4GNDA

Crystal structure of nsd3 tandem phd5-c5hch domains
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
molecule keywords Histone-lysine N-methyltransferase NSD3
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gndA00
1IYMA 2QICA 3RPGC 2LXPC 2YT5A 4UI9B 5G0FA 1VD4A 2CKLA 2L0BA 4MSXA 5B8DA 2KYUA 2FUUA 2JMJA 2HDPA 1ZBDB 3L1ZB 4ZDTA 1VYXA 2LXHC 1WIMA 3IHPA 2I50A 1BORA 5B79A 5LKXA 5G05B 2YUCA 3SOXA 4S3OC 2Y43A 3KNVA 2MD7B 4R8PK 3PHDA 1WFKA 3NG2A 3RTRB 4MVTA 5TRBA 2VJEA 2UZGA 2VP7A 5J3XA 3PUQA 2KWKA 1MM3A 4YBMA 2KU3A 2KREA 1WENA 3RPGB 2ECWA 2M1RA 2PNXA 5B77A 3M63A 4GNGA 5FERA 5LKUA 3LRQA 2CSYA 1DVPA 3T7LA 4N4FA 2LGLA 4BHWA 3ZTGA 4XI1A 3ZNIA 4S3OB 3I2DA 1Z2QA 1F62A 2MA5A 2YURA 5B76A 4LK9A 4L58A 4A4CA 2KGGA 3C5KA 4A0CD 2M85A 5D1LB 3L1XA 3ZVYA 4YAXA 4L7XA 4LJNA 4QF3A 2VPDA 2G6QA 2YSJA 5TBNA 2LGKA 4YATA 3VK6A 3SHBA 1U6GB 2KIZA 4YABA 2MA6A 2DX8A 3N9OA 4LLBA 4I7BA 1E4UA 2LN0A 2YHOA 2M3HA 2HYED 1LDKC 4C9ZA 3DQVR 3ZYQA 4PTBA 1WEPA 4FJCA 2G43A 2LRIC 2G45A 4AYCA 2K16A 3EB5A 4AVXA 3MHSA 2XEUA 2E6SA 4A49A 4LADB 1WEOA 5AIUA 3HTKC 4A4BA 4QF2A 2RI7A 2QJ0A 4CA1A 1X4JA 2KGIA 4FO9A 5FB0A 2RSDA 2EA6A 4YC9A 5H1VA 2LGGA 3O7AA 3KQIA 3O36A 2C2LA 3T6RA 1JOCA 5TABA 2ECIA 1WEWA 1K2FA 2EODA 3M99A 5LCWB 1V87A 4B7YC 2MUMA 2LQ6A 2KE1A 2L75A 4WZ0A 2ECTA 4Q6FA 4WA6A 3ZPV1 4GNFA 5DINA 5EYAF 3O34A 2MD8C 1FBVA 2LV9A 4UP0A 4BBQA 4ZUXU 1WEUA 3KV6A 2Y1NA 1WEEA 2EGPA 3HCTA 2KWNA 3ZVZB 3N9LA 3GV4A 1RMDA 2LDRA 2NAAA 2YSMA 4NN2A 1WESA 3O70A 4O64A 2VPBA 2VPEA 4FK5A 4AYCB 2F6JA 2FSAA 1XWHA 3KV5A 4LKAA 5H1TA 2VNFA 1WE9A 2M6MA 3DPLR 4YBTA 2L43A 2YU4A 2CSZA 3LQJA 2BAYA 5I3LA 2PUYA 3LQIA 3U5NA 4V3KC 1G25A 4V3LC 3EB6A 2YHNA 3HCUA 2F42A 1CHCA 2K4DA 3ASLA 3O35A 2ECVA 5LKTA 4CCGX 2ECJA 4ZQLA 1HYIA 2C2VS 2YREA 5D1MB 1HYJA 3U5MA 4YADA 3V43A 1Z6UA 4GNEA 5H1UA 2ZETC 2XB1A 1WEQA 2JRJA 5DKAA 2K1JA 1JM7B 1WILA 4R7EA 4WZ3B 5D1KB 4P5OB 5AITA 3C6WA 2MT5A 3ZPVE 4WZ2A 5TDRA 4FIPA 1X4UA 4YBSA 4IC3A 1FP0A 2YQMA 4GB0A 2VJFB 4GNDA 3GL6A 2KWOA 4N3WA 2KFTA 1T1HA 2ECNA 2L80A 3L11A 2MNZA 3LQHA 5KH3A 4UP5A 2D8SA 2JMDA 3U5PA 2OXQC 1WEMA 1WGMA 2H0DB 5FB1A 3N9QA 1VFYA 5FEYA 5TDWA 3HCSA 4I7CA 4X3GA 5KH7A 2QIZA 4F52B 3SOWA 4W4UA 2CT2A 2KWJA 2IDAA 2FUIA 1JM7A 2Y1MA 2MNYA 1Z60A 1X4IA 2AN6A 3QZVA 5B78A 1LDJB 2KR4A 2K17A 2JMIA 3MHHA 4PPEA 4IC2A 2F6NA 2LGVA 3O37A 5C13A 2CKLB 5C11A 3N9NA 2L5UA 4B86C 2VJFA 1N87A 2ECGA 2YYRA 4AP4A 3PURA 3SOUA 5G04B 4R2YA 3O33A 5JG6A 2YW8A 4TKPB 5H9MA 2E6RA 2MIQA 2H0DA 2YQLA 3U5OA 4AUQB 1MM2A 2VPGA 3N9MA 5KH9A 3M62A 1WEVA 5B75A 3FL2A 5LKZA 2VJEB 3N9PA 4I7DA
chains in the Genus database with same CATH superfamily
3DWDA 1IYMA 2QICA 3RPGC 2LXPC 2YT5A 4UI9B 2XOYA 5G0FA 1VD4A 2CKLA 2L0BA 4MSXA 5B8DA 2KYUA 2FUUA 2JMJA 2HDPA 2B0OE 1ZBDB 3L1ZB 4ZDTA 1VYXA 2LXHC 1WIMA 3IHPA 2FFWA 2I50A 1BORA 5B79A 5LKXA 1MBMA 5G05B 2YUCA 3SOXA 2DSMA 4S3OC 2Y43A 3KNVA 2MD7B 4R8PK 3PHDA 1WFKA 3NG2A 3RTRB 2E61A 4MVTA 5TRBA 2VJEA 2UZGA 2VP7A 2IQJA 5J3XA 3PUQA 2KWKA 1MM3A 4YBMA 2KU3A 3MDBC 2KREA 1WENA 3RPGB 2ECWA 2CRRA 2M1RA 2PNXA 5B77A 3M63A 4GNGA 5FERA 5LKUA 3LRQA 3FM8C 2CSYA 1DVPA 3T7LA 3LVQE 3Q1DA 4N4FA 2LGLA 4BHWA 3ZTGA 4XI1A 3ZNIA 4S3OB 3I2DA 1Z2QA 1F62A 2MA5A 2CONA 2YURA 2JUNA 5B76A 4LK9A 4L58A 4A4CA 2KGGA 3C5KA 4A0CD 2M85A 2JM3A 5D1LB 3L1XA 3ZVYA 2MKEA 3FEHA 2EXUA 4YAXA 4L7XA 4LJNA 4QF3A 2VPDA 2G6QA 2YSJA 5TBNA 2LGKA 4YATA 2FD4A 3LVRE 3VK6A 3SHBA 2XP0A 1U6GB 2KIZA 2LAUA 4OGCA 3KDEC 2CRWA 4YABA 2MA6A 2DX8A 3JUEA 3N9OA 5K3QA 4LLBA 4I7BA 1E4UA 2LN0A 2YHOA 2M3HA 2HYED 3DDTA 1LDKC 4C9ZA 3DQVR 2M13A 3ZYQA 4PTBA 1WEPA 4FJCA 3LDYA 2G43A 2LRIC 2XOZA 2G45A 4AYCA 2K16A 3EB5A 4AVXA 3MHSA 2XEUA 2E6SA 4A49A 4LADB 1WEOA 5AIUA 3HTKC 4A4BA 2KKYA 4QF2A 2RI7A 2QJ0A 4CA1A 1X4JA 2KGIA 4FO9A 5FB0A 2RSDA 3LJUX 2EA6A 4YC9A 5H1VA 2LGGA 3O7AA 3KQIA 2DJAA 3O36A 3E2DA 2C2LA 3T6RA 1JOCA 5TABA 2ECIA 4Z0OA 1WEWA 1K2FA 2EODA 3M99A 5LCWB 1V87A 4B7YC 2MUMA 2LQ6A 2KE1A 2L75A 4WZ0A 2ECTA 4Q6FA 4WA6A 3ZPV1 4GNFA 4OGEA 5DINA 4F1PA 4H9DA 5EYAF 3O34A 5SVIB 2MD8C 1FBVA 2D8UA 2LV9A 4UP0A 4BBQA 4ZUXU 1WEUA 3KV6A 2Y1NA 1WEEA 3T9KA 2EGPA 3HCTA 2KWNA 3ZVZB 3N9LA 3GV4A 1RMDA 2KKXA 2LDRA 2NAAA 2YSMA 4NN2A 1WESA 3O70A 4O64A 2VPBA 2VPEA 4FK5A 4AYCB 2F6JA 2FSAA 2XOCA 3H7HA 1XWHA 3KV5A 4LKAA 5H1TA 2VNFA 1WE9A 2M6MA 3DPLR 3FANA 4YBTA 5SVIA 3M7KA 2L43A 2YU4A 2CSZA 3LQJA 2BAYA 3FAOA 2OWAA 5I3LA 2PUYA 2L7PA 3LQIA 3SUBA 3U5NA 4V3KC 1G25A 1DCQA 3PLWA 4V3LC 3EB6A 2YHNA 3HCUA 2F42A 1CHCA 2K4DA 4Z0RA 2YVRA 3ASLA 3O35A 2ECVA 5LKTA 4CCGX 2ECJA 4ZQLA 1HYIA 2C2VS 2YREA 5D1MB 1HYJA 3U5MA 4YADA 3V43A 2EGMA 1Z6UA 4GNEA 5H1UA 2ZETC 2XB1A 1WEQA 2JRJA 5DKAA 2K1JA 2RR4A 1JM7B 1WILA 4R7EA 4WZ3B 5D1KB 4P5OB 5AITA 3C6WA 4O62A 2MT5A 3ZPVE 4WZ2A 5TDRA 4FIPA 1X4UA 4YBSA 4IC3A 1FP0A 2YQMA 4GB0A 5SVYA 2VJFB 3O47A 4GNDA 3GL6A 2KWOA 4N3WA 2KFTA 1T1HA 2ECNA 2L80A 3L11A 2MNZA 3LQHA 5KH3A 5SVXA 4UP5A 2D8SA 2JMDA 3U5PA 2OXQC 1WEMA 1WGMA 2H0DB 5FB1A 3N9QA 1VFYA 5FEYA 5TDWA 3HCSA 4I7CA 4X3GA 5KH7A 2QIZA 2P57A 4F52B 3SOWA 4W4UA 2CT2A 2KWJA 2IDAA 2FUIA 1JM7A 2Y1MA 2MNYA 1Z60A 1X4IA 2AN6A 3QZVA 5B78A 1LDJB 2KR4A 2K17A 2JMIA 3MHHA 4PPEA 4IC2A 2F6NA 2LGVA 3O37A 5C13A 2CKLB 3FJUB 5C11A 3N9NA 2L5UA 4B86C 2VJFA 1N87A 2ECGA 2YYRA 4AP4A 3PURA 3SOUA 5G04B 4R2YA 3O33A 5JG6A 2YW8A 4TKPB 5H9MA 2E6RA 2MIQA 2H0DA 2YQLA 3U5OA 4AUQB 1MM2A 2VPGA 3N9MA 4QQ4A 5KH9A 3M62A 2CSVA 1WEVA 5B75A 3FL2A 5LKZA 2VJEB 3N9PA 4I7DA
chains in the Genus database with same CATH topology
1IYMA 2QICA 3RPGC 2LXPC 2YT5A 4UI9B 5G0FA 1VD4A 2CKLA 2L0BA 4MSXA 5B8DA 2KYUA 2FUUA 2JMJA 2HDPA 1ZBDB 3L1ZB 4ZDTA 1VYXA 2LXHC 1WIMA 3IHPA 2I50A 1BORA 5B79A 5LKXA 5G05B 2YUCA 3SOXA 4S3OC 2Y43A 3KNVA 2MD7B 4R8PK 3PHDA 1WFKA 3NG2A 3RTRB 4MVTA 5TRBA 2VJEA 2UZGA 2VP7A 5J3XA 3PUQA 2KWKA 1MM3A 4YBMA 2KU3A 2KREA 1WENA 3RPGB 2ECWA 2M1RA 2PNXA 5B77A 3M63A 4GNGA 5FERA 5LKUA 3LRQA 2CSYA 1DVPA 3T7LA 4N4FA 2LGLA 4BHWA 3ZTGA 4XI1A 3ZNIA 4S3OB 3I2DA 1Z2QA 1F62A 2MA5A 2YURA 5B76A 4LK9A 4L58A 4A4CA 2KGGA 3C5KA 4A0CD 2M85A 5D1LB 3L1XA 3ZVYA 4YAXA 4L7XA 4LJNA 4QF3A 2VPDA 2G6QA 2YSJA 5TBNA 2LGKA 4YATA 3VK6A 3SHBA 1U6GB 2KIZA 4YABA 2MA6A 2DX8A 3N9OA 4LLBA 4I7BA 1E4UA 2LN0A 2YHOA 2M3HA 2HYED 1LDKC 4C9ZA 3DQVR 3ZYQA 4PTBA 1WEPA 4FJCA 2G43A 2LRIC 2G45A 4AYCA 2K16A 3EB5A 4AVXA 3MHSA 2XEUA 2E6SA 4A49A 4LADB 1WEOA 5AIUA 3HTKC 4A4BA 4QF2A 2RI7A 2QJ0A 4CA1A 1X4JA 2KGIA 4FO9A 5FB0A 2RSDA 2EA6A 4YC9A 5H1VA 2LGGA 3O7AA 3KQIA 3O36A 2C2LA 3T6RA 1JOCA 5TABA 2ECIA 1WEWA 1K2FA 2EODA 3M99A 5LCWB 1V87A 4B7YC 2MUMA 2LQ6A 2KE1A 2L75A 4WZ0A 2ECTA 4Q6FA 4WA6A 3ZPV1 4GNFA 5DINA 5EYAF 3O34A 2MD8C 1FBVA 2LV9A 4UP0A 4BBQA 4ZUXU 1WEUA 3KV6A 2Y1NA 1WEEA 2EGPA 3HCTA 2KWNA 3ZVZB 3N9LA 3GV4A 1RMDA 2LDRA 2NAAA 2YSMA 4NN2A 1WESA 3O70A 4O64A 2VPBA 2VPEA 4FK5A 4AYCB 2F6JA 2FSAA 1XWHA 3KV5A 4LKAA 5H1TA 2VNFA 1WE9A 2M6MA 3DPLR 4YBTA 2L43A 2YU4A 2CSZA 3LQJA 2BAYA 5I3LA 2PUYA 3LQIA 3U5NA 4V3KC 1G25A 4V3LC 3EB6A 2YHNA 3HCUA 2F42A 1CHCA 2K4DA 3ASLA 3O35A 2ECVA 5LKTA 4CCGX 2ECJA 4ZQLA 1HYIA 2C2VS 2YREA 5D1MB 1HYJA 3U5MA 4YADA 3V43A 1Z6UA 4GNEA 5H1UA 2ZETC 2XB1A 1WEQA 2JRJA 5DKAA 2K1JA 1JM7B 1WILA 4R7EA 4WZ3B 5D1KB 4P5OB 5AITA 3C6WA 2MT5A 3ZPVE 4WZ2A 5TDRA 4FIPA 1X4UA 4YBSA 4IC3A 1FP0A 2YQMA 4GB0A 2VJFB 4GNDA 3GL6A 2KWOA 4N3WA 2KFTA 1T1HA 2ECNA 2L80A 3L11A 2MNZA 3LQHA 5KH3A 4UP5A 2D8SA 2JMDA 3U5PA 2OXQC 1WEMA 1WGMA 2H0DB 5FB1A 3N9QA 1VFYA 5FEYA 5TDWA 3HCSA 4I7CA 4X3GA 5KH7A 2QIZA 4F52B 3SOWA 4W4UA 2CT2A 2KWJA 2IDAA 2FUIA 1JM7A 2Y1MA 2MNYA 1Z60A 1X4IA 2AN6A 3QZVA 5B78A 1LDJB 2KR4A 2K17A 2JMIA 3MHHA 4PPEA 4IC2A 2F6NA 2LGVA 3O37A 5C13A 2CKLB 5C11A 3N9NA 2L5UA 4B86C 2VJFA 1N87A 2ECGA 2YYRA 4AP4A 3PURA 3SOUA 5G04B 4R2YA 3O33A 5JG6A 2YW8A 4TKPB 5H9MA 2E6RA 2MIQA 2H0DA 2YQLA 3U5OA 4AUQB 1MM2A 2VPGA 3N9MA 5KH9A 3M62A 1WEVA 5B75A 3FL2A 5LKZA 2VJEB 3N9PA 4I7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYM A;  2QIC A;  3RPG C;  2LXP C;  2YT5 A;  4UI9 B;  5G0F A;  1VD4 A;  2CKL A;  2L0B A;  4MSX A;  5B8D A;  2KYU A;  2FUU A;  2JMJ A;  2HDP A;  1ZBD B;  3L1Z B;  4ZDT A;  1VYX A;  2LXH C;  1WIM A;  3IHP A;  2I50 A;  1BOR A;  5B79 A;  5LKX A;  5G05 B;  2YUC A;  3SOX A;  4S3O C;  2Y43 A;  3KNV A;  2MD7 B;  4R8P K;  3PHD A;  1WFK A;  3NG2 A;  3RTR B;  4MVT A;  5TRB A;  2VJE A;  2UZG A;  2VP7 A;  5J3X A;  3PUQ A;  2KWK A;  1MM3 A;  4YBM A;  2KU3 A;  2KRE A;  1WEN A;  3RPG B;  2ECW A;  2M1R A;  2PNX A;  5B77 A;  3M63 A;  4GNG A;  5FER A;  5LKU A;  3LRQ A;  2CSY A;  1DVP A;  3T7L A;  4N4F A;  2LGL A;  4BHW A;  3ZTG A;  4XI1 A;  3ZNI A;  4S3O B;  3I2D A;  1Z2Q A;  1F62 A;  2MA5 A;  2YUR A;  5B76 A;  4LK9 A;  4L58 A;  4A4C A;  2KGG A;  3C5K A;  4A0C D;  2M85 A;  5D1L B;  3L1X A;  3ZVY A;  4YAX A;  4L7X A;  4LJN A;  4QF3 A;  2VPD A;  2G6Q A;  2YSJ A;  5TBN A;  2LGK A;  4YAT A;  3VK6 A;  3SHB A;  1U6G B;  2KIZ A;  4YAB A;  2MA6 A;  2DX8 A;  3N9O A;  4LLB A;  4I7B A;  1E4U A;  2LN0 A;  2YHO A;  2M3H A;  2HYE D;  1LDK C;  4C9Z A;  3DQV R;  3ZYQ A;  4PTB A;  1WEP A;  4FJC A;  2G43 A;  2LRI C;  2G45 A;  4AYC A;  2K16 A;  3EB5 A;  4AVX A;  3MHS A;  2XEU A;  2E6S A;  4A49 A;  4LAD B;  1WEO A;  5AIU A;  3HTK C;  4A4B A;  4QF2 A;  2RI7 A;  2QJ0 A;  4CA1 A;  1X4J A;  2KGI A;  4FO9 A;  5FB0 A;  2RSD A;  2EA6 A;  4YC9 A;  5H1V A;  2LGG A;  3O7A A;  3KQI A;  3O36 A;  2C2L A;  3T6R A;  1JOC A;  5TAB A;  2ECI A;  1WEW A;  1K2F A;  2EOD A;  3M99 A;  5LCW B;  1V87 A;  4B7Y C;  2MUM A;  2LQ6 A;  2KE1 A;  2L75 A;  4WZ0 A;  2ECT A;  4Q6F A;  4WA6 A;  3ZPV 1;  4GNF A;  5DIN A;  5EYA F;  3O34 A;  2MD8 C;  1FBV A;  2LV9 A;  4UP0 A;  4BBQ A;  4ZUX U;  1WEU A;  3KV6 A;  2Y1N A;  1WEE A;  2EGP A;  3HCT A;  2KWN A;  3ZVZ B;  3N9L A;  3GV4 A;  1RMD A;  2LDR A;  2NAA A;  2YSM A;  4NN2 A;  1WES A;  3O70 A;  4O64 A;  2VPB A;  2VPE A;  4FK5 A;  4AYC B;  2F6J A;  2FSA A;  1XWH A;  3KV5 A;  4LKA A;  5H1T A;  2VNF A;  1WE9 A;  2M6M A;  3DPL R;  4YBT A;  2L43 A;  2YU4 A;  2CSZ A;  3LQJ A;  2BAY A;  5I3L A;  2PUY A;  3LQI A;  3U5N A;  4V3K C;  1G25 A;  4V3L C;  3EB6 A;  2YHN A;  3HCU A;  2F42 A;  1CHC A;  2K4D A;  3ASL A;  3O35 A;  2ECV A;  5LKT A;  4CCG X;  2ECJ A;  4ZQL A;  1HYI A;  2C2V S;  2YRE A;  5D1M B;  1HYJ A;  3U5M A;  4YAD A;  3V43 A;  1Z6U A;  4GNE A;  5H1U A;  2ZET C;  2XB1 A;  1WEQ A;  2JRJ A;  5DKA A;  2K1J A;  1JM7 B;  1WIL A;  4R7E A;  4WZ3 B;  5D1K B;  4P5O B;  5AIT A;  3C6W A;  2MT5 A;  3ZPV E;  4WZ2 A;  5TDR A;  4FIP A;  1X4U A;  4YBS A;  4IC3 A;  1FP0 A;  2YQM A;  4GB0 A;  2VJF B;  4GND A;  3GL6 A;  2KWO A;  4N3W A;  2KFT A;  1T1H A;  2ECN A;  2L80 A;  3L11 A;  2MNZ A;  3LQH A;  5KH3 A;  4UP5 A;  2D8S A;  2JMD A;  3U5P A;  2OXQ C;  1WEM A;  1WGM A;  2H0D B;  5FB1 A;  3N9Q A;  1VFY A;  5FEY A;  5TDW A;  3HCS A;  4I7C A;  4X3G A;  5KH7 A;  2QIZ A;  4F52 B;  3SOW A;  4W4U A;  2CT2 A;  2KWJ A;  2IDA A;  2FUI A;  1JM7 A;  2Y1M A;  2MNY A;  1Z60 A;  1X4I A;  2AN6 A;  3QZV A;  5B78 A;  1LDJ B;  2KR4 A;  2K17 A;  2JMI A;  3MHH A;  4PPE A;  4IC2 A;  2F6N A;  2LGV A;  3O37 A;  5C13 A;  2CKL B;  5C11 A;  3N9N A;  2L5U A;  4B86 C;  2VJF A;  1N87 A;  2ECG A;  2YYR A;  4AP4 A;  3PUR A;  3SOU A;  5G04 B;  4R2Y A;  3O33 A;  5JG6 A;  2YW8 A;  4TKP B;  5H9M A;  2E6R A;  2MIQ A;  2H0D A;  2YQL A;  3U5O A;  4AUQ B;  1MM2 A;  2VPG A;  3N9M A;  5KH9 A;  3M62 A;  1WEV A;  5B75 A;  3FL2 A;  5LKZ A;  2VJE B;  3N9P A;  4I7D A; 
#chains in the Genus database with same CATH topology
 3DWD A;  1IYM A;  2QIC A;  3RPG C;  2LXP C;  2YT5 A;  4UI9 B;  2XOY A;  5G0F A;  1VD4 A;  2CKL A;  2L0B A;  4MSX A;  5B8D A;  2KYU A;  2FUU A;  2JMJ A;  2HDP A;  2B0O E;  1ZBD B;  3L1Z B;  4ZDT A;  1VYX A;  2LXH C;  1WIM A;  3IHP A;  2FFW A;  2I50 A;  1BOR A;  5B79 A;  5LKX A;  1MBM A;  5G05 B;  2YUC A;  3SOX A;  2DSM A;  4S3O C;  2Y43 A;  3KNV A;  2MD7 B;  4R8P K;  3PHD A;  1WFK A;  3NG2 A;  3RTR B;  2E61 A;  4MVT A;  5TRB A;  2VJE A;  2UZG A;  2VP7 A;  2IQJ A;  5J3X A;  3PUQ A;  2KWK A;  1MM3 A;  4YBM A;  2KU3 A;  3MDB C;  2KRE A;  1WEN A;  3RPG B;  2ECW A;  2CRR A;  2M1R A;  2PNX A;  5B77 A;  3M63 A;  4GNG A;  5FER A;  5LKU A;  3LRQ A;  3FM8 C;  2CSY A;  1DVP A;  3T7L A;  3LVQ E;  3Q1D A;  4N4F A;  2LGL A;  4BHW A;  3ZTG A;  4XI1 A;  3ZNI A;  4S3O B;  3I2D A;  1Z2Q A;  1F62 A;  2MA5 A;  2CON A;  2YUR A;  2JUN A;  5B76 A;  4LK9 A;  4L58 A;  4A4C A;  2KGG A;  3C5K A;  4A0C D;  2M85 A;  2JM3 A;  5D1L B;  3L1X A;  3ZVY A;  2MKE A;  3FEH A;  2EXU A;  4YAX A;  4L7X A;  4LJN A;  4QF3 A;  2VPD A;  2G6Q A;  2YSJ A;  5TBN A;  2LGK A;  4YAT A;  2FD4 A;  3LVR E;  3VK6 A;  3SHB A;  2XP0 A;  1U6G B;  2KIZ A;  2LAU A;  4OGC A;  3KDE C;  2CRW A;  4YAB A;  2MA6 A;  2DX8 A;  3JUE A;  3N9O A;  5K3Q A;  4LLB A;  4I7B A;  1E4U A;  2LN0 A;  2YHO A;  2M3H A;  2HYE D;  3DDT A;  1LDK C;  4C9Z A;  3DQV R;  2M13 A;  3ZYQ A;  4PTB A;  1WEP A;  4FJC A;  3LDY A;  2G43 A;  2LRI C;  2XOZ A;  2G45 A;  4AYC A;  2K16 A;  3EB5 A;  4AVX A;  3MHS A;  2XEU A;  2E6S A;  4A49 A;  4LAD B;  1WEO A;  5AIU A;  3HTK C;  4A4B A;  2KKY A;  4QF2 A;  2RI7 A;  2QJ0 A;  4CA1 A;  1X4J A;  2KGI A;  4FO9 A;  5FB0 A;  2RSD A;  3LJU X;  2EA6 A;  4YC9 A;  5H1V A;  2LGG A;  3O7A A;  3KQI A;  2DJA A;  3O36 A;  3E2D A;  2C2L A;  3T6R A;  1JOC A;  5TAB A;  2ECI A;  4Z0O A;  1WEW A;  1K2F A;  2EOD A;  3M99 A;  5LCW B;  1V87 A;  4B7Y C;  2MUM A;  2LQ6 A;  2KE1 A;  2L75 A;  4WZ0 A;  2ECT A;  4Q6F A;  4WA6 A;  3ZPV 1;  4GNF A;  4OGE A;  5DIN A;  4F1P A;  4H9D A;  5EYA F;  3O34 A;  5SVI B;  2MD8 C;  1FBV A;  2D8U A;  2LV9 A;  4UP0 A;  4BBQ A;  4ZUX U;  1WEU A;  3KV6 A;  2Y1N A;  1WEE A;  3T9K A;  2EGP A;  3HCT A;  2KWN A;  3ZVZ B;  3N9L A;  3GV4 A;  1RMD A;  2KKX A;  2LDR A;  2NAA A;  2YSM A;  4NN2 A;  1WES A;  3O70 A;  4O64 A;  2VPB A;  2VPE A;  4FK5 A;  4AYC B;  2F6J A;  2FSA A;  2XOC A;  3H7H A;  1XWH A;  3KV5 A;  4LKA A;  5H1T A;  2VNF A;  1WE9 A;  2M6M A;  3DPL R;  3FAN A;  4YBT A;  5SVI A;  3M7K A;  2L43 A;  2YU4 A;  2CSZ A;  3LQJ A;  2BAY A;  3FAO A;  2OWA A;  5I3L A;  2PUY A;  2L7P A;  3LQI A;  3SUB A;  3U5N A;  4V3K C;  1G25 A;  1DCQ A;  3PLW A;  4V3L C;  3EB6 A;  2YHN A;  3HCU A;  2F42 A;  1CHC A;  2K4D A;  4Z0R A;  2YVR A;  3ASL A;  3O35 A;  2ECV A;  5LKT A;  4CCG X;  2ECJ A;  4ZQL A;  1HYI A;  2C2V S;  2YRE A;  5D1M B;  1HYJ A;  3U5M A;  4YAD A;  3V43 A;  2EGM A;  1Z6U A;  4GNE A;  5H1U A;  2ZET C;  2XB1 A;  1WEQ A;  2JRJ A;  5DKA A;  2K1J A;  2RR4 A;  1JM7 B;  1WIL A;  4R7E A;  4WZ3 B;  5D1K B;  4P5O B;  5AIT A;  3C6W A;  4O62 A;  2MT5 A;  3ZPV E;  4WZ2 A;  5TDR A;  4FIP A;  1X4U A;  4YBS A;  4IC3 A;  1FP0 A;  2YQM A;  4GB0 A;  5SVY A;  2VJF B;  3O47 A;  4GND A;  3GL6 A;  2KWO A;  4N3W A;  2KFT A;  1T1H A;  2ECN A;  2L80 A;  3L11 A;  2MNZ A;  3LQH A;  5KH3 A;  5SVX A;  4UP5 A;  2D8S A;  2JMD A;  3U5P A;  2OXQ C;  1WEM A;  1WGM A;  2H0D B;  5FB1 A;  3N9Q A;  1VFY A;  5FEY A;  5TDW A;  3HCS A;  4I7C A;  4X3G A;  5KH7 A;  2QIZ A;  2P57 A;  4F52 B;  3SOW A;  4W4U A;  2CT2 A;  2KWJ A;  2IDA A;  2FUI A;  1JM7 A;  2Y1M A;  2MNY A;  1Z60 A;  1X4I A;  2AN6 A;  3QZV A;  5B78 A;  1LDJ B;  2KR4 A;  2K17 A;  2JMI A;  3MHH A;  4PPE A;  4IC2 A;  2F6N A;  2LGV A;  3O37 A;  5C13 A;  2CKL B;  3FJU B;  5C11 A;  3N9N A;  2L5U A;  4B86 C;  2VJF A;  1N87 A;  2ECG A;  2YYR A;  4AP4 A;  3PUR A;  3SOU A;  5G04 B;  4R2Y A;  3O33 A;  5JG6 A;  2YW8 A;  4TKP B;  5H9M A;  2E6R A;  2MIQ A;  2H0D A;  2YQL A;  3U5O A;  4AUQ B;  1MM2 A;  2VPG A;  3N9M A;  4QQ4 A;  5KH9 A;  3M62 A;  2CSV A;  1WEV A;  5B75 A;  3FL2 A;  5LKZ A;  2VJE B;  3N9P A;  4I7D A; 
#chains in the Genus database with same CATH homology
 1IYM A;  2QIC A;  3RPG C;  2LXP C;  2YT5 A;  4UI9 B;  5G0F A;  1VD4 A;  2CKL A;  2L0B A;  4MSX A;  5B8D A;  2KYU A;  2FUU A;  2JMJ A;  2HDP A;  1ZBD B;  3L1Z B;  4ZDT A;  1VYX A;  2LXH C;  1WIM A;  3IHP A;  2I50 A;  1BOR A;  5B79 A;  5LKX A;  5G05 B;  2YUC A;  3SOX A;  4S3O C;  2Y43 A;  3KNV A;  2MD7 B;  4R8P K;  3PHD A;  1WFK A;  3NG2 A;  3RTR B;  4MVT A;  5TRB A;  2VJE A;  2UZG A;  2VP7 A;  5J3X A;  3PUQ A;  2KWK A;  1MM3 A;  4YBM A;  2KU3 A;  2KRE A;  1WEN A;  3RPG B;  2ECW A;  2M1R A;  2PNX A;  5B77 A;  3M63 A;  4GNG A;  5FER A;  5LKU A;  3LRQ A;  2CSY A;  1DVP A;  3T7L A;  4N4F A;  2LGL A;  4BHW A;  3ZTG A;  4XI1 A;  3ZNI A;  4S3O B;  3I2D A;  1Z2Q A;  1F62 A;  2MA5 A;  2YUR A;  5B76 A;  4LK9 A;  4L58 A;  4A4C A;  2KGG A;  3C5K A;  4A0C D;  2M85 A;  5D1L B;  3L1X A;  3ZVY A;  4YAX A;  4L7X A;  4LJN A;  4QF3 A;  2VPD A;  2G6Q A;  2YSJ A;  5TBN A;  2LGK A;  4YAT A;  3VK6 A;  3SHB A;  1U6G B;  2KIZ A;  4YAB A;  2MA6 A;  2DX8 A;  3N9O A;  4LLB A;  4I7B A;  1E4U A;  2LN0 A;  2YHO A;  2M3H A;  2HYE D;  1LDK C;  4C9Z A;  3DQV R;  3ZYQ A;  4PTB A;  1WEP A;  4FJC A;  2G43 A;  2LRI C;  2G45 A;  4AYC A;  2K16 A;  3EB5 A;  4AVX A;  3MHS A;  2XEU A;  2E6S A;  4A49 A;  4LAD B;  1WEO A;  5AIU A;  3HTK C;  4A4B A;  4QF2 A;  2RI7 A;  2QJ0 A;  4CA1 A;  1X4J A;  2KGI A;  4FO9 A;  5FB0 A;  2RSD A;  2EA6 A;  4YC9 A;  5H1V A;  2LGG A;  3O7A A;  3KQI A;  3O36 A;  2C2L A;  3T6R A;  1JOC A;  5TAB A;  2ECI A;  1WEW A;  1K2F A;  2EOD A;  3M99 A;  5LCW B;  1V87 A;  4B7Y C;  2MUM A;  2LQ6 A;  2KE1 A;  2L75 A;  4WZ0 A;  2ECT A;  4Q6F A;  4WA6 A;  3ZPV 1;  4GNF A;  5DIN A;  5EYA F;  3O34 A;  2MD8 C;  1FBV A;  2LV9 A;  4UP0 A;  4BBQ A;  4ZUX U;  1WEU A;  3KV6 A;  2Y1N A;  1WEE A;  2EGP A;  3HCT A;  2KWN A;  3ZVZ B;  3N9L A;  3GV4 A;  1RMD A;  2LDR A;  2NAA A;  2YSM A;  4NN2 A;  1WES A;  3O70 A;  4O64 A;  2VPB A;  2VPE A;  4FK5 A;  4AYC B;  2F6J A;  2FSA A;  1XWH A;  3KV5 A;  4LKA A;  5H1T A;  2VNF A;  1WE9 A;  2M6M A;  3DPL R;  4YBT A;  2L43 A;  2YU4 A;  2CSZ A;  3LQJ A;  2BAY A;  5I3L A;  2PUY A;  3LQI A;  3U5N A;  4V3K C;  1G25 A;  4V3L C;  3EB6 A;  2YHN A;  3HCU A;  2F42 A;  1CHC A;  2K4D A;  3ASL A;  3O35 A;  2ECV A;  5LKT A;  4CCG X;  2ECJ A;  4ZQL A;  1HYI A;  2C2V S;  2YRE A;  5D1M B;  1HYJ A;  3U5M A;  4YAD A;  3V43 A;  1Z6U A;  4GNE A;  5H1U A;  2ZET C;  2XB1 A;  1WEQ A;  2JRJ A;  5DKA A;  2K1J A;  1JM7 B;  1WIL A;  4R7E A;  4WZ3 B;  5D1K B;  4P5O B;  5AIT A;  3C6W A;  2MT5 A;  3ZPV E;  4WZ2 A;  5TDR A;  4FIP A;  1X4U A;  4YBS A;  4IC3 A;  1FP0 A;  2YQM A;  4GB0 A;  2VJF B;  4GND A;  3GL6 A;  2KWO A;  4N3W A;  2KFT A;  1T1H A;  2ECN A;  2L80 A;  3L11 A;  2MNZ A;  3LQH A;  5KH3 A;  4UP5 A;  2D8S A;  2JMD A;  3U5P A;  2OXQ C;  1WEM A;  1WGM A;  2H0D B;  5FB1 A;  3N9Q A;  1VFY A;  5FEY A;  5TDW A;  3HCS A;  4I7C A;  4X3G A;  5KH7 A;  2QIZ A;  4F52 B;  3SOW A;  4W4U A;  2CT2 A;  2KWJ A;  2IDA A;  2FUI A;  1JM7 A;  2Y1M A;  2MNY A;  1Z60 A;  1X4I A;  2AN6 A;  3QZV A;  5B78 A;  1LDJ B;  2KR4 A;  2K17 A;  2JMI A;  3MHH A;  4PPE A;  4IC2 A;  2F6N A;  2LGV A;  3O37 A;  5C13 A;  2CKL B;  5C11 A;  3N9N A;  2L5U A;  4B86 C;  2VJF A;  1N87 A;  2ECG A;  2YYR A;  4AP4 A;  3PUR A;  3SOU A;  5G04 B;  4R2Y A;  3O33 A;  5JG6 A;  2YW8 A;  4TKP B;  5H9M A;  2E6R A;  2MIQ A;  2H0D A;  2YQL A;  3U5O A;  4AUQ B;  1MM2 A;  2VPG A;  3N9M A;  5KH9 A;  3M62 A;  1WEV A;  5B75 A;  3FL2 A;  5LKZ A;  2VJE B;  3N9P A;  4I7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...