4BBYA 1FP0A 3J80C 3ZVZB 5KL2A 2KGIA 2G6QA 1IBKE 2LQ6A 1T4NA 4A49A 5BR8E 5TRBA 3ZVYA 2DMIA 2MKNA 5LMNE 4R8PK 4WXCA 3VYXA 4MSXA 3QG5C 3FL2A 3JAMC 2ECGA 4I7BA 1F2IG 2EPLX 3F6GA 2L2NA 2VQEE 2V8QB 2RSDA 2CSHA 1N33E 1WEPA 1WFKA 2ENCA 3MDBC 2WBUA 1BBOA 4JI4E 2JR1A 4OX9E 2EN4A 4PTBA 1IYMA 2B7TA 5C13A 4CA1A 2BB8A 2EN8A 2UUBE 4R2RA 2KGGA 4DMIA 1PJTA 4F6MA 1ZAAC 1ZU1A 1PKPA 1N32E 1NCSA 3FJUB 3GL6A 2ECIA 3C6WA 3KWRA 2J7JA 2CKLA 2EMWA 5SVXA 1WGMA 2D9HA 2EOSA 2EOMA 4X62E 4LFBE 4FK5A 3I2DA 1WEOA 2NABA 2EOIA 2KE1A 3U5PA 2DSYA 1N36E 3JU0A 4DR4E 4YC9A 2KR4A 2EPPA 1IQOA 4R03A 5AE2A 5B77A 2VF1A 1HYJA 3OTOE 5FB0A 2MT5A 2MD7B 2EL5A 4DV2E 2NAAA 5AC4A 4YBSA 4X65E 2WBSA 4DR5E 2EN1A 3EPJA 1HNWE 3J81C 2EOHA 2YTDA 2XOCA 4DV3E 3LQJA 5G05B 5TSEA 2EOFA 4NZVA 5DINA 2EMIA 1HYIA 2EOQA 2EM5A 3T1HE 4TKPB 5AE1A 4N4RB 2CONA 2QIZA 1ZBDB 3GV4A 4BHBA 1FKAE 5H1VA 2VJFB 3M99B 2LTRA 5LKTA 3KQIA 2EWLA 2YU8A 2L3JA 4M2ZA 3LJUX 3O47A 3DF6A 1X48A 1PJQA 2EMLA 1JK1A 2CT1A 1ZBTA 2EM8A 1QNTA 4V3LC 4L5NC 1LLMC 2RQLA 2LGKA 1XWHA 5LKXA 4TUIA 3U5NA 4B86C 2LRSA 5TDRA 2MC5A 3ADGA 2IQJA 3AUZA 2RS6A 1I94E 4O62A 2K7IA 1RC7A 1UILA 1SFEA 5F3WA 2JUNA 3PUQA 2JY9A 1T4LB 5H9MA 3PURA 4R2SA 1Z1BA 3JUEA 3VHTB 2D8UA 2EN3A 3MHHA 2EPRA 1WJPA 4N4FA 4P7DA 2WCC3 4LF5E 2EOYA 4WSPA 4WZ0A 2VPGA 4B7YC 2DSMA 2KWKA 3VK6A 2LXHC 1NEIA 4X8WA 4WPYA 3P1XA 4DR1E 4FIPA 3BBGA 2VQFE 1Z2QA 1WEVA 2C2LA 3ADLA 3M7KA 4X64E 1YPNA 2JWOA 5I3LA 4DV6E 2EOJA 1WENA 3RPGB 4MLQA 3RPGC 4LFCE 2CTDA 2E61A 4NHRA 3FAOA 5KL7A 3TQMA 4R7EA 4R2EA 2KU3A 2YUCA 5FB1A 3HCTA 2LCEA 2YTIA 4JI3E 4QQ4A 3EB5A 3THOB 1UN6B 3L00A 2EN2A 1MGTA 2K4DA 1WEQA 2CSZA 4JYAE 2MA6A 2A25A 3Q1DA 2CKLB 5TBNA 4ZYDA 3SHBA 2UXCE 2H0DA 4OGCA 5DKAA 2LUPB 4UP5A 1BORA 2KWJA 2LGVA 2WZOA 2FSAA 1JM7A 3IWDA 4LLBA 5D1MB 3U5MA 2EMKA 1ZBQA 1WE9A 1J5EE 1MM3A 1Z6UA 3M62A 4DR7E 2MKEA 2YTEA 2EMBA 3LLHA 2FUUA 2NUFA 1EH8A 4BBQA 2EORA 1A1GA 3N9MA 2K1JA 2YWQA 2B7VA 4W4UA 2L33A 4DV1E 4DR6E 3C4BA 3KDEC 2JYAA 3ADJA 2EMHA 5A6BA 2N3HA 5DNYA 2L2KB 4CCGX 4YADA 2JMIA 2YTPA 5FEYA 2EPAA 2EPUA 2YTOA 2HJJA 2EMAA 2L8TA 2YSJA 1IQSA 1QU6A 3SOWA 2YSOA 2LT7A 2EZ6A 2DB2A 4BHWA 4BC7A 2B0OE 2I9IA 2EM0A 5B75A 2BAYA 1T4OA 5FLXC 1RMDA 4AYCA 3PHDA 2ECVA 2LAUA 5SVIA 1A1IA 2YRKA 2NA2A 4S3OB 2L6MA 4S3OC 1O0WA 2EODA 3K6QA 5LL6R 2G7HA 5KH9A 2HHHE 4LKAA 5LKUA 4TUGA 3ECRA 4LK9A 5JG6A 3EQ1A 4DV5E 4GZNC 2MNZA 1G2FC 2GPIA 2MDGA 2YHOA 4O43A 4AQYE 3EB6A 2M4IA 2L3CA 5B8DA 2DIXA 3VYYA 4K0KE 4GNGA 4O5GA 3N9OA 4L58A 2E72A 2XEUA 2YQMA 3N9NA 1WHQA 3MHHC 2YPNA 4M30A 2EGMA 2ODRC 2KYUA 2K17A 5G04B 1DQ3A 2ZETC 3DDTA 2DLKA 2B3TB 4I8OA 4YABA 4BCAA 4A4CA 5B78A 4GNDA 3KV6A 4DR2E 2EPXA 2VPDA 2LUQA 3UK3C 1DGCA 1X5WA 1YYWA 4F6NA 2YURA 3MHSA 2V87A 5TDWA 2HGHA 3DWDA 2LBSB 2EQ1A 4P78A 4Q28A 3PLWA 2LTSA 2EM7A 3J7AG 2UXBE 3KZZA 3FEHA 2PUYA 2L43A 4IS1C 1X6FA 3HCSA 2EP3A 2Y1NA 3O35A 1GQEA 2V86A 1HNZE 2EGPA 3FIGA 4GNEA 1WEUA 1YSAC 2EPKX 5KL5A 2VPBA 1X4IA 4NN2A 2EMYA 4LF4E 3L11A 2YRMA 3QZVA 3ZPV1 1YZ9A 5IWAE 4BMJA 1WRJA 4QF3A 4ZQLA 4ZYEA 4LFAE 1STUA 3T9KA 4LF8E 2CT2A 5CFFE 1XNQE 2KKYA 4ZUXU 1JM7B 5IT9C 5K3QA 2M3HA 1A1JA 1KJKA 3LQHA 2EOXA 2KHXA 1FJGE 2F4VE 1V87A 4WXDA 1DI2A 2EL4A 2ECNA 4O64A 4OGEA 2EPZA 5AC5A 1U6GB 1WESA 2MDRA 2V85A 3LDYA 4JI7E 1DCQA 4LF7E 1E4UA 2LRIC 3HTXA 3O33A 2CRRA 4Q6FA 2CSVA 2EMZA 5AE3A 2YSMA 4LADB 2CPNA 2ECWA 4Z0RA 4YBTA 4UI9B 2EMFA 5LMUE 2JP9A 1WILA 3ASLA 3C5KA 2JMJA 3LQIA 4V3KC 2LV9A 2FV4B 1T38A 3N9PA 3FM8C 2GLIA 3EPHA 1X6HA 5KL4A 5KH3A 2EA6A 2KFTA 3KV5A 4N3WA 3C6KA 2ADRA 2EOZA 5FERA 3H09A 1IMUA 4WX9A 4KWYA 4I7DA 4RHBB 2LMZA 2E6SA 1JK2A 4X3GA 4XI1A 2YTQA 2Y43A 1X49A 2L0BA 1A1FA 2D8SA 2M7QA 4JI1E 4R2QA 2P57A 4H9DA 5D1LB 2EL6A 2EPMX 2C2VS 3N9LA 2E6RA 2PRTA 3NG2A 3T6RA 1B69A 4JI6E 4J8ZA 1Z60A 3N9QA 2LE2A 4DV0E 3ZYQA 2EPOA 1A1LA 3L1XA 2YVRA 3KNVA 4YY3E 3JTZA 4FK5C 5KH7A 2HDPA 2YT4A 3ZNIA 3L1ZB 1GTKA 2G45A 2N3GA 1VYXA 1KYQA 2ECJA 4F1PA 1WEEA 2VRDA 4AP4A 1L4SA 3E2DA 4F9AB 4Q35B 2EOOA 2YSPA 4DUZE 2KWOA 4YATA 2VJFA 4DUYE 1YUIA 4ZYHA 5G0FA 2GHFA 5TABA 3V43A 3AV0A 2OWAA 2Q8UA 2ENAA 1MEYC 2KONA 4R2DA 3HQ1A 4X66E 2F42A 4WZ3B 2DX8A 2EQ3A 2UUAE 5A6JA 3F6HA 3BIDA 1X6EA 2M1RA 2DGCA 3ADIA 2V83A 4L8NA 2L5UA 2M6MA 5J3XA 1UBDC 1TN9A 3LMLA 1T1HA 4NXME 4JI0E 4JI8E 4DR3E 2M85A 1PJSA 2KREA 2YHNA 3BF2A 1YUJA 2FTXB 3IWCA 2OXQC 3EPKA 2JMDA 2YQLA 4O4KA 4LJNA 1A1KA 2NUGA 4F9BB 4HEIA 4PPEA 2MUMA 2YREA 2DMYA 3LRQA 3T1YE 2RTXA 4FO9A 1BBGA 2EM4A 2RSIA 1T39A 4JV5E 4LU9A 2YTNA 3DJWA 2DLQA 4M9VC 1TF3A 2E1MA 1FBVA 2JM3A 3BGHA 4KHPE 2YU5A 5A69A 4F54A 2YYRA 4AUQB 3U5OA 2VNFA 2MIQA 2XOZA 1XNRE 4F2JC 2FUIA 1J26A 1WHNA 2F8BA 2JXPA 1HR0E 2EM3A 2V88A 1UHZA 2EQ0A 4X9JA 5KL3A 4F52B 2VE7C 3HPSA 3SUBA 1RQ0A 1WEWA 3T7LA 1IBME 2EM9A 2KIZA 2BBGA 2EN7A 3ZPVE 2LDRA 3ZTGA 5T6JA 4B3ME 4HTGA 2L80A 2UZGA 4B3RE 5AIUA 2EPNA 4FJCA 2RI7A 2R1FA 2EM6A 1TF6A 2VJEA 1CHCA 4Z0OA 2EXUA
chains in the Genus database with same CATH topology
2E5LE 1YYKA 4KZSA 4BC9A 3J7Yp 5LCWB 2AN6A 1N34E 5H1TA 3IHPA 3O7AA 2NUEA 2LN0A 4MVTA 2H0DB 4GB0A 2IHR1 4GEQB 2K4VA 1X47A 4YHHE 1YYOA 4JI2E 3M63A 4WA6A 4P5OB 2KWNA 5B79A 4R8OA 5ADZA 2LGGA 4LF9E 2QICA 2F6NA 5LKZA 1LDKC 2UUCE 1DVPA 4BS9A 4YBMA 4R2YA 1GZ6A 2B9DA 3RMPA 2YT5A 4DKKA 1IBLE 4L7XA 3SOXA 1K2FA 3HTKC 4ZDTA 3OMLA 3HXLA 2ODRD 4LF6E 2LJHA 4AYCB 2IDAA 3DPLR 2KOUA 2RSMA 3SOUA 2LGLA 2HYED 3IWBA 1EKZA 2ECTA 2VP7A 5AITA 4UP0A 5AASA 2MA5A 2MC6A 1LDJB 2G43A 2YU4A 3DQVR 4A0CD 1WEMA 2YZTA 3O70A 2JOBA 2K16A 1F62A 3O37A 2M1SA 4A4BA 1N87A 5B76A 1WIMA 2CSYA 2F6JA 2V89A 2H36X 4GNFA 4DV4E 4NXNE 1X4JA 5D1KB 4JI5E 2I50A 1XMQE 2JVAA 1WXRA 2ZM6E 2L75A 1MM2A 4I7CA 4M0VA 2XB1A 4DV7E 3HPZA 2JOXA 1XMOE 3M99A 4IC3A 5A2QC 4B3SE 2UXDE 2QJ0A 1JOCA 2MD8C 4GKJE 1X4UA 2VPEA 2JRJA 2L2MA 3ZOQB 2PNXA 3C4TA 4WYQB 4GKKE 2Y1MA 5H1UA 2LXPC 3HCUA 2YW8A 4B3TE 1HNXE 2VJEB 4OOGC 2RS7A 4AVXA 3MSWA 5C11A 1SR9A 3O34A 2L92A 2UU9E 4F9CB 3RTRB 2FGGA 4IC2A 4QF2A 2MNYA 1VD4A 4WZ2A 3O36A 5EYAF 1VFYA 4WFTA 4LTYA 4YAXA 4C9ZA 1G25A 3J80C 4BBYA 1FP0A 3ZVZB 2KGIA 2G6QA 1IBKE 2LQ6A 1T4NA 4A49A 5BR8E 5TRBA 3ZVYA 5LMNE 4R8PK 3VYXA 4MSXA 3FL2A 3JAMC 2ECGA 4I7BA 3F6GA 2L2NA 2VQEE 2V8QB 2RSDA 1N33E 1WEPA 1WFKA 4JI4E 2JR1A 4OX9E 4PTBA 1IYMA 2B7TA 5C13A 4CA1A 2UUBE 2KGGA 4DMIA 1PKPA 1N32E 3GL6A 2ECIA 3C6WA 3KWRA 2CKLA 1WGMA 4X62E 4LFBE 4FK5A 3I2DA 1WEOA 2KE1A 3U5PA 2DSYA 1N36E 3JU0A 4DR4E 4YC9A 2KR4A 4R03A 5AE2A 5B77A 2VF1A 1HYJA 3OTOE 5FB0A 2MT5A 2MD7B 4DV2E 2NAAA 4YBSA 4X65E 4DR5E 1HNWE 3J81C 4DV3E 3LQJA 5G05B 5DINA 1HYIA 3T1HE 4TKPB 5AE1A 2QIZA 1ZBDB 3GV4A 1FKAE 5H1VA 2VJFB 2LTRA 5LKTA 3KQIA 2EWLA 2L3JA 4M2ZA 3DF6A 1X48A 1ZBTA 4V3LC 4L5NC 2LGKA 1XWHA 5LKXA 4TUIA 3U5NA 4B86C 2LRSA 5TDRA 2MC5A 3ADGA 3AUZA 2RS6A 1I94E 1RC7A 1UILA 5F3WA 3PUQA 2JY9A 1T4LB 5H9MA 3PURA 3MHHA 4N4FA 4P7DA 4LF5E 4WSPA 4WZ0A 2VPGA 4B7YC 2KWKA 3VK6A 2LXHC 4X8WA 4WPYA 3P1XA 4DR1E 4FIPA 2VQFE 1Z2QA 1WEVA 2C2LA 3ADLA 4X64E 2JWOA 5I3LA 4DV6E 1WENA 3RPGB 4LFCE 3RPGC 4R7EA 2KU3A 2YUCA 5FB1A 3HCTA 4JI3E 3EB5A 2K4DA 1WEQA 2CSZA 4JYAE 2MA6A 5TBNA 2CKLB 3SHBA 2UXCE 2H0DA 5DKAA 2LUPB 4UP5A 1BORA 2KWJA 2LGVA 2WZOA 2FSAA 1JM7A 3IWDA 4LLBA 5D1MB 3U5MA 1ZBQA 1WE9A 1J5EE 1MM3A 1Z6UA 3M62A 4DR7E 3LLHA 2FUUA 2NUFA 4BBQA 3N9MA 2K1JA 2B7VA 4W4UA 2L33A 4DV1E 4DR6E 3C4BA 3ADJA 2N3HA 5DNYA 2L2KB 4CCGX 4YADA 2JMIA 5FEYA 2L8TA 2YSJA 1QU6A 3SOWA 2EZ6A 2DB2A 4BHWA 4BC7A 5B75A 2BAYA 1T4OA 5FLXC 1RMDA 4AYCA 3PHDA 2ECVA 2NA2A 4S3OB 2L6MA 4S3OC 1O0WA 2EODA 3K6QA 5LL6R 2G7HA 5KH9A 2HHHE 4LKAA 5LKUA 4TUGA 4LK9A 5JG6A 4DV5E 2MNZA 2YHOA 4AQYE 3EB6A 2M4IA 2L3CA 5B8DA 2DIXA 3VYYA 4K0KE 4GNGA 3N9OA 4L58A 2XEUA 2YQMA 3N9NA 1WHQA 4M30A 2ODRC 2KYUA 2K17A 5G04B 1DQ3A 2ZETC 2B3TB 4I8OA 4YABA 4BCAA 4A4CA 5B78A 4GNDA 3KV6A 4DR2E 2VPDA 2LUQA 1YYWA 2YURA 3MHSA 2V87A 5TDWA 2LBSB 4P78A 4Q28A 2LTSA 3J7AG 2UXBE 2PUYA 2L43A 3HCSA 2Y1NA 3O35A 1GQEA 2V86A 1HNZE 2EGPA 3FIGA 4GNEA 1WEUA 2VPBA 1X4IA 4NN2A 4LF4E 3L11A 3QZVA 3ZPV1 1YZ9A 5IWAE 4BMJA 4QF3A 4ZQLA 4LFAE 1STUA 4LF8E 2CT2A 5CFFE 1XNQE 4ZUXU 1JM7B 5IT9C 2M3HA 3LQHA 1DI2A 2KHXA 1FJGE 2F4VE 1V87A 2ECNA 4O64A 1U6GB 1WESA 2MDRA 2V85A 4JI7E 4LF7E 1E4UA 2LRIC 3HTXA 3O33A 4Q6FA 5AE3A 2YSMA 4LADB 2CPNA 2ECWA 4YBTA 4UI9B 5LMUE 1WILA 3ASLA 3C5KA 2JMJA 3LQIA 4V3KC 2LV9A 2FV4B 3N9PA 5KH3A 2EA6A 2KFTA 3KV5A 4N3WA 5FERA 3H09A 4I7DA 2LMZA 2E6SA 4X3GA 4XI1A 2Y43A 1X49A 2L0BA 2D8SA 2M7QA 4JI1E 5D1LB 2C2VS 3N9LA 2E6RA 3NG2A 3T6RA 4JI6E 4J8ZA 1Z60A 3N9QA 2LE2A 4DV0E 3ZYQA 3L1XA 4YY3E 3KNVA 3JTZA 5KH7A 2HDPA 2YT4A 3ZNIA 3L1ZB 2G45A 2N3GA 1VYXA 2ECJA 1WEEA 4AP4A 4F9AB 4DUZE 2KWOA 4YATA 2VJFA 4DUYE 5G0FA 5TABA 3V43A 3AV0A 2KONA 3HQ1A 4X66E 2F42A 4WZ3B 2DX8A 2UUAE 3F6HA 2M1RA 3ADIA 2V83A 4L8NA 2L5UA 2M6MA 5J3XA 3LMLA 1T1HA 4NXME 4JI0E 4JI8E 4DR3E 2M85A 2KREA 2YHNA 2FTXB 3IWCA 2OXQC 2JMDA 2YQLA 4LJNA 2NUGA 4F9BB 4PPEA 2MUMA 2YREA 2DMYA 3LRQA 3T1YE 2RTXA 4FO9A 4JV5E 4LU9A 3DJWA 2E1MA 1FBVA 4KHPE 4F54A 2YYRA 4AUQB 3U5OA 2VNFA 2MIQA 1XNRE 2FUIA 1J26A 1WHNA 2F8BA 1HR0E 2V88A 1UHZA 4F52B 2VE7C 3HPSA 1RQ0A 1WEWA 3T7LA 1IBME 2KIZA 3ZPVE 2LDRA 3ZTGA 5T6JA 4B3ME 2L80A 2UZGA 4B3RE 5AIUA 4FJCA 2RI7A 2VJEA 1CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCW B;  2AN6 A;  5H1T A;  3IHP A;  3O7A A;  2LN0 A;  4MVT A;  2H0D B;  4GB0 A;  3M63 A;  4WA6 A;  4P5O B;  2KWN A;  5B79 A;  2LGG A;  2QIC A;  2F6N A;  5LKZ A;  1LDK C;  1DVP A;  4YBM A;  4R2Y A;  2YT5 A;  4L7X A;  3SOX A;  1K2F A;  3HTK C;  4ZDT A;  4AYC B;  2IDA A;  3DPL R;  3SOU A;  2LGL A;  2HYE D;  2ECT A;  2VP7 A;  5AIT A;  4UP0 A;  2MA5 A;  1LDJ B;  2G43 A;  2YU4 A;  3DQV R;  4A0C D;  1WEM A;  3O70 A;  2K16 A;  1F62 A;  3O37 A;  4A4B A;  1N87 A;  5B76 A;  1WIM A;  2CSY A;  2F6J A;  4GNF A;  1X4J A;  5D1K B;  2I50 A;  2L75 A;  1MM2 A;  4I7C A;  2XB1 A;  3M99 A;  4IC3 A;  2QJ0 A;  1JOC A;  2MD8 C;  1X4U A;  2VPE A;  2JRJ A;  2PNX A;  2Y1M A;  5H1U A;  2LXP C;  3HCU A;  2YW8 A;  2VJE B;  4AVX A;  5C11 A;  3O34 A;  3RTR B;  4IC2 A;  4QF2 A;  2MNY A;  1VD4 A;  4WZ2 A;  3O36 A;  5EYA F;  1VFY A;  4YAX A;  4C9Z A;  1G25 A;  1FP0 A;  3ZVZ B;  2KGI A;  2G6Q A;  2LQ6 A;  4A49 A;  5TRB A;  3ZVY A;  4R8P K;  4MSX A;  3FL2 A;  2ECG A;  4I7B A;  2RSD A;  1WEP A;  1WFK A;  4PTB A;  1IYM A;  5C13 A;  4CA1 A;  2KGG A;  3GL6 A;  2ECI A;  3C6W A;  2CKL A;  1WGM A;  4FK5 A;  3I2D A;  1WEO A;  2KE1 A;  3U5P A;  4YC9 A;  2KR4 A;  5B77 A;  1HYJ A;  5FB0 A;  2MT5 A;  2MD7 B;  2NAA A;  4YBS A;  3LQJ A;  5G05 B;  5DIN A;  1HYI A;  4TKP B;  2QIZ A;  1ZBD B;  3GV4 A;  5H1V A;  2VJF B;  5LKT A;  3KQI A;  4V3L C;  2LGK A;  1XWH A;  5LKX A;  3U5N A;  4B86 C;  5TDR A;  3PUQ A;  5H9M A;  3PUR A;  3MHH A;  4N4F A;  4WZ0 A;  2VPG A;  4B7Y C;  2KWK A;  3VK6 A;  2LXH C;  4FIP A;  1Z2Q A;  1WEV A;  2C2L A;  5I3L A;  1WEN A;  3RPG B;  3RPG C;  4R7E A;  2KU3 A;  2YUC A;  5FB1 A;  3HCT A;  3EB5 A;  2K4D A;  1WEQ A;  2CSZ A;  2MA6 A;  5TBN A;  2CKL B;  3SHB A;  2H0D A;  5DKA A;  4UP5 A;  1BOR A;  2KWJ A;  2LGV A;  2FSA A;  1JM7 A;  4LLB A;  5D1M B;  3U5M A;  1WE9 A;  1MM3 A;  1Z6U A;  3M62 A;  2FUU A;  4BBQ A;  3N9M A;  2K1J A;  4W4U A;  4CCG X;  4YAD A;  2JMI A;  5FEY A;  2YSJ A;  3SOW A;  4BHW A;  5B75 A;  2BAY A;  1RMD A;  4AYC A;  3PHD A;  2ECV A;  4S3O B;  4S3O C;  2EOD A;  5KH9 A;  4LKA A;  5LKU A;  4LK9 A;  5JG6 A;  2MNZ A;  2YHO A;  3EB6 A;  5B8D A;  4GNG A;  3N9O A;  4L58 A;  2XEU A;  2YQM A;  3N9N A;  2KYU A;  2K17 A;  5G04 B;  2ZET C;  4YAB A;  4A4C A;  5B78 A;  4GND A;  3KV6 A;  2VPD A;  2YUR A;  3MHS A;  5TDW A;  2PUY A;  2L43 A;  3HCS A;  2Y1N A;  3O35 A;  2EGP A;  4GNE A;  1WEU A;  2VPB A;  1X4I A;  4NN2 A;  3L11 A;  3QZV A;  3ZPV 1;  4QF3 A;  4ZQL A;  2CT2 A;  4ZUX U;  1JM7 B;  2M3H A;  3LQH A;  1V87 A;  2ECN A;  4O64 A;  1U6G B;  1WES A;  1E4U A;  2LRI C;  3O33 A;  4Q6F A;  2YSM A;  4LAD B;  2ECW A;  4YBT A;  4UI9 B;  1WIL A;  3ASL A;  3C5K A;  2JMJ A;  3LQI A;  4V3K C;  2LV9 A;  3N9P A;  5KH3 A;  2EA6 A;  2KFT A;  3KV5 A;  4N3W A;  5FER A;  4I7D A;  2E6S A;  4X3G A;  4XI1 A;  2Y43 A;  2L0B A;  2D8S A;  5D1L B;  2C2V S;  3N9L A;  2E6R A;  3NG2 A;  3T6R A;  1Z60 A;  3N9Q A;  3ZYQ A;  3L1X A;  3KNV A;  5KH7 A;  2HDP A;  3ZNI A;  3L1Z B;  2G45 A;  1VYX A;  2ECJ A;  1WEE A;  4AP4 A;  2KWO A;  4YAT A;  2VJF A;  5G0F A;  5TAB A;  3V43 A;  2F42 A;  4WZ3 B;  2DX8 A;  2M1R A;  2L5U A;  2M6M A;  5J3X A;  1T1H A;  2M85 A;  2KRE A;  2YHN A;  2OXQ C;  2JMD A;  2YQL A;  4LJN A;  4PPE A;  2MUM A;  2YRE A;  3LRQ A;  4FO9 A;  1FBV A;  2YYR A;  4AUQ B;  3U5O A;  2VNF A;  2MIQ A;  2FUI A;  4F52 B;  1WEW A;  3T7L A;  2KIZ A;  3ZPV E;  2LDR A;  3ZTG A;  2L80 A;  2UZG A;  5AIU A;  4FJC A;  2RI7 A;  2VJE A;  1CHC A; 
#chains in the Genus database with same CATH topology
 2E5L E;  1YYK A;  3LVQ E;  4KZS A;  4BC9 A;  3J7Y p;  5LCW B;  2AN6 A;  1N34 E;  5H1T A;  3IHP A;  3O7A A;  2NUE A;  2LN0 A;  4MVT A;  2H0D B;  1PDA A;  4GB0 A;  2EOE A;  2IHR 1;  4GEQ B;  2K4V A;  2WBT A;  4R2C A;  1X47 A;  4YHH E;  2LJU A;  2LO3 A;  1YYO A;  3FAN A;  2YTF A;  1MBM A;  4JI2 E;  3M63 A;  4WA6 A;  4P5O B;  2KWN A;  5IXM B;  2N8X A;  5B79 A;  4R8O A;  5ADZ A;  2LGG A;  1EH7 A;  1N3G A;  4LF9 E;  2QIC A;  3LVR E;  2F6N A;  5LKZ A;  1LDK C;  2UUC E;  1DVP A;  2RR4 A;  4BS9 A;  2EMC A;  4YBM A;  4R2Y A;  1GZ6 A;  2B9D A;  3RMP A;  5SVY A;  2FD4 A;  2YT5 A;  4WSG A;  3THN A;  2DJA A;  4DKK A;  1IBL E;  4L7X A;  3SOX A;  1K2F A;  3HTK C;  2EMX A;  5IV8 B;  4ZDT A;  3OML A;  5A6A A;  3HXL A;  4MLV A;  2ODR D;  1ZR9 A;  4LF6 E;  2M13 A;  2LJH A;  4AYC B;  3H7H A;  2IDA A;  2XP0 A;  3DPL R;  2KOU A;  2RSM A;  2JPA A;  2LVH A;  5SVI B;  3SOU A;  2LGL A;  2HYE D;  4ZYG A;  2R76 A;  1YFH A;  3IWB A;  4R2A A;  1EKZ A;  2ECT A;  2VP7 A;  5AIT A;  4BHC A;  1AAY A;  4UP0 A;  2RPC A;  5AAS A;  2MA5 A;  2MC6 A;  1LDJ B;  2G43 A;  2YU4 A;  3DQV R;  4A0C D;  1WEM A;  2YZT A;  2XOY A;  3O70 A;  2JOB A;  2K16 A;  1F62 A;  3O37 A;  2M1S A;  4A4B A;  1AH5 A;  1N87 A;  2FFW A;  5B76 A;  1WIM A;  2CSY A;  2F6J A;  2V89 A;  2H36 X;  4GNF A;  4DV4 E;  2L7P A;  4NXN E;  1X4J A;  2ELZ A;  5D1K B;  4R2P A;  2DRP A;  4JI5 E;  2I50 A;  1XMQ E;  2JVA A;  1WXR A;  4O24 A;  1EH6 A;  2L75 A;  2ZM6 E;  5A6K A;  1MM2 A;  4I7C A;  2HC5 A;  2ELY A;  4M0V A;  1G2D C;  2XB1 A;  4DV7 E;  2EE8 A;  2JOX A;  3HPZ A;  3MHS C;  1XMO E;  3M99 A;  4IC3 A;  5A2Q C;  4B3S E;  2UXD E;  2QJ0 A;  1JOC A;  2MD8 C;  4GKJ E;  1X4U A;  2VPE A;  1A1H A;  2JRJ A;  2ENH A;  2L2M A;  3ZOQ B;  4IJD A;  1BB8 A;  2PNX A;  3C4T A;  4WYQ B;  4GKK E;  2Y1M A;  5H1U A;  2LXP C;  3HCU A;  2EPC A;  2YRH A;  4RH8 A;  2MKD A;  2YW8 A;  2I13 A;  4B3T E;  3C6M A;  1X3C A;  2VJE B;  4OOG C;  2RS7 A;  1HNX E;  4AVX A;  3MSW A;  1P47 A;  5C11 A;  2M9A A;  1SR9 A;  3O34 A;  2L92 A;  5A6B D;  2UU9 E;  4F9C B;  2EN6 A;  3RTR B;  2FGG A;  4IC2 A;  4QF2 A;  2MNY A;  3EPL A;  1VD4 A;  2CRW A;  2KKX A;  4WZ2 A;  3O36 A;  2EMG A;  2EJ4 A;  5EYA F;  1VFY A;  5KL6 A;  4WFT A;  3KZY A;  4YAX A;  4C9Z A;  1G25 A;  4LTY A;  2EM2 A;  5LLQ A;  2YTJ A;  2YTG A;  2LV2 A;  4BBY A;  1FP0 A;  3J80 C;  3ZVZ B;  5KL2 A;  2KGI A;  2G6Q A;  1IBK E;  2LQ6 A;  1T4N A;  4A49 A;  5BR8 E;  5TRB A;  3ZVY A;  2DMI A;  2MKN A;  5LMN E;  4R8P K;  4WXC A;  3VYX A;  4MSX A;  3QG5 C;  3FL2 A;  3JAM C;  2ECG A;  4I7B A;  1F2I G;  2EPL X;  3F6G A;  2L2N A;  2VQE E;  2V8Q B;  2RSD A;  2CSH A;  1N33 E;  1WEP A;  1WFK A;  2ENC A;  3MDB C;  2WBU A;  1BBO A;  4JI4 E;  2JR1 A;  4OX9 E;  2EN4 A;  4PTB A;  1IYM A;  2B7T A;  5C13 A;  4CA1 A;  2BB8 A;  2EN8 A;  2UUB E;  4R2R A;  2KGG A;  4DMI A;  1PJT A;  4F6M A;  1ZAA C;  1ZU1 A;  1PKP A;  1N32 E;  1NCS A;  3FJU B;  3GL6 A;  2ECI A;  3C6W A;  3KWR A;  2J7J A;  2CKL A;  2EMW A;  5SVX A;  1WGM A;  2D9H A;  2EOS A;  2EOM A;  4X62 E;  4LFB E;  4FK5 A;  3I2D A;  1WEO A;  2NAB A;  2EOI A;  2KE1 A;  3U5P A;  2DSY A;  1N36 E;  3JU0 A;  4DR4 E;  4YC9 A;  2KR4 A;  2EPP A;  1IQO A;  4R03 A;  5AE2 A;  5B77 A;  2VF1 A;  1HYJ A;  3OTO E;  5FB0 A;  2MT5 A;  2MD7 B;  2EL5 A;  4DV2 E;  2NAA A;  5AC4 A;  4YBS A;  4X65 E;  2WBS A;  4DR5 E;  2EN1 A;  3EPJ A;  1HNW E;  3J81 C;  2EOH A;  2YTD A;  2XOC A;  4DV3 E;  3LQJ A;  5G05 B;  5TSE A;  2EOF A;  4NZV A;  5DIN A;  2EMI A;  1HYI A;  2EOQ A;  2EM5 A;  3T1H E;  4TKP B;  5AE1 A;  4N4R B;  2CON A;  2QIZ A;  1ZBD B;  3GV4 A;  4BHB A;  1FKA E;  5H1V A;  2VJF B;  3M99 B;  2LTR A;  5LKT A;  3KQI A;  2EWL A;  2YU8 A;  2L3J A;  4M2Z A;  3LJU X;  3O47 A;  3DF6 A;  1X48 A;  1PJQ A;  2EML A;  1JK1 A;  2CT1 A;  1ZBT A;  2EM8 A;  1QNT A;  4V3L C;  4L5N C;  1LLM C;  2RQL A;  2LGK A;  1XWH A;  5LKX A;  4TUI A;  3U5N A;  4B86 C;  2LRS A;  5TDR A;  2MC5 A;  3ADG A;  2IQJ A;  3AUZ A;  2RS6 A;  1I94 E;  4O62 A;  2K7I A;  1RC7 A;  1UIL A;  1SFE A;  5F3W A;  2JUN A;  3PUQ A;  2JY9 A;  1T4L B;  5H9M A;  3PUR A;  4R2S A;  1Z1B A;  3JUE A;  3VHT B;  2D8U A;  2EN3 A;  3MHH A;  2EPR A;  1WJP A;  4N4F A;  4P7D A;  2WCC 3;  4LF5 E;  2EOY A;  4WSP A;  4WZ0 A;  2VPG A;  4B7Y C;  2DSM A;  2KWK A;  3VK6 A;  2LXH C;  1NEI A;  4X8W A;  4WPY A;  3P1X A;  4DR1 E;  4FIP A;  3BBG A;  2VQF E;  1Z2Q A;  1WEV A;  2C2L A;  3ADL A;  3M7K A;  4X64 E;  1YPN A;  2JWO A;  5I3L A;  4DV6 E;  2EOJ A;  1WEN A;  3RPG B;  4MLQ A;  3RPG C;  4LFC E;  2CTD A;  2E61 A;  4NHR A;  3FAO A;  5KL7 A;  3TQM A;  4R7E A;  4R2E A;  2KU3 A;  2YUC A;  5FB1 A;  3HCT A;  2LCE A;  2YTI A;  4JI3 E;  4QQ4 A;  3EB5 A;  3THO B;  1UN6 B;  3L00 A;  2EN2 A;  1MGT A;  2K4D A;  1WEQ A;  2CSZ A;  4JYA E;  2MA6 A;  2A25 A;  3Q1D A;  2CKL B;  5TBN A;  4ZYD A;  3SHB A;  2UXC E;  2H0D A;  4OGC A;  5DKA A;  2LUP B;  4UP5 A;  1BOR A;  2KWJ A;  2LGV A;  2WZO A;  2FSA A;  1JM7 A;  3IWD A;  4LLB A;  5D1M B;  3U5M A;  2EMK A;  1ZBQ A;  1WE9 A;  1J5E E;  1MM3 A;  1Z6U A;  3M62 A;  4DR7 E;  2MKE A;  2YTE A;  2EMB A;  3LLH A;  2FUU A;  2NUF A;  1EH8 A;  4BBQ A;  2EOR A;  1A1G A;  3N9M A;  2K1J A;  2YWQ A;  2B7V A;  4W4U A;  2L33 A;  4DV1 E;  4DR6 E;  3C4B A;  3KDE C;  2JYA A;  3ADJ A;  2EMH A;  5A6B A;  2N3H A;  5DNY A;  2L2K B;  4CCG X;  4YAD A;  2JMI A;  2YTP A;  5FEY A;  2EPA A;  2EPU A;  2YTO A;  2HJJ A;  2EMA A;  2L8T A;  2YSJ A;  1IQS A;  1QU6 A;  3SOW A;  2YSO A;  2LT7 A;  2EZ6 A;  2DB2 A;  4BHW A;  4BC7 A;  2B0O E;  2I9I A;  2EM0 A;  5B75 A;  2BAY A;  1T4O A;  5FLX C;  1RMD A;  4AYC A;  3PHD A;  2ECV A;  2LAU A;  5SVI A;  1A1I A;  2YRK A;  2NA2 A;  4S3O B;  2L6M A;  4S3O C;  1O0W A;  2EOD A;  3K6Q A;  5LL6 R;  2G7H A;  5KH9 A;  2HHH E;  4LKA A;  5LKU A;  4TUG A;  3ECR A;  4LK9 A;  5JG6 A;  3EQ1 A;  4DV5 E;  4GZN C;  2MNZ A;  1G2F C;  2GPI A;  2MDG A;  2YHO A;  4O43 A;  4AQY E;  3EB6 A;  2M4I A;  2L3C A;  5B8D A;  2DIX A;  3VYY A;  4K0K E;  4GNG A;  4O5G A;  3N9O A;  4L58 A;  2E72 A;  2XEU A;  2YQM A;  3N9N A;  1WHQ A;  3MHH C;  2YPN A;  4M30 A;  2EGM A;  2ODR C;  2KYU A;  2K17 A;  5G04 B;  1DQ3 A;  2ZET C;  3DDT A;  2DLK A;  2B3T B;  4I8O A;  4YAB A;  4BCA A;  4A4C A;  5B78 A;  4GND A;  3KV6 A;  4DR2 E;  2EPX A;  2VPD A;  2LUQ A;  3UK3 C;  1DGC A;  1X5W A;  1YYW A;  4F6N A;  2YUR A;  3MHS A;  2V87 A;  5TDW A;  2HGH A;  3DWD A;  2LBS B;  2EQ1 A;  4P78 A;  4Q28 A;  3PLW A;  2LTS A;  2EM7 A;  3J7A G;  2UXB E;  3KZZ A;  3FEH A;  2PUY A;  2L43 A;  4IS1 C;  1X6F A;  3HCS A;  2EP3 A;  2Y1N A;  3O35 A;  1GQE A;  2V86 A;  1HNZ E;  2EGP A;  3FIG A;  4GNE A;  1WEU A;  1YSA C;  2EPK X;  5KL5 A;  2VPB A;  1X4I A;  4NN2 A;  2EMY A;  4LF4 E;  3L11 A;  2YRM A;  3QZV A;  3ZPV 1;  1YZ9 A;  5IWA E;  4BMJ A;  1WRJ A;  4QF3 A;  4ZQL A;  4ZYE A;  4LFA E;  1STU A;  3T9K A;  4LF8 E;  2CT2 A;  5CFF E;  1XNQ E;  2KKY A;  4ZUX U;  1JM7 B;  5IT9 C;  5K3Q A;  2M3H A;  1A1J A;  1KJK A;  3LQH A;  2EOX A;  2KHX A;  1FJG E;  2F4V E;  1V87 A;  4WXD A;  1DI2 A;  2EL4 A;  2ECN A;  4O64 A;  4OGE A;  2EPZ A;  5AC5 A;  1U6G B;  1WES A;  2MDR A;  2V85 A;  3LDY A;  4JI7 E;  1DCQ A;  4LF7 E;  1E4U A;  2LRI C;  3HTX A;  3O33 A;  2CRR A;  4Q6F A;  2CSV A;  2EMZ A;  5AE3 A;  2YSM A;  4LAD B;  2CPN A;  2ECW A;  4Z0R A;  4YBT A;  4UI9 B;  2EMF A;  5LMU E;  2JP9 A;  1WIL A;  3ASL A;  3C5K A;  2JMJ A;  3LQI A;  4V3K C;  2LV9 A;  2FV4 B;  1T38 A;  3N9P A;  3FM8 C;  2GLI A;  3EPH A;  1X6H A;  5KL4 A;  5KH3 A;  2EA6 A;  2KFT A;  3KV5 A;  4N3W A;  3C6K A;  2ADR A;  2EOZ A;  5FER A;  3H09 A;  1IMU A;  4WX9 A;  4KWY A;  4I7D A;  4RHB B;  2LMZ A;  2E6S A;  1JK2 A;  4X3G A;  4XI1 A;  2YTQ A;  2Y43 A;  1X49 A;  2L0B A;  1A1F A;  2D8S A;  2M7Q A;  4JI1 E;  4R2Q A;  2P57 A;  4H9D A;  5D1L B;  2EL6 A;  2EPM X;  2C2V S;  3N9L A;  2E6R A;  2PRT A;  3NG2 A;  3T6R A;  1B69 A;  4JI6 E;  4J8Z A;  1Z60 A;  3N9Q A;  2LE2 A;  4DV0 E;  3ZYQ A;  2EPO A;  1A1L A;  3L1X A;  2YVR A;  3KNV A;  4YY3 E;  3JTZ A;  4FK5 C;  5KH7 A;  2HDP A;  2YT4 A;  3ZNI A;  3L1Z B;  1GTK A;  2G45 A;  2N3G A;  1VYX A;  1KYQ A;  2ECJ A;  4F1P A;  1WEE A;  2VRD A;  4AP4 A;  1L4S A;  3E2D A;  4F9A B;  4Q35 B;  2EOO A;  2YSP A;  4DUZ E;  2KWO A;  4YAT A;  2VJF A;  4DUY E;  1YUI A;  4ZYH A;  5G0F A;  2GHF A;  5TAB A;  3V43 A;  3AV0 A;  2OWA A;  2Q8U A;  2ENA A;  1MEY C;  2KON A;  4R2D A;  3HQ1 A;  4X66 E;  2F42 A;  4WZ3 B;  2DX8 A;  2EQ3 A;  2UUA E;  5A6J A;  3F6H A;  3BID A;  1X6E A;  2M1R A;  2DGC A;  3ADI A;  2V83 A;  4L8N A;  2L5U A;  2M6M A;  5J3X A;  1UBD C;  1TN9 A;  3LML A;  1T1H A;  4NXM E;  4JI0 E;  4JI8 E;  4DR3 E;  2M85 A;  1PJS A;  2KRE A;  2YHN A;  3BF2 A;  1YUJ A;  2FTX B;  3IWC A;  2OXQ C;  3EPK A;  2JMD A;  2YQL A;  4O4K A;  4LJN A;  1A1K A;  2NUG A;  4F9B B;  4HEI A;  4PPE A;  2MUM A;  2YRE A;  2DMY A;  3LRQ A;  3T1Y E;  2RTX A;  4FO9 A;  1BBG A;  2EM4 A;  2RSI A;  1T39 A;  4JV5 E;  4LU9 A;  2YTN A;  3DJW A;  2DLQ A;  4M9V C;  1TF3 A;  2E1M A;  1FBV A;  2JM3 A;  3BGH A;  4KHP E;  2YU5 A;  5A69 A;  4F54 A;  2YYR A;  4AUQ B;  3U5O A;  2VNF A;  2MIQ A;  2XOZ A;  1XNR E;  4F2J C;  2FUI A;  1J26 A;  1WHN A;  2F8B A;  2JXP A;  1HR0 E;  2EM3 A;  2V88 A;  1UHZ A;  2EQ0 A;  4X9J A;  5KL3 A;  4F52 B;  2VE7 C;  3HPS A;  3SUB A;  1RQ0 A;  1WEW A;  3T7L A;  1IBM E;  2EM9 A;  2KIZ A;  2BBG A;  2EN7 A;  3ZPV E;  2LDR A;  3ZTG A;  5T6J A;  4B3M E;  4HTG A;  2L80 A;  2UZG A;  4B3R E;  5AIU A;  2EPN A;  4FJC A;  2RI7 A;  2R1F A;  2EM6 A;  1TF6 A;  2VJE A;  1CHC A;  4Z0O A;  2EXU A; 
#chains in the Genus database with same CATH homology
 2E5L E;  1YYK A;  4KZS A;  4BC9 A;  3J7Y p;  5LCW B;  2AN6 A;  1N34 E;  5H1T A;  3IHP A;  3O7A A;  2NUE A;  2LN0 A;  4MVT A;  2H0D B;  4GB0 A;  2IHR 1;  4GEQ B;  2K4V A;  1X47 A;  4YHH E;  1YYO A;  4JI2 E;  3M63 A;  4WA6 A;  4P5O B;  2KWN A;  5B79 A;  4R8O A;  5ADZ A;  2LGG A;  4LF9 E;  2QIC A;  2F6N A;  5LKZ A;  1LDK C;  2UUC E;  1DVP A;  4BS9 A;  4YBM A;  4R2Y A;  1GZ6 A;  2B9D A;  3RMP A;  2YT5 A;  4DKK A;  1IBL E;  4L7X A;  3SOX A;  1K2F A;  3HTK C;  4ZDT A;  3OML A;  3HXL A;  2ODR D;  4LF6 E;  2LJH A;  4AYC B;  2IDA A;  3DPL R;  2KOU A;  2RSM A;  3SOU A;  2LGL A;  2HYE D;  3IWB A;  1EKZ A;  2ECT A;  2VP7 A;  5AIT A;  4UP0 A;  5AAS A;  2MA5 A;  2MC6 A;  1LDJ B;  2G43 A;  2YU4 A;  3DQV R;  4A0C D;  1WEM A;  2YZT A;  3O70 A;  2JOB A;  2K16 A;  1F62 A;  3O37 A;  2M1S A;  4A4B A;  1N87 A;  5B76 A;  1WIM A;  2CSY A;  2F6J A;  2V89 A;  2H36 X;  4GNF A;  4DV4 E;  4NXN E;  1X4J A;  5D1K B;  4JI5 E;  2I50 A;  1XMQ E;  2JVA A;  1WXR A;  2ZM6 E;  2L75 A;  1MM2 A;  4I7C A;  4M0V A;  2XB1 A;  4DV7 E;  3HPZ A;  2JOX A;  1XMO E;  3M99 A;  4IC3 A;  5A2Q C;  4B3S E;  2UXD E;  2QJ0 A;  1JOC A;  2MD8 C;  4GKJ E;  1X4U A;  2VPE A;  2JRJ A;  2L2M A;  3ZOQ B;  2PNX A;  3C4T A;  4WYQ B;  4GKK E;  2Y1M A;  5H1U A;  2LXP C;  3HCU A;  2YW8 A;  4B3T E;  1HNX E;  2VJE B;  4OOG C;  2RS7 A;  4AVX A;  3MSW A;  5C11 A;  1SR9 A;  3O34 A;  2L92 A;  2UU9 E;  4F9C B;  3RTR B;  2FGG A;  4IC2 A;  4QF2 A;  2MNY A;  1VD4 A;  4WZ2 A;  3O36 A;  5EYA F;  1VFY A;  4WFT A;  4LTY A;  4YAX A;  4C9Z A;  1G25 A;  3J80 C;  4BBY A;  1FP0 A;  3ZVZ B;  2KGI A;  2G6Q A;  1IBK E;  2LQ6 A;  1T4N A;  4A49 A;  5BR8 E;  5TRB A;  3ZVY A;  5LMN E;  4R8P K;  3VYX A;  4MSX A;  3FL2 A;  3JAM C;  2ECG A;  4I7B A;  3F6G A;  2L2N A;  2VQE E;  2V8Q B;  2RSD A;  1N33 E;  1WEP A;  1WFK A;  4JI4 E;  2JR1 A;  4OX9 E;  4PTB A;  1IYM A;  2B7T A;  5C13 A;  4CA1 A;  2UUB E;  2KGG A;  4DMI A;  1PKP A;  1N32 E;  3GL6 A;  2ECI A;  3C6W A;  3KWR A;  2CKL A;  1WGM A;  4X62 E;  4LFB E;  4FK5 A;  3I2D A;  1WEO A;  2KE1 A;  3U5P A;  2DSY A;  1N36 E;  3JU0 A;  4DR4 E;  4YC9 A;  2KR4 A;  4R03 A;  5AE2 A;  5B77 A;  2VF1 A;  1HYJ A;  3OTO E;  5FB0 A;  2MT5 A;  2MD7 B;  4DV2 E;  2NAA A;  4YBS A;  4X65 E;  4DR5 E;  1HNW E;  3J81 C;  4DV3 E;  3LQJ A;  5G05 B;  5DIN A;  1HYI A;  3T1H E;  4TKP B;  5AE1 A;  2QIZ A;  1ZBD B;  3GV4 A;  1FKA E;  5H1V A;  2VJF B;  2LTR A;  5LKT A;  3KQI A;  2EWL A;  2L3J A;  4M2Z A;  3DF6 A;  1X48 A;  1ZBT A;  4V3L C;  4L5N C;  2LGK A;  1XWH A;  5LKX A;  4TUI A;  3U5N A;  4B86 C;  2LRS A;  5TDR A;  2MC5 A;  3ADG A;  3AUZ A;  2RS6 A;  1I94 E;  1RC7 A;  1UIL A;  5F3W A;  3PUQ A;  2JY9 A;  1T4L B;  5H9M A;  3PUR A;  3MHH A;  4N4F A;  4P7D A;  4LF5 E;  4WSP A;  4WZ0 A;  2VPG A;  4B7Y C;  2KWK A;  3VK6 A;  2LXH C;  4X8W A;  4WPY A;  3P1X A;  4DR1 E;  4FIP A;  2VQF E;  1Z2Q A;  1WEV A;  2C2L A;  3ADL A;  4X64 E;  2JWO A;  5I3L A;  4DV6 E;  1WEN A;  3RPG B;  4LFC E;  3RPG C;  4R7E A;  2KU3 A;  2YUC A;  5FB1 A;  3HCT A;  4JI3 E;  3EB5 A;  2K4D A;  1WEQ A;  2CSZ A;  4JYA E;  2MA6 A;  5TBN A;  2CKL B;  3SHB A;  2UXC E;  2H0D A;  5DKA A;  2LUP B;  4UP5 A;  1BOR A;  2KWJ A;  2LGV A;  2WZO A;  2FSA A;  1JM7 A;  3IWD A;  4LLB A;  5D1M B;  3U5M A;  1ZBQ A;  1WE9 A;  1J5E E;  1MM3 A;  1Z6U A;  3M62 A;  4DR7 E;  3LLH A;  2FUU A;  2NUF A;  4BBQ A;  3N9M A;  2K1J A;  2B7V A;  4W4U A;  2L33 A;  4DV1 E;  4DR6 E;  3C4B A;  3ADJ A;  2N3H A;  5DNY A;  2L2K B;  4CCG X;  4YAD A;  2JMI A;  5FEY A;  2L8T A;  2YSJ A;  1QU6 A;  3SOW A;  2EZ6 A;  2DB2 A;  4BHW A;  4BC7 A;  5B75 A;  2BAY A;  1T4O A;  5FLX C;  1RMD A;  4AYC A;  3PHD A;  2ECV A;  2NA2 A;  4S3O B;  2L6M A;  4S3O C;  1O0W A;  2EOD A;  3K6Q A;  5LL6 R;  2G7H A;  5KH9 A;  2HHH E;  4LKA A;  5LKU A;  4TUG A;  4LK9 A;  5JG6 A;  4DV5 E;  2MNZ A;  2YHO A;  4AQY E;  3EB6 A;  2M4I A;  2L3C A;  5B8D A;  2DIX A;  3VYY A;  4K0K E;  4GNG A;  3N9O A;  4L58 A;  2XEU A;  2YQM A;  3N9N A;  1WHQ A;  4M30 A;  2ODR C;  2KYU A;  2K17 A;  5G04 B;  1DQ3 A;  2ZET C;  2B3T B;  4I8O A;  4YAB A;  4BCA A;  4A4C A;  5B78 A;  4GND A;  3KV6 A;  4DR2 E;  2VPD A;  2LUQ A;  1YYW A;  2YUR A;  3MHS A;  2V87 A;  5TDW A;  2LBS B;  4P78 A;  4Q28 A;  2LTS A;  3J7A G;  2UXB E;  2PUY A;  2L43 A;  3HCS A;  2Y1N A;  3O35 A;  1GQE A;  2V86 A;  1HNZ E;  2EGP A;  3FIG A;  4GNE A;  1WEU A;  2VPB A;  1X4I A;  4NN2 A;  4LF4 E;  3L11 A;  3QZV A;  3ZPV 1;  1YZ9 A;  5IWA E;  4BMJ A;  4QF3 A;  4ZQL A;  4LFA E;  1STU A;  4LF8 E;  2CT2 A;  5CFF E;  1XNQ E;  4ZUX U;  1JM7 B;  5IT9 C;  2M3H A;  3LQH A;  1DI2 A;  2KHX A;  1FJG E;  2F4V E;  1V87 A;  2ECN A;  4O64 A;  1U6G B;  1WES A;  2MDR A;  2V85 A;  4JI7 E;  4LF7 E;  1E4U A;  2LRI C;  3HTX A;  3O33 A;  4Q6F A;  5AE3 A;  2YSM A;  4LAD B;  2CPN A;  2ECW A;  4YBT A;  4UI9 B;  5LMU E;  1WIL A;  3ASL A;  3C5K A;  2JMJ A;  3LQI A;  4V3K C;  2LV9 A;  2FV4 B;  3N9P A;  5KH3 A;  2EA6 A;  2KFT A;  3KV5 A;  4N3W A;  5FER A;  3H09 A;  4I7D A;  2LMZ A;  2E6S A;  4X3G A;  4XI1 A;  2Y43 A;  1X49 A;  2L0B A;  2D8S A;  2M7Q A;  4JI1 E;  5D1L B;  2C2V S;  3N9L A;  2E6R A;  3NG2 A;  3T6R A;  4JI6 E;  4J8Z A;  1Z60 A;  3N9Q A;  2LE2 A;  4DV0 E;  3ZYQ A;  3L1X A;  4YY3 E;  3KNV A;  3JTZ A;  5KH7 A;  2HDP A;  2YT4 A;  3ZNI A;  3L1Z B;  2G45 A;  2N3G A;  1VYX A;  2ECJ A;  1WEE A;  4AP4 A;  4F9A B;  4DUZ E;  2KWO A;  4YAT A;  2VJF A;  4DUY E;  5G0F A;  5TAB A;  3V43 A;  3AV0 A;  2KON A;  3HQ1 A;  4X66 E;  2F42 A;  4WZ3 B;  2DX8 A;  2UUA E;  3F6H A;  2M1R A;  3ADI A;  2V83 A;  4L8N A;  2L5U A;  2M6M A;  5J3X A;  3LML A;  1T1H A;  4NXM E;  4JI0 E;  4JI8 E;  4DR3 E;  2M85 A;  2KRE A;  2YHN A;  2FTX B;  3IWC A;  2OXQ C;  2JMD A;  2YQL A;  4LJN A;  2NUG A;  4F9B B;  4PPE A;  2MUM A;  2YRE A;  2DMY A;  3LRQ A;  3T1Y E;  2RTX A;  4FO9 A;  4JV5 E;  4LU9 A;  3DJW A;  2E1M A;  1FBV A;  4KHP E;  4F54 A;  2YYR A;  4AUQ B;  3U5O A;  2VNF A;  2MIQ A;  1XNR E;  2FUI A;  1J26 A;  1WHN A;  2F8B A;  1HR0 E;  2V88 A;  1UHZ A;  4F52 B;  2VE7 C;  3HPS A;  1RQ0 A;  1WEW A;  3T7L A;  1IBM E;  2KIZ A;  3ZPV E;  2LDR A;  3ZTG A;  5T6J A;  4B3M E;  2L80 A;  2UZG A;  4B3R E;  5AIU A;  4FJC A;  2RI7 A;  2VJE A;  1CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...