3VK6A

Crystal structure of a phosphotyrosine binding domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase Hakai
total genus 20
structure length 96
sequence length 96
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18408 zf_Hakai C2H2 Hakai zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3vk6A01
3.30.160.640 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vk6A02
2LQ6A 4L7XA 5D1MB 2MUMA 4WZ0A 2JMDA 2YU4A 4BHWA 3EB6A 5G0FA 3EB5A 4R8PK 1FBVA 2YHOA 4IC2A 4YABA 4GNDA 2ECTA 3O7AA 2ECJA 2KWNA 2YYRA 3MHSA 4Q6FA 5DKAA 2OXQC 2LN0A 2KU3A 5B78A 1WEWA 2LXHC 2ZETC 2K1JA 2JMIA 2IDAA 2YURA 3ZYQA 2K4DA 3MHHA 5J3XA 5LCWB 1ZBDB 4R2YA 2G6QA 3PHDA 2MNZA 3SHBA 4CCGX 2UZGA 3O34A 2VPGA 4GNEA 2NAAA 3M99A 4P5OB 4LADB 3HTKC 3L11A 3N9MA 3LQIA 5JG6A 1WEQA 3N9LA 2L0BA 2Y1MA 4ZUXU 2VJEB 4W4UA 3KV6A 2KIZA 5C13A 4C9ZA 5TRBA 3ZTGA 4AYCB 2VPDA 5LKZA 2F42A 5AIUA 1BORA 5TDRA 5LKUA 5FB1A 1VFYA 4I7BA 5I3LA 2F6JA 4LK9A 4B86C 2L5UA 4L58A 4A49A 2EODA 2G45A 3ZPVE 3GL6A 2MD7B 4V3KC 4ZQLA 4GB0A 2KGIA 2KWOA 3N9PA 2ECWA 3U5NA 5FERA 2RI7A 4GNGA 2AN6A 1Z2QA 1IYMA 1VYXA 5KH7A 2LV9A 5AITA 2H0DA 4A0CD 1WIMA 1F62A 2KWKA 2D8SA 2I50A 5B75A 2KWJA 5C11A 3KNVA 3NG2A 2ECNA 4S3OC 3LRQA 2VNFA 1WE9A 3C6WA 3O35A 2YUCA 4I7DA 3ZNIA 2YREA 4I7CA 3KV5A 3T6RA 3ZVYA 3ZVZB 2Y1NA 3LQJA 3IHPA 2LGVA 4AYCA 3L1XA 3RPGC 1X4IA 5KH3A 2EGPA 2FUIA 1JM7B 3V43A 2KFTA 4TKPB 4A4CA 2YHNA 2VJFB 2K17A 4AP4A 5H1VA 3N9QA 5TBNA 2VPEA 4X3GA 4NN2A 2LXPC 5TABA 2MA5A 1WESA 4UP0A 1HYIA 1RMDA 4ZDTA 2CSYA 5H1TA 1CHCA 4QF2A 2VP7A 1FP0A 1X4JA 5FB0A 2LGLA 2L75A 4QF3A 5D1KB 2ECVA 4LLBA 2KGGA 2YSMA 3DPLR 1WEVA 5FEYA 1MM3A 2L80A 2XEUA 2YSJA 5B76A 2RSDA 3O36A 2YQLA 2BAYA 4R7EA 2MIQA 1XWHA 4UP5A 4YAXA 4CA1A 1N87A 1WEUA 4BBQA 3PURA 2HYED 2KE1A 2C2LA 2VJEA 5G04B 3DQVR 2CT2A 2M3HA 3M63A 2VJFA 1JOCA 2YQMA 1G25A 4LJNA 4YBTA 1WEPA 3N9OA 3O33A 2CSZA 3N9NA 2XB1A 4LKAA 3L1ZB 2ECGA 3U5PA 2FSAA 2M85A 5KH9A 2YW8A 1LDJB 2MNYA 3C5KA 4F52B 2KYUA 3U5MA 1WEEA 3FL2A 4FJCA 5G05B 2ECIA 1LDKC 2VPBA 3HCSA 1HYJA 5B8DA 1JM7A 1DVPA 3M62A 2MA6A 4UI9B 4FO9A 2YT5A 1WGMA 1X4UA 3GV4A 2QICA 3RTRB 3RPGB 4MSXA 2E6RA 2MD8C 1WEOA 4MVTA 4V3LC 5B79A 4PPEA 2JRJA 5H1UA 5D1LB 4A4BA 2KR4A 1K2FA 2M6MA 5EYAF 2CKLB 2CKLA 4YATA 4B7YC 2LRIC 1U6GB 4WZ3B 2JMJA 4YBMA 1VD4A 3HCUA 1Z6UA 2E6SA 2QIZA 2MT5A 2LGGA 2HDPA 1V87A 2Y43A 4N4FA 2H0DB 4O64A 2LDRA 4YADA 3ZPV1 2LGKA 4YBSA 2PNXA 2DX8A 5DINA 2L43A 3T7LA 3QZVA 2PUYA 5LKXA 4GNFA 4S3OB 2M1RA 1WILA 3LQHA 2F6NA 1WEMA 2KREA 3SOUA 2FUUA 2K16A 5H9MA 1WENA 2QJ0A 1MM2A 3KQIA 3HCTA 3VK6A 3SOXA 2G43A 4FIPA 4YC9A 3O70A 4N3WA 2EA6A 1WFKA 4PTBA 4IC3A 4AUQB 4WZ2A 2C2VS 1T1HA 1Z60A 4AVXA 1E4UA 3ASLA 5LKTA 4XI1A 4FK5A 4WA6A 3PUQA 3SOWA 3O37A 5TDWA 5B77A 3U5OA 3I2DA
chains in the Genus database with same CATH superfamily
2YZTA 2LQ6A 4LTYA 1QU6A 2DLKA 4BCAA 4L7XA 5AE2A 5D1MB 1YYKA 2DSYA 2JXPA 2EMBA 2MUMA 4WZ0A 2RPCA 1UBDC 2JMDA 2MKEA 2EPXA 4R2SA 5A6KA 2ENCA 2NA2A 2YU4A 2UUBE 2GPIA 4BHWA 3EB6A 5G0FA 1MBMA 3EB5A 5IXMB 4X65E 4YY3E 3LJUX 4R8PK 1X48A 3LLHA 1FBVA 2A25A 1EH8A 2YHOA 3DDTA 4IC2A 4YABA 2L92A 2N8XA 4GNDA 2EXUA 2V89A 2ECTA 3O7AA 2ECJA 2VQEE 2KWNA 2YYRA 5KL6A 2EOIA 2KKYA 3MHSA 4Q6FA 2WBSA 4J8ZA 4DV3E 5DKAA 2OXQC 1NCSA 2LN0A 4QQ4A 2EPUA 3JTZA 4WSPA 1JK1A 2KU3A 5B78A 2EWLA 1WEWA 3ADLA 1STUA 2LXHC 2CPNA 4N4RB 1A1LA 2ZETC 2K1JA 2JMIA 2LE2A 4OX9E 2EM2A 2IDAA 2YURA 3JUEA 2UXBE 3ZYQA 4WX9A 2K4DA 3MHHA 3FM8C 5J3XA 4R2DA 4GZNC 5LCWB 4R2AA 2LBSB 2EPKX 1ZBDB 2VE7C 2YRHA 2M1SA 4R2YA 2G6QA 3FANA 2MNZA 3PHDA 3SHBA 4CCGX 2DMIA 2EM7A 3MHHC 2CRRA 5F3WA 2UZGA 3O34A 2VPGA 4H9DA 4OOGC 1P47A 3IWDA 4IJDA 4GNEA 4F54A 2PRTA 2NAAA 3M99A 3HXLA 4P5OB 4LADB 1N32E 4LF8E 3HTKC 3L11A 3N9MA 3T1YE 1IBLE 2EPLX 2IHR1 2L7PA 3RMPA 3LQIA 5JG6A 2N3HA 1WEQA 3N9LA 2ELYA 2L0BA 2Y1MA 2EM8A 4ZUXU 3E2DA 3BF2A 1FJGE 2VJEB 2EPNA 4W4UA 2EP3A 4JI0E 2EN3A 2EQ3A 1UHZA 1AAYA 4B3RE 3KV6A 4BMJA 2DJAA 2EM5A 2EN1A 1HNZE 2KIZA 2UU9E 3M99B 1YZ9A 5C13A 5TSEA 4C9ZA 1YSAC 4LFBE 4BHBA 1N34E 5TRBA 3ZTGA 4AYCB 1ZBTA 2MDRA 1TF6A 1N3GA 2VPDA 5LKZA 3J7Yp 2F42A 5AIUA 3H09A 4MLVA 2EOSA 1ZAAC 2EOZA 2M13A 1BORA 5TDRA 5LKUA 2NABA 2V86A 3SUBA 5FB1A 1VFYA 1PJQA 1O0WA 4I7BA 5I3LA 2DLQA 2F6JA 4LK9A 5A69A 2UUAE 2EM4A 3HPZA 4B86C 1N36E 2UUCE 4MLQA 4FK5C 4P78A 2L5UA 4L58A 2LRSA 2YSPA 3DF6A 4KWYA 3M7KA 4A49A 4KZSA 4M2ZA 2EODA 2BB8A 1DCQA 2WBTA 4L8NA 2G45A 4GKJE 1MEYC 3ZPVE 5DNYA 1RQ0A 4NXME 4BC7A 3GL6A 2YTEA 5KL2A 2EE8A 2MD7B 2LMZA 4BS9A 3HPSA 2EJ4A 4O5GA 4DR3E 2EOMA 4F9CB 2FFWA 2JM3A 4WXDA 4V3KC 2ENAA 2EQ0A 2LJUA 5KL5A 2F8BA 3VYYA 1DQ3A 4ZQLA 2VQFE 4DV2E 3K6QA 2JP9A 2YVRA 4GB0A 3KZYA 2KGIA 2KWOA 3N9PA 1UN6B 4OGCA 2EMFA 2JVAA 1B69A 4NHRA 4R2QA 1T4OA 2YRKA 2ECWA 3U5NA 3J7AG 5FERA 2RI7A 4GNGA 2L6MA 5FLXC 2AN6A 2YWQA 4ZYGA 5AE3A 2KONA 1Z2QA 1IYMA 2EOXA 2KHXA 1VYXA 5KH7A 2V8QB 2LV9A 4O4KA 1IQSA 2EMWA 5AITA 2Q8UA 4X66E 1T39A 2H0DA 2EZ6A 2EGMA 2CT1A 2K7IA 4A0CD 1WIMA 1F62A 2KWKA 2YTPA 2D8SA 4LFAE 2I50A 5B75A 2KWJA 5C11A 1KJKA 4DR1E 3ZOQB 3KNVA 2B3TB 3KWRA 3NG2A 4BBYA 2ECNA 1XMQE 4S3OC 3P1XA 2I9IA 2YTFA 1XNQE 3LRQA 1X6EA 2JR1A 2VNFA 4DV1E 1WE9A 2MKNA 4O62A 2EOQA 2EPAA 5KL3A 3C6WA 4JI6E 3LDYA 3O35A 2EL4A 2EORA 1T4NA 1EH6A 3J81C 4ZYHA 2YUCA 2EOOA 4F1PA 4I7DA 2MKDA 3ZNIA 2JY9A 2FD4A 2YREA 4DV6E 2JOXA 4JI5E 2EPOA 4RHBB 3L00A 1WJPA 2EQ1A 4I7CA 1FKAE 3KV5A 4F6NA 1A1IA 4NXNE 4F9AB 3T6RA 1GQEA 3ZVYA 3ZVZB 2EM0A 2LV2A 3QG5C 4O24A 2DMYA 2Y1NA 3LQJA 3IHPA 2EMKA 2LGVA 2JYAA 2CONA 1A1HA 1PDAA 4AYCA 3L1XA 2G7HA 3F6GA 3RPGC 3JAMC 3EPKA 3F6HA 2B7TA 1X4IA 4R03A 5KH3A 2EGPA 2FUIA 3LVQE 4WSGA 2N3GA 1JM7B 4YHHE 2YSOA 4ZYDA 3FIGA 1KYQA 3V43A 1HNWE 2V85A 2KFTA 3FJUB 1YUIA 1A1FA 4TKPB 2EN2A 4A4CA 4R2RA 2DGCA 2XOYA 2IQJA 2YHNA 2ENHA 2VJFB 2OWAA 2K17A 4WFTA 2EL6A 2EMYA 4AP4A 1N33E 5H1VA 3N9QA 2EOFA 1L4SA 5TBNA 3KZZA 3JU0A 2YTQA 3AV0A 2VPEA 2RQLA 1A1JA 2M9AA 3DWDA 4X3GA 2CTDA 2EN6A 2HC5A 1RC7A 5LMNE 4NN2A 2B9DA 2M4IA 2YTOA 2LTRA 2BBGA 2LXPC 5TABA 5SVIA 1YPNA 1YFHA 3Q1DA 2MA5A 1X47A 4TUGA 2RSIA 2UXCE 1WESA 2LO3A 4UP0A 5CFFE 2EPMX 4Q35B 1HYIA 1RMDA 4ZDTA 2CSYA 5H1TA 2EM3A 2MC5A 4F6MA 4DMIA 1CHCA 4QF2A 1PJSA 4DV4E 2YRMA 1A1KA 4LF7E 5A6BA 2VP7A 1IMUA 3EPJA 2LUPB 2DIXA 1FP0A 1X4JA 5FB0A 2LGLA 3EQ1A 2YPNA 1NEIA 2LVHA 2L75A 4QF3A 5D1KB 3C4TA 5IV8B 2V88A 2ECVA 2EMLA 4LLBA 3LMLA 2KGGA 2YSMA 3DPLR 1WEVA 5FEYA 1MM3A 2L80A 2XEUA 1YYOA 4K0KE 5SVYA 3KDEC 4OGEA 2YSJA 5B76A 1X5WA 2RSDA 3O36A 3C6MA 2YQLA 5A6AA 2NUFA 2FV4B 2BAYA 4R7EA 2MIQA 2JUNA 1X6HA 2YU5A 1XWHA 4UP5A 4M0VA 4YAXA 4CA1A 1N87A 2LJHA 3T9KA 1WEUA 2M7QA 1YYWA 5KL4A 2YTJA 4X64E 2XOZA 3C4BA 1SFEA 2WZOA 4P7DA 3T1HE 3HTXA 2ADRA 2CSHA 1G2FC 4BBQA 3PURA 2HYED 2E72A 2KE1A 4DR2E 5AC5A 1XNRE 2EPRA 2EMHA 4KHPE 4R2EA 4DUZE 4DV5E 1ZR9A 2C2LA 2E1MA 2VJEA 4JI7E 5G04B 2B7VA 2LUQA 2EMIA 3DQVR 5K3QA 4R2CA 2CT2A 1F2IG 4AQYE 1I94E 2M3HA 1IBME 3M63A 2VJFA 1JOCA 2CRWA 2YQMA 2EOJA 4R8OA 2L2NA 1G25A 4LJNA 4YBTA 2E5LE 4B3SE 2V87A 1WEPA 2EMAA 5A6JA 1UILA 2K4VA 2EL5A 2YU8A 5IT9C 3N9OA 4LF5E 3O33A 2EMGA 2CSZA 5KL7A 3H7HA 1J5EE 3N9NA 2XB1A 3BBGA 4LKAA 3L1ZB 2ECGA 3U5PA 2FSAA 3HQ1A 3MSWA 1QNTA 4B3TE 2RS6A 3IWCA 5SVIB 1PJTA 2M85A 5SVXA 2EN7A 5KH9A 3UK3C 2YW8A 1J26A 2YTDA 4L5NC 4LFCE 1LDJB 1YUJA 2MNYA 2DRPA 2YTGA 2RR4A 1WRJA 3C5KA 4F52B 2KYUA 2L3CA 4GEQB 3U5MA 4X62E 1WEEA 1PKPA 3ADGA 1EKZA 4M30A 4DV7E 3AUZA 3BGHA 4ZYEA 5AASA 2UXDE 3FL2A 1IQOA 4FJCA 5G05B 4Z0RA 2ECIA 1LDKC 3OTOE 2VPBA 2LAUA 2RS7A 3HCSA 4X8WA 2DSMA 1HYJA 2EOYA 2GHFA 5B8DA 1JM7A 1DVPA 3M62A 2MA6A 4UI9B 3MHSC 3J80C 4FO9A 1XMOE 2YT5A 2FTXB 4F9BB 2F4VE 1T38A 2WBUA 1WGMA 3ADIA 1X4UA 3GV4A 3VHTB 2MC6A 2QICA 5LMUE 1Z1BA 3RTRB 2KOUA 2CSVA 4IS1C 2XP0A 5AE1A 2L8TA 1WHQA 2EOEA 3TQMA 3RPGB 2EPZA 4MSXA 3VYXA 2E6RA 2YT4A 2MD8C 5LLQA 4JI3E 4DR6E 1WEOA 4JI2E 3ADJA 2NUGA 4MVTA 4V3LC 2VF1A 2B0OE 5A6BD 5B79A 1GTKA 4JI1E 3C6KA 4PPEA 2DB2A 2JRJA 2R1FA 5H1UA 2HJJA 5IWAE 3FEHA 5D1LB 4A4BA 3O47A 2KR4A 2EMZA 2HHHE 1K2FA 4Q28A 2M6MA 5EYAF 2R76A 1WXRA 2CKLB 2CKLA 4YATA 2NUEA 2EOHA 2E61A 4X9JA 3BIDA 4B7YC 1ZU1A 2LRIC 2YTIA 2L3JA 2KKXA 4DR4E 1U6GB 4TUIA 1BBOA 1TF3A 4WZ3B 2JMJA 4YBMA 1G2DC 1VD4A 3HCUA 4DR5E 1WHNA 1Z6UA 3EPHA 2E6SA 2QIZA 1X3CA 3DJWA 2ZM6E 2J7JA 2L2KB 2MT5A 2EM9A 2LGGA 2D9HA 4GKKE 4BHCA 4WYQB 2HDPA 1V87A 2XOCA 2FGGA 4LU9A 5LL6R 2Y43A 4N4FA 1IBKE 2ELZA 2H0DB 2P57A 2EN4A 4O64A 3ECRA 2LDRA 5AC4A 4YADA 1ZBQA 2EN8A 3ZPV1 2LGKA 1MGTA 4DKKA 2HGHA 4YBSA 4DUYE 2PNXA 2DX8A 4WXCA 5DINA 2L43A 3T7LA 4I8OA 4HEIA 3QZVA 2PUYA 5LKXA 1X49A 4F2JC 2GLIA 2EPCA 4GNFA 4Z0OA 4S3OB 1BBGA 2M1RA 1WILA 3FAOA 3LQHA 5BR8E 4JYAE 2F6NA 3THOB 1WEMA 2KREA 3SOUA 1GZ6A 4O43A 2FUUA 3PLWA 2L33A 1DGCA 5A2QC 2WCC3 1LLMC 2RTXA 2K16A 5H9MA 1WENA 2QJ0A 2EMCA 4HTGA 2VRDA 1MM2A 3KQIA 3HCTA 3VK6A 4M9VC 3SOXA 1SR9A 1A1GA 4R2PA 2G43A 1HR0E 2D8UA 4FIPA 1EH7A 3LVRE 4YC9A 3O70A 4N3WA 4LF4E 4RH8A 4LF6E 1X6FA 3THNA 2EA6A 1WFKA 3MDBC 2LTSA 4PTBA 2JWOA 1TN9A 5T6JA 4IC3A 2H36X 4AUQB 1AH5A 2MDGA 4WZ2A 2LCEA 2ODRD 2V83A 2C2VS 1HNXE 2EMXA 1T4LB 2RSMA 1BB8A 1T1HA 4DR7E 1DI2A 1Z60A 4AVXA 1E4UA 2I13A 3ASLA 4JV5E 3IWBA 2L2MA 2JPAA 5LKTA 4XI1A 2JOBA 4FK5A 4JI8E 4WA6A 3OMLA 4LF9E 4JI4E 2EPPA 2EM6A 4B3ME 3PUQA 4WPYA 3SOWA 3O37A 5TDWA 5ADZA 5B77A 4DV0E 1JK2A 3U5OA 3EPLA 2ODRC 4NZVA 2LT7A 2YTNA 3I2DA 4BC9A
chains in the Genus database with same CATH topology
2YZTA 2LQ6A 4LTYA 1QU6A 4BCAA 5AE2A 4L7XA 5D1MB 1YYKA 2DSYA 2MUMA 4WZ0A 2JMDA 2NA2A 2YU4A 2UUBE 4BHWA 3EB6A 5G0FA 3EB5A 4X65E 4YY3E 4R8PK 3LLHA 1X48A 1FBVA 2YHOA 4IC2A 4YABA 2L92A 2V89A 4GNDA 2ECTA 3O7AA 2ECJA 2VQEE 2KWNA 2YYRA 3MHSA 4Q6FA 4J8ZA 4DV3E 5DKAA 2OXQC 2LN0A 3JTZA 4WSPA 2KU3A 5B78A 2EWLA 1WEWA 3ADLA 1STUA 2LXHC 2CPNA 2ZETC 2K1JA 2JMIA 2LE2A 4OX9E 2IDAA 2YURA 2UXBE 3ZYQA 2K4DA 3MHHA 5J3XA 5LCWB 2LBSB 1ZBDB 2VE7C 2M1SA 4R2YA 2G6QA 3PHDA 2MNZA 3SHBA 5F3WA 4CCGX 2UZGA 3O34A 2VPGA 4OOGC 3IWDA 4F54A 4GNEA 2NAAA 3M99A 3HXLA 4P5OB 4LADB 1N32E 4LF8E 3HTKC 3L11A 3N9MA 3T1YE 1IBLE 2IHR1 3RMPA 3LQIA 5JG6A 2N3HA 1WEQA 3N9LA 2L0BA 2Y1MA 4ZUXU 1FJGE 2VJEB 4W4UA 4JI0E 1UHZA 4B3RE 3KV6A 4BMJA 1HNZE 2KIZA 2UU9E 1YZ9A 5C13A 4C9ZA 4LFBE 1N34E 5TRBA 3ZTGA 4AYCB 1ZBTA 2MDRA 2VPDA 5LKZA 3J7Yp 2F42A 5AIUA 3H09A 1BORA 5TDRA 5LKUA 2V86A 5FB1A 1VFYA 1O0WA 4I7BA 5I3LA 2F6JA 4LK9A 2UUAE 1N36E 3HPZA 4B86C 2UUCE 4P78A 2L5UA 4L58A 2LRSA 3DF6A 4KZSA 4M2ZA 4A49A 2EODA 4L8NA 2G45A 4GKJE 3ZPVE 5DNYA 1RQ0A 4NXME 4BC7A 3GL6A 2MD7B 2LMZA 4BS9A 3HPSA 4DR3E 4F9CB 3VYYA 4V3KC 2F8BA 1DQ3A 4ZQLA 2VQFE 4DV2E 3K6QA 4GB0A 2KGIA 2KWOA 3N9PA 2JVAA 1T4OA 2ECWA 3U5NA 3J7AG 5FERA 2RI7A 4GNGA 2L6MA 5FLXC 2AN6A 5AE3A 2KONA 1Z2QA 1IYMA 2KHXA 1VYXA 5KH7A 2V8QB 2LV9A 5AITA 4X66E 2H0DA 2EZ6A 4A0CD 1WIMA 1F62A 2KWKA 2D8SA 4LFAE 2I50A 5B75A 2KWJA 5C11A 4DR1E 3ZOQB 3KNVA 2B3TB 3KWRA 3NG2A 4BBYA 2ECNA 1XMQE 4S3OC 3P1XA 1XNQE 3LRQA 2JR1A 2VNFA 4DV1E 1WE9A 3C6WA 4JI6E 3O35A 1T4NA 3J81C 2YUCA 4I7DA 3ZNIA 2JY9A 2YREA 4DV6E 2JOXA 4JI5E 4I7CA 1FKAE 3KV5A 4NXNE 4F9AB 3T6RA 1GQEA 3ZVYA 3ZVZB 2DMYA 2Y1NA 3LQJA 3IHPA 2LGVA 3F6GA 4AYCA 3L1XA 2G7HA 3RPGC 3JAMC 3F6HA 2B7TA 1X4IA 4R03A 5KH3A 2EGPA 2FUIA 2N3GA 1JM7B 4YHHE 3FIGA 3V43A 1HNWE 2V85A 2KFTA 4TKPB 4A4CA 2YHNA 2VJFB 2K17A 4WFTA 4AP4A 1N33E 5H1VA 3N9QA 5TBNA 3JU0A 3AV0A 2VPEA 4X3GA 1RC7A 5LMNE 4NN2A 2B9DA 2M4IA 2LTRA 2LXPC 5TABA 2MA5A 1X47A 4TUGA 2UXCE 1WESA 4UP0A 5CFFE 1HYIA 1RMDA 4ZDTA 2CSYA 5H1TA 2MC5A 4DMIA 1CHCA 4QF2A 4DV4E 4LF7E 2VP7A 2LUPB 2DIXA 1FP0A 1X4JA 5FB0A 2LGLA 2L75A 4QF3A 5D1KB 3C4TA 2V88A 2ECVA 3LMLA 4LLBA 2KGGA 2YSMA 3DPLR 1WEVA 5FEYA 1MM3A 2L80A 2XEUA 1YYOA 4K0KE 2NUFA 2YSJA 5B76A 2RSDA 3O36A 2YQLA 2FV4B 2BAYA 4R7EA 2MIQA 1XWHA 4UP5A 4M0VA 4YAXA 4CA1A 1N87A 2LJHA 1YYWA 1WEUA 2M7QA 4X64E 3C4BA 2WZOA 4P7DA 3T1HE 3HTXA 4BBQA 3PURA 2HYED 2KE1A 4DR2E 1XNRE 4KHPE 4DUZE 4DV5E 2C2LA 2E1MA 2VJEA 4JI7E 5G04B 2B7VA 2LUQA 3DQVR 2CT2A 1IBME 4AQYE 1I94E 2M3HA 3M63A 2VJFA 1JOCA 2YQMA 4R8OA 2L2NA 1G25A 4LJNA 4YBTA 2E5LE 4B3SE 2V87A 1WEPA 1UILA 2K4VA 5IT9C 3N9OA 4LF5E 3O33A 2CSZA 1J5EE 3N9NA 2XB1A 4LKAA 3L1ZB 2ECGA 3U5PA 2FSAA 3HQ1A 3MSWA 4B3TE 2RS6A 3IWCA 2M85A 5KH9A 1J26A 2YW8A 4L5NC 4LFCE 1LDJB 2MNYA 3C5KA 4F52B 2KYUA 2L3CA 4GEQB 3U5MA 4X62E 1WEEA 1PKPA 3ADGA 1EKZA 4M30A 4DV7E 3AUZA 5AASA 2UXDE 3FL2A 4FJCA 5G05B 2ECIA 1LDKC 3OTOE 2VPBA 2RS7A 3HCSA 4X8WA 1HYJA 5B8DA 1JM7A 1DVPA 3M62A 2MA6A 4UI9B 3J80C 4FO9A 1XMOE 2YT5A 2FTXB 4F9BB 2F4VE 1WGMA 3ADIA 1X4UA 3GV4A 2MC6A 2QICA 5LMUE 3RTRB 2KOUA 5AE1A 2L8TA 1WHQA 3RPGB 3VYXA 4MSXA 2E6RA 2YT4A 2MD8C 4DR6E 4JI3E 1WEOA 4JI2E 3ADJA 2NUGA 4MVTA 4V3LC 2VF1A 5B79A 4JI1E 4PPEA 2DB2A 2JRJA 5H1UA 5IWAE 5D1LB 4A4BA 2KR4A 2HHHE 1K2FA 4Q28A 2M6MA 5EYAF 1WXRA 2CKLB 2CKLA 4YATA 2NUEA 4B7YC 2L3JA 2LRIC 4DR4E 1U6GB 4TUIA 4WZ3B 2JMJA 4YBMA 1VD4A 3HCUA 4DR5E 1WHNA 1Z6UA 2E6SA 2QIZA 3DJWA 2ZM6E 2L2KB 2MT5A 2LGGA 4GKKE 4WYQB 2HDPA 1V87A 2FGGA 4LU9A 5LL6R 1IBKE 2Y43A 4N4FA 2H0DB 4O64A 2LDRA 4YADA 1ZBQA 3ZPV1 2LGKA 4DKKA 4YBSA 4DUYE 2PNXA 2DX8A 5DINA 2L43A 3T7LA 4I8OA 3QZVA 2PUYA 5LKXA 1X49A 4GNFA 4S3OB 2M1RA 1WILA 3LQHA 5BR8E 4JYAE 2F6NA 1WEMA 2KREA 3SOUA 1GZ6A 2FUUA 2L33A 5A2QC 2RTXA 2K16A 5H9MA 1WENA 2QJ0A 1MM2A 3KQIA 3HCTA 3VK6A 3SOXA 1SR9A 2G43A 1HR0E 4FIPA 4YC9A 3O70A 4N3WA 4LF4E 4LF6E 2EA6A 1WFKA 2LTSA 4PTBA 2JWOA 5T6JA 4IC3A 2H36X 4AUQB 4WZ2A 2ODRD 2V83A 2C2VS 1HNXE 1T4LB 2RSMA 1T1HA 4DR7E 1DI2A 1Z60A 4AVXA 1E4UA 3ASLA 4JV5E 3IWBA 2L2MA 5LKTA 4XI1A 2JOBA 4FK5A 4JI8E 4WA6A 3OMLA 4LF9E 4JI4E 4B3ME 3PUQA 4WPYA 3SOWA 3O37A 5TDWA 5ADZA 5B77A 4DV0E 3U5OA 2ODRC 3I2DA 4BC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQ6 A;  4L7X A;  5D1M B;  2MUM A;  4WZ0 A;  2JMD A;  2YU4 A;  4BHW A;  3EB6 A;  5G0F A;  3EB5 A;  4R8P K;  1FBV A;  2YHO A;  4IC2 A;  4YAB A;  4GND A;  2ECT A;  3O7A A;  2ECJ A;  2KWN A;  2YYR A;  3MHS A;  4Q6F A;  5DKA A;  2OXQ C;  2LN0 A;  2KU3 A;  5B78 A;  1WEW A;  2LXH C;  2ZET C;  2K1J A;  2JMI A;  2IDA A;  2YUR A;  3ZYQ A;  2K4D A;  3MHH A;  5J3X A;  5LCW B;  1ZBD B;  4R2Y A;  2G6Q A;  3PHD A;  2MNZ A;  3SHB A;  4CCG X;  2UZG A;  3O34 A;  2VPG A;  4GNE A;  2NAA A;  3M99 A;  4P5O B;  4LAD B;  3HTK C;  3L11 A;  3N9M A;  3LQI A;  5JG6 A;  1WEQ A;  3N9L A;  2L0B A;  2Y1M A;  4ZUX U;  2VJE B;  4W4U A;  3KV6 A;  2KIZ A;  5C13 A;  4C9Z A;  5TRB A;  3ZTG A;  4AYC B;  2VPD A;  5LKZ A;  2F42 A;  5AIU A;  1BOR A;  5TDR A;  5LKU A;  5FB1 A;  1VFY A;  4I7B A;  5I3L A;  2F6J A;  4LK9 A;  4B86 C;  2L5U A;  4L58 A;  4A49 A;  2EOD A;  2G45 A;  3ZPV E;  3GL6 A;  2MD7 B;  4V3K C;  4ZQL A;  4GB0 A;  2KGI A;  2KWO A;  3N9P A;  2ECW A;  3U5N A;  5FER A;  2RI7 A;  4GNG A;  2AN6 A;  1Z2Q A;  1IYM A;  1VYX A;  5KH7 A;  2LV9 A;  5AIT A;  2H0D A;  4A0C D;  1WIM A;  1F62 A;  2KWK A;  2D8S A;  2I50 A;  5B75 A;  2KWJ A;  5C11 A;  3KNV A;  3NG2 A;  2ECN A;  4S3O C;  3LRQ A;  2VNF A;  1WE9 A;  3C6W A;  3O35 A;  2YUC A;  4I7D A;  3ZNI A;  2YRE A;  4I7C A;  3KV5 A;  3T6R A;  3ZVY A;  3ZVZ B;  2Y1N A;  3LQJ A;  3IHP A;  2LGV A;  4AYC A;  3L1X A;  3RPG C;  1X4I A;  5KH3 A;  2EGP A;  2FUI A;  1JM7 B;  3V43 A;  2KFT A;  4TKP B;  4A4C A;  2YHN A;  2VJF B;  2K17 A;  4AP4 A;  5H1V A;  3N9Q A;  5TBN A;  2VPE A;  4X3G A;  4NN2 A;  2LXP C;  5TAB A;  2MA5 A;  1WES A;  4UP0 A;  1HYI A;  1RMD A;  4ZDT A;  2CSY A;  5H1T A;  1CHC A;  4QF2 A;  2VP7 A;  1FP0 A;  1X4J A;  5FB0 A;  2LGL A;  2L75 A;  4QF3 A;  5D1K B;  2ECV A;  4LLB A;  2KGG A;  2YSM A;  3DPL R;  1WEV A;  5FEY A;  1MM3 A;  2L80 A;  2XEU A;  2YSJ A;  5B76 A;  2RSD A;  3O36 A;  2YQL A;  2BAY A;  4R7E A;  2MIQ A;  1XWH A;  4UP5 A;  4YAX A;  4CA1 A;  1N87 A;  1WEU A;  4BBQ A;  3PUR A;  2HYE D;  2KE1 A;  2C2L A;  2VJE A;  5G04 B;  3DQV R;  2CT2 A;  2M3H A;  3M63 A;  2VJF A;  1JOC A;  2YQM A;  1G25 A;  4LJN A;  4YBT A;  1WEP A;  3N9O A;  3O33 A;  2CSZ A;  3N9N A;  2XB1 A;  4LKA A;  3L1Z B;  2ECG A;  3U5P A;  2FSA A;  2M85 A;  5KH9 A;  2YW8 A;  1LDJ B;  2MNY A;  3C5K A;  4F52 B;  2KYU A;  3U5M A;  1WEE A;  3FL2 A;  4FJC A;  5G05 B;  2ECI A;  1LDK C;  2VPB A;  3HCS A;  1HYJ A;  5B8D A;  1JM7 A;  1DVP A;  3M62 A;  2MA6 A;  4UI9 B;  4FO9 A;  2YT5 A;  1WGM A;  1X4U A;  3GV4 A;  2QIC A;  3RTR B;  3RPG B;  4MSX A;  2E6R A;  2MD8 C;  1WEO A;  4MVT A;  4V3L C;  5B79 A;  4PPE A;  2JRJ A;  5H1U A;  5D1L B;  4A4B A;  2KR4 A;  1K2F A;  2M6M A;  5EYA F;  2CKL B;  2CKL A;  4YAT A;  4B7Y C;  2LRI C;  1U6G B;  4WZ3 B;  2JMJ A;  4YBM A;  1VD4 A;  3HCU A;  1Z6U A;  2E6S A;  2QIZ A;  2MT5 A;  2LGG A;  2HDP A;  1V87 A;  2Y43 A;  4N4F A;  2H0D B;  4O64 A;  2LDR A;  4YAD A;  3ZPV 1;  2LGK A;  4YBS A;  2PNX A;  2DX8 A;  5DIN A;  2L43 A;  3T7L A;  3QZV A;  2PUY A;  5LKX A;  4GNF A;  4S3O B;  2M1R A;  1WIL A;  3LQH A;  2F6N A;  1WEM A;  2KRE A;  3SOU A;  2FUU A;  2K16 A;  5H9M A;  1WEN A;  2QJ0 A;  1MM2 A;  3KQI A;  3HCT A;  3VK6 A;  3SOX A;  2G43 A;  4FIP A;  4YC9 A;  3O70 A;  4N3W A;  2EA6 A;  1WFK A;  4PTB A;  4IC3 A;  4AUQ B;  4WZ2 A;  2C2V S;  1T1H A;  1Z60 A;  4AVX A;  1E4U A;  3ASL A;  5LKT A;  4XI1 A;  4FK5 A;  4WA6 A;  3PUQ A;  3SOW A;  3O37 A;  5TDW A;  5B77 A;  3U5O A;  3I2D A; 
#chains in the Genus database with same CATH topology
 2YZT A;  2LQ6 A;  4LTY A;  1QU6 A;  2DLK A;  4BCA A;  4L7X A;  5AE2 A;  5D1M B;  1YYK A;  2DSY A;  2JXP A;  2EMB A;  2MUM A;  4WZ0 A;  2RPC A;  1UBD C;  2JMD A;  2MKE A;  2EPX A;  4R2S A;  5A6K A;  2ENC A;  2NA2 A;  2YU4 A;  2UUB E;  2GPI A;  4BHW A;  3EB6 A;  5G0F A;  1MBM A;  3EB5 A;  5IXM B;  4X65 E;  4YY3 E;  3LJU X;  4R8P K;  1X48 A;  3LLH A;  1FBV A;  2A25 A;  1EH8 A;  2YHO A;  3DDT A;  4IC2 A;  4YAB A;  2L92 A;  2N8X A;  4GND A;  2EXU A;  2V89 A;  2ECT A;  3O7A A;  2ECJ A;  2VQE E;  2KWN A;  2YYR A;  5KL6 A;  2EOI A;  2KKY A;  3MHS A;  4Q6F A;  2WBS A;  4J8Z A;  4DV3 E;  5DKA A;  2OXQ C;  1NCS A;  2LN0 A;  4QQ4 A;  2EPU A;  3JTZ A;  4WSP A;  1JK1 A;  2KU3 A;  5B78 A;  2EWL A;  1WEW A;  3ADL A;  1STU A;  2LXH C;  2CPN A;  4N4R B;  1A1L A;  2ZET C;  2K1J A;  2JMI A;  2LE2 A;  4OX9 E;  2EM2 A;  2IDA A;  2YUR A;  3JUE A;  2UXB E;  3ZYQ A;  4WX9 A;  2K4D A;  3MHH A;  3FM8 C;  5J3X A;  4R2D A;  4GZN C;  5LCW B;  4R2A A;  2LBS B;  2EPK X;  1ZBD B;  2VE7 C;  2YRH A;  2M1S A;  4R2Y A;  2G6Q A;  3FAN A;  2MNZ A;  3PHD A;  3SHB A;  4CCG X;  2DMI A;  2EM7 A;  3MHH C;  2CRR A;  5F3W A;  2UZG A;  3O34 A;  2VPG A;  4H9D A;  4OOG C;  1P47 A;  3IWD A;  4IJD A;  4GNE A;  4F54 A;  2PRT A;  2NAA A;  3M99 A;  3HXL A;  4P5O B;  4LAD B;  1N32 E;  4LF8 E;  3HTK C;  3L11 A;  3N9M A;  3T1Y E;  1IBL E;  2EPL X;  2IHR 1;  2L7P A;  3RMP A;  3LQI A;  5JG6 A;  2N3H A;  1WEQ A;  3N9L A;  2ELY A;  2L0B A;  2Y1M A;  2EM8 A;  4ZUX U;  3E2D A;  3BF2 A;  1FJG E;  2VJE B;  2EPN A;  4W4U A;  2EP3 A;  4JI0 E;  2EN3 A;  2EQ3 A;  1UHZ A;  1AAY A;  4B3R E;  3KV6 A;  4BMJ A;  2DJA A;  2EM5 A;  2EN1 A;  1HNZ E;  2KIZ A;  2UU9 E;  3M99 B;  1YZ9 A;  5C13 A;  5TSE A;  4C9Z A;  1YSA C;  4LFB E;  4BHB A;  1N34 E;  5TRB A;  3ZTG A;  4AYC B;  1ZBT A;  2MDR A;  1TF6 A;  1N3G A;  2VPD A;  5LKZ A;  3J7Y p;  2F42 A;  5AIU A;  3H09 A;  4MLV A;  2EOS A;  1ZAA C;  2EOZ A;  2M13 A;  1BOR A;  5TDR A;  5LKU A;  2NAB A;  2V86 A;  3SUB A;  5FB1 A;  1VFY A;  1PJQ A;  1O0W A;  4I7B A;  5I3L A;  2DLQ A;  2F6J A;  4LK9 A;  5A69 A;  2UUA E;  2EM4 A;  3HPZ A;  4B86 C;  1N36 E;  2UUC E;  4MLQ A;  4FK5 C;  4P78 A;  2L5U A;  4L58 A;  2LRS A;  2YSP A;  3DF6 A;  4KWY A;  3M7K A;  4A49 A;  4KZS A;  4M2Z A;  2EOD A;  2BB8 A;  1DCQ A;  2WBT A;  4L8N A;  2G45 A;  4GKJ E;  1MEY C;  3ZPV E;  5DNY A;  1RQ0 A;  4NXM E;  4BC7 A;  3GL6 A;  2YTE A;  5KL2 A;  2EE8 A;  2MD7 B;  2LMZ A;  4BS9 A;  3HPS A;  2EJ4 A;  4O5G A;  4DR3 E;  2EOM A;  4F9C B;  2FFW A;  2JM3 A;  4WXD A;  4V3K C;  2ENA A;  2EQ0 A;  2LJU A;  5KL5 A;  2F8B A;  3VYY A;  1DQ3 A;  4ZQL A;  2VQF E;  4DV2 E;  3K6Q A;  2JP9 A;  2YVR A;  4GB0 A;  3KZY A;  2KGI A;  2KWO A;  3N9P A;  1UN6 B;  4OGC A;  2EMF A;  2JVA A;  1B69 A;  4NHR A;  4R2Q A;  1T4O A;  2YRK A;  2ECW A;  3U5N A;  3J7A G;  5FER A;  2RI7 A;  4GNG A;  2L6M A;  5FLX C;  2AN6 A;  2YWQ A;  4ZYG A;  5AE3 A;  2KON A;  1Z2Q A;  1IYM A;  2EOX A;  2KHX A;  1VYX A;  5KH7 A;  2V8Q B;  2LV9 A;  4O4K A;  1IQS A;  2EMW A;  5AIT A;  2Q8U A;  4X66 E;  1T39 A;  2H0D A;  2EZ6 A;  2EGM A;  2CT1 A;  2K7I A;  4A0C D;  1WIM A;  1F62 A;  2KWK A;  2YTP A;  2D8S A;  4LFA E;  2I50 A;  5B75 A;  2KWJ A;  5C11 A;  1KJK A;  4DR1 E;  3ZOQ B;  3KNV A;  2B3T B;  3KWR A;  3NG2 A;  4BBY A;  2ECN A;  1XMQ E;  4S3O C;  3P1X A;  2I9I A;  2YTF A;  1XNQ E;  3LRQ A;  1X6E A;  2JR1 A;  2VNF A;  4DV1 E;  1WE9 A;  2MKN A;  4O62 A;  2EOQ A;  2EPA A;  5KL3 A;  3C6W A;  4JI6 E;  3LDY A;  3O35 A;  2EL4 A;  2EOR A;  1T4N A;  1EH6 A;  3J81 C;  4ZYH A;  2YUC A;  2EOO A;  4F1P A;  4I7D A;  2MKD A;  3ZNI A;  2JY9 A;  2FD4 A;  2YRE A;  4DV6 E;  2JOX A;  4JI5 E;  2EPO A;  4RHB B;  3L00 A;  1WJP A;  2EQ1 A;  4I7C A;  1FKA E;  3KV5 A;  4F6N A;  1A1I A;  4NXN E;  4F9A B;  3T6R A;  1GQE A;  3ZVY A;  3ZVZ B;  2EM0 A;  2LV2 A;  3QG5 C;  4O24 A;  2DMY A;  2Y1N A;  3LQJ A;  3IHP A;  2EMK A;  2LGV A;  2JYA A;  2CON A;  1A1H A;  1PDA A;  4AYC A;  3L1X A;  2G7H A;  3F6G A;  3RPG C;  3JAM C;  3EPK A;  3F6H A;  2B7T A;  1X4I A;  4R03 A;  5KH3 A;  2EGP A;  2FUI A;  3LVQ E;  4WSG A;  2N3G A;  1JM7 B;  4YHH E;  2YSO A;  4ZYD A;  3FIG A;  1KYQ A;  3V43 A;  1HNW E;  2V85 A;  2KFT A;  3FJU B;  1YUI A;  1A1F A;  4TKP B;  2EN2 A;  4A4C A;  4R2R A;  2DGC A;  2XOY A;  2IQJ A;  2YHN A;  2ENH A;  2VJF B;  2OWA A;  2K17 A;  4WFT A;  2EL6 A;  2EMY A;  4AP4 A;  1N33 E;  5H1V A;  3N9Q A;  2EOF A;  1L4S A;  5TBN A;  3KZZ A;  3JU0 A;  2YTQ A;  3AV0 A;  2VPE A;  2RQL A;  1A1J A;  2M9A A;  3DWD A;  4X3G A;  2CTD A;  2EN6 A;  2HC5 A;  1RC7 A;  5LMN E;  4NN2 A;  2B9D A;  2M4I A;  2YTO A;  2LTR A;  2BBG A;  2LXP C;  5TAB A;  5SVI A;  1YPN A;  1YFH A;  3Q1D A;  2MA5 A;  1X47 A;  4TUG A;  2RSI A;  2UXC E;  1WES A;  2LO3 A;  4UP0 A;  5CFF E;  2EPM X;  4Q35 B;  1HYI A;  1RMD A;  4ZDT A;  2CSY A;  5H1T A;  2EM3 A;  2MC5 A;  4F6M A;  4DMI A;  1CHC A;  4QF2 A;  1PJS A;  4DV4 E;  2YRM A;  1A1K A;  4LF7 E;  5A6B A;  2VP7 A;  1IMU A;  3EPJ A;  2LUP B;  2DIX A;  1FP0 A;  1X4J A;  5FB0 A;  2LGL A;  3EQ1 A;  2YPN A;  1NEI A;  2LVH A;  2L75 A;  4QF3 A;  5D1K B;  3C4T A;  5IV8 B;  2V88 A;  2ECV A;  2EML A;  4LLB A;  3LML A;  2KGG A;  2YSM A;  3DPL R;  1WEV A;  5FEY A;  1MM3 A;  2L80 A;  2XEU A;  1YYO A;  4K0K E;  5SVY A;  3KDE C;  4OGE A;  2YSJ A;  5B76 A;  1X5W A;  2RSD A;  3O36 A;  3C6M A;  2YQL A;  5A6A A;  2NUF A;  2FV4 B;  2BAY A;  4R7E A;  2MIQ A;  2JUN A;  1X6H A;  2YU5 A;  1XWH A;  4UP5 A;  4M0V A;  4YAX A;  4CA1 A;  1N87 A;  2LJH A;  3T9K A;  1WEU A;  2M7Q A;  1YYW A;  5KL4 A;  2YTJ A;  4X64 E;  2XOZ A;  3C4B A;  1SFE A;  2WZO A;  4P7D A;  3T1H E;  3HTX A;  2ADR A;  2CSH A;  1G2F C;  4BBQ A;  3PUR A;  2HYE D;  2E72 A;  2KE1 A;  4DR2 E;  5AC5 A;  1XNR E;  2EPR A;  2EMH A;  4KHP E;  4R2E A;  4DUZ E;  4DV5 E;  1ZR9 A;  2C2L A;  2E1M A;  2VJE A;  4JI7 E;  5G04 B;  2B7V A;  2LUQ A;  2EMI A;  3DQV R;  5K3Q A;  4R2C A;  2CT2 A;  1F2I G;  4AQY E;  1I94 E;  2M3H A;  1IBM E;  3M63 A;  2VJF A;  1JOC A;  2CRW A;  2YQM A;  2EOJ A;  4R8O A;  2L2N A;  1G25 A;  4LJN A;  4YBT A;  2E5L E;  4B3S E;  2V87 A;  1WEP A;  2EMA A;  5A6J A;  1UIL A;  2K4V A;  2EL5 A;  2YU8 A;  5IT9 C;  3N9O A;  4LF5 E;  3O33 A;  2EMG A;  2CSZ A;  5KL7 A;  3H7H A;  1J5E E;  3N9N A;  2XB1 A;  3BBG A;  4LKA A;  3L1Z B;  2ECG A;  3U5P A;  2FSA A;  3HQ1 A;  3MSW A;  1QNT A;  4B3T E;  2RS6 A;  3IWC A;  5SVI B;  1PJT A;  2M85 A;  5SVX A;  2EN7 A;  5KH9 A;  3UK3 C;  2YW8 A;  1J26 A;  2YTD A;  4L5N C;  4LFC E;  1LDJ B;  1YUJ A;  2MNY A;  2DRP A;  2YTG A;  2RR4 A;  1WRJ A;  3C5K A;  4F52 B;  2KYU A;  2L3C A;  4GEQ B;  3U5M A;  4X62 E;  1WEE A;  1PKP A;  3ADG A;  1EKZ A;  4M30 A;  4DV7 E;  3AUZ A;  3BGH A;  4ZYE A;  5AAS A;  2UXD E;  3FL2 A;  1IQO A;  4FJC A;  5G05 B;  4Z0R A;  2ECI A;  1LDK C;  3OTO E;  2VPB A;  2LAU A;  2RS7 A;  3HCS A;  4X8W A;  2DSM A;  1HYJ A;  2EOY A;  2GHF A;  5B8D A;  1JM7 A;  1DVP A;  3M62 A;  2MA6 A;  4UI9 B;  3MHS C;  3J80 C;  4FO9 A;  1XMO E;  2YT5 A;  2FTX B;  4F9B B;  2F4V E;  1T38 A;  2WBU A;  1WGM A;  3ADI A;  1X4U A;  3GV4 A;  3VHT B;  2MC6 A;  2QIC A;  5LMU E;  1Z1B A;  3RTR B;  2KOU A;  2CSV A;  4IS1 C;  2XP0 A;  5AE1 A;  2L8T A;  1WHQ A;  2EOE A;  3TQM A;  3RPG B;  2EPZ A;  4MSX A;  3VYX A;  2E6R A;  2YT4 A;  2MD8 C;  5LLQ A;  4JI3 E;  4DR6 E;  1WEO A;  4JI2 E;  3ADJ A;  2NUG A;  4MVT A;  4V3L C;  2VF1 A;  2B0O E;  5A6B D;  5B79 A;  1GTK A;  4JI1 E;  3C6K A;  4PPE A;  2DB2 A;  2JRJ A;  2R1F A;  5H1U A;  2HJJ A;  5IWA E;  3FEH A;  5D1L B;  4A4B A;  3O47 A;  2KR4 A;  2EMZ A;  2HHH E;  1K2F A;  4Q28 A;  2M6M A;  5EYA F;  2R76 A;  1WXR A;  2CKL B;  2CKL A;  4YAT A;  2NUE A;  2EOH A;  2E61 A;  4X9J A;  3BID A;  4B7Y C;  1ZU1 A;  2LRI C;  2YTI A;  2L3J A;  2KKX A;  4DR4 E;  1U6G B;  4TUI A;  1BBO A;  1TF3 A;  4WZ3 B;  2JMJ A;  4YBM A;  1G2D C;  1VD4 A;  3HCU A;  4DR5 E;  1WHN A;  1Z6U A;  3EPH A;  2E6S A;  2QIZ A;  1X3C A;  3DJW A;  2ZM6 E;  2J7J A;  2L2K B;  2MT5 A;  2EM9 A;  2LGG A;  2D9H A;  4GKK E;  4BHC A;  4WYQ B;  2HDP A;  1V87 A;  2XOC A;  2FGG A;  4LU9 A;  5LL6 R;  2Y43 A;  4N4F A;  1IBK E;  2ELZ A;  2H0D B;  2P57 A;  2EN4 A;  4O64 A;  3ECR A;  2LDR A;  5AC4 A;  4YAD A;  1ZBQ A;  2EN8 A;  3ZPV 1;  2LGK A;  1MGT A;  4DKK A;  2HGH A;  4YBS A;  4DUY E;  2PNX A;  2DX8 A;  4WXC A;  5DIN A;  2L43 A;  3T7L A;  4I8O A;  4HEI A;  3QZV A;  2PUY A;  5LKX A;  1X49 A;  4F2J C;  2GLI A;  2EPC A;  4GNF A;  4Z0O A;  4S3O B;  1BBG A;  2M1R A;  1WIL A;  3FAO A;  3LQH A;  5BR8 E;  4JYA E;  2F6N A;  3THO B;  1WEM A;  2KRE A;  3SOU A;  1GZ6 A;  4O43 A;  2FUU A;  3PLW A;  2L33 A;  1DGC A;  5A2Q C;  2WCC 3;  1LLM C;  2RTX A;  2K16 A;  5H9M A;  1WEN A;  2QJ0 A;  2EMC A;  4HTG A;  2VRD A;  1MM2 A;  3KQI A;  3HCT A;  3VK6 A;  4M9V C;  3SOX A;  1SR9 A;  1A1G A;  4R2P A;  2G43 A;  1HR0 E;  2D8U A;  4FIP A;  1EH7 A;  3LVR E;  4YC9 A;  3O70 A;  4N3W A;  4LF4 E;  4RH8 A;  4LF6 E;  1X6F A;  3THN A;  2EA6 A;  1WFK A;  3MDB C;  2LTS A;  4PTB A;  2JWO A;  1TN9 A;  5T6J A;  4IC3 A;  2H36 X;  4AUQ B;  1AH5 A;  2MDG A;  4WZ2 A;  2LCE A;  2ODR D;  2V83 A;  2C2V S;  1HNX E;  2EMX A;  1T4L B;  2RSM A;  1BB8 A;  1T1H A;  4DR7 E;  1DI2 A;  1Z60 A;  4AVX A;  1E4U A;  2I13 A;  3ASL A;  4JV5 E;  3IWB A;  2L2M A;  2JPA A;  5LKT A;  4XI1 A;  2JOB A;  4FK5 A;  4JI8 E;  4WA6 A;  3OML A;  4LF9 E;  4JI4 E;  2EPP A;  2EM6 A;  4B3M E;  3PUQ A;  4WPY A;  3SOW A;  3O37 A;  5TDW A;  5ADZ A;  5B77 A;  4DV0 E;  1JK2 A;  3U5O A;  3EPL A;  2ODR C;  4NZV A;  2LT7 A;  2YTN A;  3I2D A;  4BC9 A; 
#chains in the Genus database with same CATH homology
 2YZT A;  2LQ6 A;  4LTY A;  1QU6 A;  4BCA A;  5AE2 A;  4L7X A;  5D1M B;  1YYK A;  2DSY A;  2MUM A;  4WZ0 A;  2JMD A;  2NA2 A;  2YU4 A;  2UUB E;  4BHW A;  3EB6 A;  5G0F A;  3EB5 A;  4X65 E;  4YY3 E;  4R8P K;  3LLH A;  1X48 A;  1FBV A;  2YHO A;  4IC2 A;  4YAB A;  2L92 A;  2V89 A;  4GND A;  2ECT A;  3O7A A;  2ECJ A;  2VQE E;  2KWN A;  2YYR A;  3MHS A;  4Q6F A;  4J8Z A;  4DV3 E;  5DKA A;  2OXQ C;  2LN0 A;  3JTZ A;  4WSP A;  2KU3 A;  5B78 A;  2EWL A;  1WEW A;  3ADL A;  1STU A;  2LXH C;  2CPN A;  2ZET C;  2K1J A;  2JMI A;  2LE2 A;  4OX9 E;  2IDA A;  2YUR A;  2UXB E;  3ZYQ A;  2K4D A;  3MHH A;  5J3X A;  5LCW B;  2LBS B;  1ZBD B;  2VE7 C;  2M1S A;  4R2Y A;  2G6Q A;  3PHD A;  2MNZ A;  3SHB A;  5F3W A;  4CCG X;  2UZG A;  3O34 A;  2VPG A;  4OOG C;  3IWD A;  4F54 A;  4GNE A;  2NAA A;  3M99 A;  3HXL A;  4P5O B;  4LAD B;  1N32 E;  4LF8 E;  3HTK C;  3L11 A;  3N9M A;  3T1Y E;  1IBL E;  2IHR 1;  3RMP A;  3LQI A;  5JG6 A;  2N3H A;  1WEQ A;  3N9L A;  2L0B A;  2Y1M A;  4ZUX U;  1FJG E;  2VJE B;  4W4U A;  4JI0 E;  1UHZ A;  4B3R E;  3KV6 A;  4BMJ A;  1HNZ E;  2KIZ A;  2UU9 E;  1YZ9 A;  5C13 A;  4C9Z A;  4LFB E;  1N34 E;  5TRB A;  3ZTG A;  4AYC B;  1ZBT A;  2MDR A;  2VPD A;  5LKZ A;  3J7Y p;  2F42 A;  5AIU A;  3H09 A;  1BOR A;  5TDR A;  5LKU A;  2V86 A;  5FB1 A;  1VFY A;  1O0W A;  4I7B A;  5I3L A;  2F6J A;  4LK9 A;  2UUA E;  1N36 E;  3HPZ A;  4B86 C;  2UUC E;  4P78 A;  2L5U A;  4L58 A;  2LRS A;  3DF6 A;  4KZS A;  4M2Z A;  4A49 A;  2EOD A;  4L8N A;  2G45 A;  4GKJ E;  3ZPV E;  5DNY A;  1RQ0 A;  4NXM E;  4BC7 A;  3GL6 A;  2MD7 B;  2LMZ A;  4BS9 A;  3HPS A;  4DR3 E;  4F9C B;  3VYY A;  4V3K C;  2F8B A;  1DQ3 A;  4ZQL A;  2VQF E;  4DV2 E;  3K6Q A;  4GB0 A;  2KGI A;  2KWO A;  3N9P A;  2JVA A;  1T4O A;  2ECW A;  3U5N A;  3J7A G;  5FER A;  2RI7 A;  4GNG A;  2L6M A;  5FLX C;  2AN6 A;  5AE3 A;  2KON A;  1Z2Q A;  1IYM A;  2KHX A;  1VYX A;  5KH7 A;  2V8Q B;  2LV9 A;  5AIT A;  4X66 E;  2H0D A;  2EZ6 A;  4A0C D;  1WIM A;  1F62 A;  2KWK A;  2D8S A;  4LFA E;  2I50 A;  5B75 A;  2KWJ A;  5C11 A;  4DR1 E;  3ZOQ B;  3KNV A;  2B3T B;  3KWR A;  3NG2 A;  4BBY A;  2ECN A;  1XMQ E;  4S3O C;  3P1X A;  1XNQ E;  3LRQ A;  2JR1 A;  2VNF A;  4DV1 E;  1WE9 A;  3C6W A;  4JI6 E;  3O35 A;  1T4N A;  3J81 C;  2YUC A;  4I7D A;  3ZNI A;  2JY9 A;  2YRE A;  4DV6 E;  2JOX A;  4JI5 E;  4I7C A;  1FKA E;  3KV5 A;  4NXN E;  4F9A B;  3T6R A;  1GQE A;  3ZVY A;  3ZVZ B;  2DMY A;  2Y1N A;  3LQJ A;  3IHP A;  2LGV A;  3F6G A;  4AYC A;  3L1X A;  2G7H A;  3RPG C;  3JAM C;  3F6H A;  2B7T A;  1X4I A;  4R03 A;  5KH3 A;  2EGP A;  2FUI A;  2N3G A;  1JM7 B;  4YHH E;  3FIG A;  3V43 A;  1HNW E;  2V85 A;  2KFT A;  4TKP B;  4A4C A;  2YHN A;  2VJF B;  2K17 A;  4WFT A;  4AP4 A;  1N33 E;  5H1V A;  3N9Q A;  5TBN A;  3JU0 A;  3AV0 A;  2VPE A;  4X3G A;  1RC7 A;  5LMN E;  4NN2 A;  2B9D A;  2M4I A;  2LTR A;  2LXP C;  5TAB A;  2MA5 A;  1X47 A;  4TUG A;  2UXC E;  1WES A;  4UP0 A;  5CFF E;  1HYI A;  1RMD A;  4ZDT A;  2CSY A;  5H1T A;  2MC5 A;  4DMI A;  1CHC A;  4QF2 A;  4DV4 E;  4LF7 E;  2VP7 A;  2LUP B;  2DIX A;  1FP0 A;  1X4J A;  5FB0 A;  2LGL A;  2L75 A;  4QF3 A;  5D1K B;  3C4T A;  2V88 A;  2ECV A;  3LML A;  4LLB A;  2KGG A;  2YSM A;  3DPL R;  1WEV A;  5FEY A;  1MM3 A;  2L80 A;  2XEU A;  1YYO A;  4K0K E;  2NUF A;  2YSJ A;  5B76 A;  2RSD A;  3O36 A;  2YQL A;  2FV4 B;  2BAY A;  4R7E A;  2MIQ A;  1XWH A;  4UP5 A;  4M0V A;  4YAX A;  4CA1 A;  1N87 A;  2LJH A;  1YYW A;  1WEU A;  2M7Q A;  4X64 E;  3C4B A;  2WZO A;  4P7D A;  3T1H E;  3HTX A;  4BBQ A;  3PUR A;  2HYE D;  2KE1 A;  4DR2 E;  1XNR E;  4KHP E;  4DUZ E;  4DV5 E;  2C2L A;  2E1M A;  2VJE A;  4JI7 E;  5G04 B;  2B7V A;  2LUQ A;  3DQV R;  2CT2 A;  1IBM E;  4AQY E;  1I94 E;  2M3H A;  3M63 A;  2VJF A;  1JOC A;  2YQM A;  4R8O A;  2L2N A;  1G25 A;  4LJN A;  4YBT A;  2E5L E;  4B3S E;  2V87 A;  1WEP A;  1UIL A;  2K4V A;  5IT9 C;  3N9O A;  4LF5 E;  3O33 A;  2CSZ A;  1J5E E;  3N9N A;  2XB1 A;  4LKA A;  3L1Z B;  2ECG A;  3U5P A;  2FSA A;  3HQ1 A;  3MSW A;  4B3T E;  2RS6 A;  3IWC A;  2M85 A;  5KH9 A;  1J26 A;  2YW8 A;  4L5N C;  4LFC E;  1LDJ B;  2MNY A;  3C5K A;  4F52 B;  2KYU A;  2L3C A;  4GEQ B;  3U5M A;  4X62 E;  1WEE A;  1PKP A;  3ADG A;  1EKZ A;  4M30 A;  4DV7 E;  3AUZ A;  5AAS A;  2UXD E;  3FL2 A;  4FJC A;  5G05 B;  2ECI A;  1LDK C;  3OTO E;  2VPB A;  2RS7 A;  3HCS A;  4X8W A;  1HYJ A;  5B8D A;  1JM7 A;  1DVP A;  3M62 A;  2MA6 A;  4UI9 B;  3J80 C;  4FO9 A;  1XMO E;  2YT5 A;  2FTX B;  4F9B B;  2F4V E;  1WGM A;  3ADI A;  1X4U A;  3GV4 A;  2MC6 A;  2QIC A;  5LMU E;  3RTR B;  2KOU A;  5AE1 A;  2L8T A;  1WHQ A;  3RPG B;  3VYX A;  4MSX A;  2E6R A;  2YT4 A;  2MD8 C;  4DR6 E;  4JI3 E;  1WEO A;  4JI2 E;  3ADJ A;  2NUG A;  4MVT A;  4V3L C;  2VF1 A;  5B79 A;  4JI1 E;  4PPE A;  2DB2 A;  2JRJ A;  5H1U A;  5IWA E;  5D1L B;  4A4B A;  2KR4 A;  2HHH E;  1K2F A;  4Q28 A;  2M6M A;  5EYA F;  1WXR A;  2CKL B;  2CKL A;  4YAT A;  2NUE A;  4B7Y C;  2L3J A;  2LRI C;  4DR4 E;  1U6G B;  4TUI A;  4WZ3 B;  2JMJ A;  4YBM A;  1VD4 A;  3HCU A;  4DR5 E;  1WHN A;  1Z6U A;  2E6S A;  2QIZ A;  3DJW A;  2ZM6 E;  2L2K B;  2MT5 A;  2LGG A;  4GKK E;  4WYQ B;  2HDP A;  1V87 A;  2FGG A;  4LU9 A;  5LL6 R;  1IBK E;  2Y43 A;  4N4F A;  2H0D B;  4O64 A;  2LDR A;  4YAD A;  1ZBQ A;  3ZPV 1;  2LGK A;  4DKK A;  4YBS A;  4DUY E;  2PNX A;  2DX8 A;  5DIN A;  2L43 A;  3T7L A;  4I8O A;  3QZV A;  2PUY A;  5LKX A;  1X49 A;  4GNF A;  4S3O B;  2M1R A;  1WIL A;  3LQH A;  5BR8 E;  4JYA E;  2F6N A;  1WEM A;  2KRE A;  3SOU A;  1GZ6 A;  2FUU A;  2L33 A;  5A2Q C;  2RTX A;  2K16 A;  5H9M A;  1WEN A;  2QJ0 A;  1MM2 A;  3KQI A;  3HCT A;  3VK6 A;  3SOX A;  1SR9 A;  2G43 A;  1HR0 E;  4FIP A;  4YC9 A;  3O70 A;  4N3W A;  4LF4 E;  4LF6 E;  2EA6 A;  1WFK A;  2LTS A;  4PTB A;  2JWO A;  5T6J A;  4IC3 A;  2H36 X;  4AUQ B;  4WZ2 A;  2ODR D;  2V83 A;  2C2V S;  1HNX E;  1T4L B;  2RSM A;  1T1H A;  4DR7 E;  1DI2 A;  1Z60 A;  4AVX A;  1E4U A;  3ASL A;  4JV5 E;  3IWB A;  2L2M A;  5LKT A;  4XI1 A;  2JOB A;  4FK5 A;  4JI8 E;  4WA6 A;  3OML A;  4LF9 E;  4JI4 E;  4B3M E;  3PUQ A;  4WPY A;  3SOW A;  3O37 A;  5TDW A;  5ADZ A;  5B77 A;  4DV0 E;  3U5O A;  2ODR C;  3I2D A;  4BC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...