4GNDA

Crystal structure of nsd3 tandem phd5-c5hch domains
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase NSD3
publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gndA00
3ZNIA 4O64A 2FSAA 1JM7A 4IC3A 2YU4A 5B79A 2VP7A 4ZQLA 1JOCA 4A4CA 1WFKA 2QIZA 2KGIA 2DX8A 3O37A 3RTRB 3O70A 4YATA 1X4IA 4LADB 2QICA 5KH9A 2C2LA 4YADA 2LGVA 2VJEA 5KH7A 2JMIA 2HDPA 2RI7A 4YC9A 2YYRA 2ECNA 4GNGA 5FB1A 3SOUA 3ZVZB 2EGPA 5AITA 4N3WA 2MNZA 4GNEA 3L11A 3DPLR 1XWHA 2LGLA 2E6SA 3KV5A 2YT5A 1V87A 2G6QA 3U5PA 4AYCB 3EB6A 2Y1MA 4BHWA 2KWNA 2VJFB 2KWOA 2NAAA 2ECJA 5TDRA 5B8DA 2MA5A 2L0BA 4WZ2A 2KGGA 2HYED 3HCSA 2K17A 3M62A 1WEVA 3HTKC 2ECVA 2IDAA 4F52B 5FERA 1WESA 3LRQA 5J3XA 1Z2QA 1MM2A 4YAXA 2YURA 2KR4A 2E6RA 4P5OB 4W4UA 4X3GA 2ECIA 1WEPA 5H9MA 3O36A 3C5KA 4UP0A 3PURA 5FEYA 1WEOA 2LRIC 2G45A 1K2FA 1G25A 2QJ0A 4R7EA 3C6WA 3GV4A 5TDWA 4XI1A 4PPEA 2M85A 2KU3A 1X4UA 2KFTA 3SOWA 2KIZA 5H1TA 4ZUXU 1WGMA 2YQMA 2YW8A 3HCUA 4CA1A 2LGKA 1U6GB 4GNDA 3SHBA 2D8SA 4V3KC 1VFYA 2PUYA 3FL2A 3N9LA 1WEMA 4LLBA 2YSMA 2CT2A 2F42A 2YREA 5C13A 4V3LC 4LKAA 2LDRA 1N87A 4YBSA 5D1LB 2FUUA 4B7YC 5KH3A 2H0DB 4YBTA 3U5OA 3I2DA 2BAYA 3PHDA 5B77A 1DVPA 3ZVYA 2VPGA 3SOXA 2C2VS 5JG6A 3ASLA 4A0CD 1LDKC 4I7DA 4B86C 5C11A 2RSDA 2CSZA 2VPDA 3KNVA 1E4UA 2MUMA 2LV9A 2MD8C 4WZ0A 4FK5A 1X4JA 2PNXA 3ZYQA 1FBVA 2CSYA 2M6MA 3N9OA 2K1JA 2Y43A 4FIPA 2M3HA 3NG2A 5B78A 2MA6A 3KV6A 2VNFA 2G43A 2L43A 3RPGC 4S3OC 2XEUA 2LXPC 3T6RA 4GB0A 3QZVA 3N9NA 2KYUA 1RMDA 4A49A 2L5UA 3N9PA 2VJFA 3EB5A 4TKPB 1WEEA 2VPBA 1WE9A 4QF3A 3PUQA 3MHSA 3LQJA 2CKLB 2MNYA 5G04B 2K16A 3ZPVE 4Q6FA 2ZETC 3KQIA 1WENA 3LQHA 4N4FA 2VPEA 1F62A 4R2YA 5B75A 1JM7B 2ECGA 4S3OB 1WIMA 2LN0A 2L75A 3LQIA 4AP4A 2MD7B 5G0FA 5TBNA 2KREA 2JMJA 4UP5A 2AN6A 1Z6UA 2VJEB 2I50A 3N9MA 4PTBA 4MSXA 5EYAF 5LKZA 5TRBA 5DINA 5I3LA 1Z60A 2LGGA 3VK6A 5LCWB 3IHPA 3MHHA 4AUQB 4IC2A 2LQ6A 3U5MA 2Y1NA 2YUCA 3V43A 3M63A 4L7XA 2EA6A 5TABA 2F6JA 3ZTGA 1WEUA 1WEQA 5LKXA 2ECWA 2H0DA 4A4BA 1HYJA 3O33A 5DKAA 3O7AA 4LK9A 5G05B 4NN2A 4MVTA 1ZBDB 1VD4A 5D1MB 5B76A 2UZGA 4ZDTA 2OXQC 3N9QA 2YHOA 2KWJA 5LKTA 1T1HA 1FP0A 4AVXA 3U5NA 1CHCA 2MIQA 4I7CA 4AYCA 2F6NA 2JRJA 3ZPV1 4FO9A 1LDJB 5H1VA 4UI9B 2LXHC 2KWKA 4I7BA 4LJNA 5FB0A 5AIUA 5LKUA 3HCTA 3DQVR 4FJCA 5D1KB 4GNFA 2KE1A 2ECTA 1WILA 2MT5A 4WZ3B 3T7LA 4YABA 3O34A 4BBQA 2L80A 3L1ZB 2K4DA 5H1UA 2JMDA 3RPGB 4QF2A 2YSJA 2YHNA 4C9ZA 3M99A 4WA6A 3GL6A 1IYMA 1BORA 2FUIA 2EODA 4CCGX 3O35A 2CKLA 1HYIA 2YQLA 1WEWA 4YBMA 4R8PK 1VYXA 2XB1A 4L58A 2M1RA 1MM3A 3L1XA
chains in the Genus database with same CATH superfamily
3T9KA 2EGMA 3ZNIA 4O64A 2FSAA 1JM7A 3LVRE 4IC3A 2YU4A 5B79A 2VP7A 4ZQLA 1JOCA 4A4CA 1WFKA 2QIZA 2KGIA 2DX8A 3O37A 3RTRB 3O70A 4YATA 1X4IA 4LADB 2QICA 5KH9A 2C2LA 4YADA 2LGVA 2VJEA 5KH7A 2JMIA 2HDPA 2RI7A 4YC9A 2YYRA 2YVRA 2ECNA 4GNGA 5FB1A 3SOUA 3ZVZB 2EGPA 5AITA 4N3WA 2MNZA 4GNEA 3L11A 3DPLR 4F1PA 1XWHA 2LGLA 2E6SA 3KV5A 2JM3A 2YT5A 1V87A 2G6QA 3FANA 3U5PA 4AYCB 3EB6A 3LDYA 2Y1MA 4BHWA 2KWNA 2VJFB 2KWOA 2NAAA 2ECJA 2XOZA 5TDRA 5B8DA 2MA5A 2L0BA 5K3QA 4WZ2A 2KGGA 2HYED 3HCSA 2K17A 3M62A 1WEVA 2RR4A 3HTKC 2ECVA 2IDAA 4F52B 5FERA 1WESA 3LRQA 5J3XA 2LAUA 1Z2QA 1MM2A 4YAXA 2YURA 2KR4A 2E6RA 4P5OB 3MDBC 4W4UA 4X3GA 2ECIA 1WEPA 5H9MA 3O36A 3C5KA 4UP0A 3PURA 5FEYA 1WEOA 2LRIC 2G45A 1K2FA 3DWDA 1G25A 2QJ0A 4R7EA 3C6WA 3GV4A 5TDWA 4XI1A 4PPEA 2M85A 2CRRA 2KU3A 1X4UA 2KFTA 2P57A 3SOWA 2KIZA 5H1TA 4ZUXU 1WGMA 1DCQA 3LJUX 2YQMA 2YW8A 3HCUA 4CA1A 2LGKA 1U6GB 5SVIA 4GNDA 4QQ4A 3SHBA 2D8SA 4V3KC 1VFYA 4Z0RA 2PUYA 3N9LA 3FL2A 2IQJA 1WEMA 4LLBA 2YSMA 2CT2A 2F42A 2YREA 5C13A 4V3LC 2XOCA 4LKAA 2LDRA 1N87A 4YBSA 2CSVA 5D1LB 2FUUA 4B7YC 5KH3A 2H0DB 4YBTA 2EXUA 2L7PA 3U5OA 3I2DA 2BAYA 3PHDA 3Q1DA 3FJUB 5B77A 1DVPA 3ZVYA 2VPGA 3SOXA 2C2VS 5JG6A 3SUBA 3ASLA 4A0CD 1LDKC 3FEHA 2FD4A 4I7DA 4H9DA 4B86C 5C11A 2RSDA 2CSZA 2VPDA 3KNVA 1E4UA 2MUMA 2LV9A 4OGEA 2MD8C 4WZ0A 3FM8C 4FK5A 1X4JA 2PNXA 3ZYQA 1FBVA 2CSYA 2M6MA 3N9OA 2K1JA 2Y43A 3PLWA 4FIPA 2M3HA 3NG2A 5B78A 2MA6A 5SVXA 3KV6A 2VNFA 2G43A 2L43A 3RPGC 4OGCA 4S3OC 2XEUA 2LXPC 2KKYA 3T6RA 4GB0A 3QZVA 3N9NA 2KYUA 1RMDA 4A49A 2L5UA 3N9PA 3JUEA 2VJFA 3EB5A 4TKPB 1WEEA 2VPBA 5SVYA 1WE9A 4QF3A 3PUQA 3MHSA 3LQJA 2CKLB 2MNYA 5G04B 2K16A 2DJAA 3ZPVE 4Q6FA 2ZETC 3KQIA 1WENA 3LQHA 4N4FA 2VPEA 1F62A 4R2YA 5B75A 1JM7B 2CONA 2CRWA 2ECGA 4S3OB 1WIMA 2LN0A 2L75A 3LQIA 4AP4A 2XOYA 2MD7B 5G0FA 5TBNA 2KREA 2JMJA 4UP5A 2KKXA 2AN6A 1Z6UA 2VJEB 2I50A 3N9MA 4PTBA 4MSXA 5EYAF 5LKZA 5TRBA 5DINA 3FAOA 4O62A 2XP0A 5I3LA 1Z60A 2LGGA 3VK6A 5LCWB 3IHPA 3MHHA 2JUNA 4AUQB 4IC2A 2LQ6A 3U5MA 2Y1NA 2YUCA 3V43A 3M63A 1MBMA 2OWAA 4L7XA 3M7KA 2EA6A 5TABA 2F6JA 3ZTGA 2E61A 1WEUA 1WEQA 5LKXA 2FFWA 2ECWA 2H0DA 4A4BA 1HYJA 3O33A 5DKAA 3O7AA 4LK9A 5G05B 4NN2A 4MVTA 1ZBDB 1VD4A 5D1MB 5B76A 2UZGA 4ZDTA 2OXQC 3N9QA 2YHOA 2KWJA 2D8UA 5LKTA 1T1HA 1FP0A 4AVXA 3U5NA 4Z0OA 1CHCA 2MIQA 4I7CA 3LVQE 3KDEC 2B0OE 4AYCA 2F6NA 2JRJA 3ZPV1 3H7HA 4FO9A 1LDJB 5H1VA 4UI9B 2LXHC 2KWKA 4I7BA 4LJNA 5FB0A 5AIUA 5LKUA 3HCTA 3DQVR 4FJCA 5D1KB 4GNFA 2KE1A 2ECTA 5SVIB 1WILA 2MKEA 3DDTA 2MT5A 4WZ3B 3T7LA 3O47A 4YABA 3O34A 4BBQA 2L80A 3L1ZB 2K4DA 5H1UA 2JMDA 3E2DA 3RPGB 4QF2A 2YSJA 2YHNA 4C9ZA 3M99A 4WA6A 3GL6A 1IYMA 2M13A 1BORA 2FUIA 2EODA 4CCGX 3O35A 2CKLA 1HYIA 2YQLA 1WEWA 4YBMA 4R8PK 1VYXA 2DSMA 2XB1A 4L58A 2M1RA 1MM3A 3L1XA
chains in the Genus database with same CATH topology
3ZNIA 4O64A 2FSAA 1JM7A 4IC3A 2YU4A 5B79A 2VP7A 4ZQLA 1JOCA 4A4CA 1WFKA 2QIZA 2KGIA 2DX8A 3O37A 3RTRB 3O70A 4YATA 1X4IA 4LADB 2QICA 5KH9A 2C2LA 4YADA 2LGVA 2VJEA 5KH7A 2JMIA 2HDPA 2RI7A 4YC9A 2YYRA 2ECNA 4GNGA 5FB1A 3SOUA 3ZVZB 2EGPA 5AITA 4N3WA 2MNZA 4GNEA 3L11A 3DPLR 1XWHA 2LGLA 2E6SA 3KV5A 2YT5A 1V87A 2G6QA 3U5PA 4AYCB 3EB6A 2Y1MA 4BHWA 2KWNA 2VJFB 2KWOA 2NAAA 2ECJA 5TDRA 5B8DA 2MA5A 2L0BA 4WZ2A 2KGGA 2HYED 3HCSA 2K17A 3M62A 1WEVA 3HTKC 2ECVA 2IDAA 4F52B 5FERA 1WESA 3LRQA 5J3XA 1Z2QA 1MM2A 4YAXA 2YURA 2KR4A 2E6RA 4P5OB 4W4UA 4X3GA 2ECIA 1WEPA 5H9MA 3O36A 3C5KA 4UP0A 3PURA 5FEYA 1WEOA 2LRIC 2G45A 1K2FA 1G25A 2QJ0A 4R7EA 3C6WA 3GV4A 5TDWA 4XI1A 4PPEA 2M85A 2KU3A 1X4UA 2KFTA 3SOWA 2KIZA 5H1TA 4ZUXU 1WGMA 2YQMA 2YW8A 3HCUA 4CA1A 2LGKA 1U6GB 4GNDA 3SHBA 2D8SA 4V3KC 1VFYA 2PUYA 3FL2A 3N9LA 1WEMA 4LLBA 2YSMA 2CT2A 2F42A 2YREA 5C13A 4V3LC 4LKAA 2LDRA 1N87A 4YBSA 5D1LB 2FUUA 4B7YC 5KH3A 2H0DB 4YBTA 3U5OA 3I2DA 2BAYA 3PHDA 5B77A 1DVPA 3ZVYA 2VPGA 3SOXA 2C2VS 5JG6A 3ASLA 4A0CD 1LDKC 4I7DA 4B86C 5C11A 2RSDA 2CSZA 2VPDA 3KNVA 1E4UA 2MUMA 2LV9A 2MD8C 4WZ0A 4FK5A 1X4JA 2PNXA 3ZYQA 1FBVA 2CSYA 2M6MA 3N9OA 2K1JA 2Y43A 4FIPA 2M3HA 3NG2A 5B78A 2MA6A 3KV6A 2VNFA 2G43A 2L43A 3RPGC 4S3OC 2XEUA 2LXPC 3T6RA 4GB0A 3QZVA 3N9NA 2KYUA 1RMDA 4A49A 2L5UA 3N9PA 2VJFA 3EB5A 4TKPB 1WEEA 2VPBA 1WE9A 4QF3A 3PUQA 3MHSA 3LQJA 2CKLB 2MNYA 5G04B 2K16A 3ZPVE 4Q6FA 2ZETC 3KQIA 1WENA 3LQHA 4N4FA 2VPEA 1F62A 4R2YA 5B75A 1JM7B 2ECGA 4S3OB 1WIMA 2LN0A 2L75A 3LQIA 4AP4A 2MD7B 5G0FA 5TBNA 2KREA 2JMJA 4UP5A 2AN6A 1Z6UA 2VJEB 2I50A 3N9MA 4PTBA 4MSXA 5EYAF 5LKZA 5TRBA 5DINA 5I3LA 1Z60A 2LGGA 3VK6A 5LCWB 3IHPA 3MHHA 4AUQB 4IC2A 2LQ6A 3U5MA 2Y1NA 2YUCA 3V43A 3M63A 4L7XA 2EA6A 5TABA 2F6JA 3ZTGA 1WEUA 1WEQA 5LKXA 2ECWA 2H0DA 4A4BA 1HYJA 3O33A 5DKAA 3O7AA 4LK9A 5G05B 4NN2A 4MVTA 1ZBDB 1VD4A 5D1MB 5B76A 2UZGA 4ZDTA 2OXQC 3N9QA 2YHOA 2KWJA 5LKTA 1T1HA 1FP0A 4AVXA 3U5NA 1CHCA 2MIQA 4I7CA 4AYCA 2F6NA 2JRJA 3ZPV1 4FO9A 1LDJB 5H1VA 4UI9B 2LXHC 2KWKA 4I7BA 4LJNA 5FB0A 5AIUA 5LKUA 3HCTA 3DQVR 4FJCA 5D1KB 4GNFA 2KE1A 2ECTA 1WILA 2MT5A 4WZ3B 3T7LA 4YABA 3O34A 4BBQA 2L80A 3L1ZB 2K4DA 5H1UA 2JMDA 3RPGB 4QF2A 2YSJA 2YHNA 4C9ZA 3M99A 4WA6A 3GL6A 1IYMA 1BORA 2FUIA 2EODA 4CCGX 3O35A 2CKLA 1HYIA 2YQLA 1WEWA 4YBMA 4R8PK 1VYXA 2XB1A 4L58A 2M1RA 1MM3A 3L1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNI A;  4O64 A;  2FSA A;  1JM7 A;  4IC3 A;  2YU4 A;  5B79 A;  2VP7 A;  4ZQL A;  1JOC A;  4A4C A;  1WFK A;  2QIZ A;  2KGI A;  2DX8 A;  3O37 A;  3RTR B;  3O70 A;  4YAT A;  1X4I A;  4LAD B;  2QIC A;  5KH9 A;  2C2L A;  4YAD A;  2LGV A;  2VJE A;  5KH7 A;  2JMI A;  2HDP A;  2RI7 A;  4YC9 A;  2YYR A;  2ECN A;  4GNG A;  5FB1 A;  3SOU A;  3ZVZ B;  2EGP A;  5AIT A;  4N3W A;  2MNZ A;  4GNE A;  3L11 A;  3DPL R;  1XWH A;  2LGL A;  2E6S A;  3KV5 A;  2YT5 A;  1V87 A;  2G6Q A;  3U5P A;  4AYC B;  3EB6 A;  2Y1M A;  4BHW A;  2KWN A;  2VJF B;  2KWO A;  2NAA A;  2ECJ A;  5TDR A;  5B8D A;  2MA5 A;  2L0B A;  4WZ2 A;  2KGG A;  2HYE D;  3HCS A;  2K17 A;  3M62 A;  1WEV A;  3HTK C;  2ECV A;  2IDA A;  4F52 B;  5FER A;  1WES A;  3LRQ A;  5J3X A;  1Z2Q A;  1MM2 A;  4YAX A;  2YUR A;  2KR4 A;  2E6R A;  4P5O B;  4W4U A;  4X3G A;  2ECI A;  1WEP A;  5H9M A;  3O36 A;  3C5K A;  4UP0 A;  3PUR A;  5FEY A;  1WEO A;  2LRI C;  2G45 A;  1K2F A;  1G25 A;  2QJ0 A;  4R7E A;  3C6W A;  3GV4 A;  5TDW A;  4XI1 A;  4PPE A;  2M85 A;  2KU3 A;  1X4U A;  2KFT A;  3SOW A;  2KIZ A;  5H1T A;  4ZUX U;  1WGM A;  2YQM A;  2YW8 A;  3HCU A;  4CA1 A;  2LGK A;  1U6G B;  4GND A;  3SHB A;  2D8S A;  4V3K C;  1VFY A;  2PUY A;  3FL2 A;  3N9L A;  1WEM A;  4LLB A;  2YSM A;  2CT2 A;  2F42 A;  2YRE A;  5C13 A;  4V3L C;  4LKA A;  2LDR A;  1N87 A;  4YBS A;  5D1L B;  2FUU A;  4B7Y C;  5KH3 A;  2H0D B;  4YBT A;  3U5O A;  3I2D A;  2BAY A;  3PHD A;  5B77 A;  1DVP A;  3ZVY A;  2VPG A;  3SOX A;  2C2V S;  5JG6 A;  3ASL A;  4A0C D;  1LDK C;  4I7D A;  4B86 C;  5C11 A;  2RSD A;  2CSZ A;  2VPD A;  3KNV A;  1E4U A;  2MUM A;  2LV9 A;  2MD8 C;  4WZ0 A;  4FK5 A;  1X4J A;  2PNX A;  3ZYQ A;  1FBV A;  2CSY A;  2M6M A;  3N9O A;  2K1J A;  2Y43 A;  4FIP A;  2M3H A;  3NG2 A;  5B78 A;  2MA6 A;  3KV6 A;  2VNF A;  2G43 A;  2L43 A;  3RPG C;  4S3O C;  2XEU A;  2LXP C;  3T6R A;  4GB0 A;  3QZV A;  3N9N A;  2KYU A;  1RMD A;  4A49 A;  2L5U A;  3N9P A;  2VJF A;  3EB5 A;  4TKP B;  1WEE A;  2VPB A;  1WE9 A;  4QF3 A;  3PUQ A;  3MHS A;  3LQJ A;  2CKL B;  2MNY A;  5G04 B;  2K16 A;  3ZPV E;  4Q6F A;  2ZET C;  3KQI A;  1WEN A;  3LQH A;  4N4F A;  2VPE A;  1F62 A;  4R2Y A;  5B75 A;  1JM7 B;  2ECG A;  4S3O B;  1WIM A;  2LN0 A;  2L75 A;  3LQI A;  4AP4 A;  2MD7 B;  5G0F A;  5TBN A;  2KRE A;  2JMJ A;  4UP5 A;  2AN6 A;  1Z6U A;  2VJE B;  2I50 A;  3N9M A;  4PTB A;  4MSX A;  5EYA F;  5LKZ A;  5TRB A;  5DIN A;  5I3L A;  1Z60 A;  2LGG A;  3VK6 A;  5LCW B;  3IHP A;  3MHH A;  4AUQ B;  4IC2 A;  2LQ6 A;  3U5M A;  2Y1N A;  2YUC A;  3V43 A;  3M63 A;  4L7X A;  2EA6 A;  5TAB A;  2F6J A;  3ZTG A;  1WEU A;  1WEQ A;  5LKX A;  2ECW A;  2H0D A;  4A4B A;  1HYJ A;  3O33 A;  5DKA A;  3O7A A;  4LK9 A;  5G05 B;  4NN2 A;  4MVT A;  1ZBD B;  1VD4 A;  5D1M B;  5B76 A;  2UZG A;  4ZDT A;  2OXQ C;  3N9Q A;  2YHO A;  2KWJ A;  5LKT A;  1T1H A;  1FP0 A;  4AVX A;  3U5N A;  1CHC A;  2MIQ A;  4I7C A;  4AYC A;  2F6N A;  2JRJ A;  3ZPV 1;  4FO9 A;  1LDJ B;  5H1V A;  4UI9 B;  2LXH C;  2KWK A;  4I7B A;  4LJN A;  5FB0 A;  5AIU A;  5LKU A;  3HCT A;  3DQV R;  4FJC A;  5D1K B;  4GNF A;  2KE1 A;  2ECT A;  1WIL A;  2MT5 A;  4WZ3 B;  3T7L A;  4YAB A;  3O34 A;  4BBQ A;  2L80 A;  3L1Z B;  2K4D A;  5H1U A;  2JMD A;  3RPG B;  4QF2 A;  2YSJ A;  2YHN A;  4C9Z A;  3M99 A;  4WA6 A;  3GL6 A;  1IYM A;  1BOR A;  2FUI A;  2EOD A;  4CCG X;  3O35 A;  2CKL A;  1HYI A;  2YQL A;  1WEW A;  4YBM A;  4R8P K;  1VYX A;  2XB1 A;  4L58 A;  2M1R A;  1MM3 A;  3L1X A; 
#chains in the Genus database with same CATH topology
 3T9K A;  2EGM A;  3ZNI A;  4O64 A;  2FSA A;  1JM7 A;  3LVR E;  4IC3 A;  2YU4 A;  5B79 A;  2VP7 A;  4ZQL A;  1JOC A;  4A4C A;  1WFK A;  2QIZ A;  2KGI A;  2DX8 A;  3O37 A;  3RTR B;  3O70 A;  4YAT A;  1X4I A;  4LAD B;  2QIC A;  5KH9 A;  2C2L A;  4YAD A;  2LGV A;  2VJE A;  5KH7 A;  2JMI A;  2HDP A;  2RI7 A;  4YC9 A;  2YYR A;  2YVR A;  2ECN A;  4GNG A;  5FB1 A;  3SOU A;  3ZVZ B;  2EGP A;  5AIT A;  4N3W A;  2MNZ A;  4GNE A;  3L11 A;  3DPL R;  4F1P A;  1XWH A;  2LGL A;  2E6S A;  3KV5 A;  2JM3 A;  2YT5 A;  1V87 A;  2G6Q A;  3FAN A;  3U5P A;  4AYC B;  3EB6 A;  3LDY A;  2Y1M A;  4BHW A;  2KWN A;  2VJF B;  2KWO A;  2NAA A;  2ECJ A;  2XOZ A;  5TDR A;  5B8D A;  2MA5 A;  2L0B A;  5K3Q A;  4WZ2 A;  2KGG A;  2HYE D;  3HCS A;  2K17 A;  3M62 A;  1WEV A;  2RR4 A;  3HTK C;  2ECV A;  2IDA A;  4F52 B;  5FER A;  1WES A;  3LRQ A;  5J3X A;  2LAU A;  1Z2Q A;  1MM2 A;  4YAX A;  2YUR A;  2KR4 A;  2E6R A;  4P5O B;  3MDB C;  4W4U A;  4X3G A;  2ECI A;  1WEP A;  5H9M A;  3O36 A;  3C5K A;  4UP0 A;  3PUR A;  5FEY A;  1WEO A;  2LRI C;  2G45 A;  1K2F A;  3DWD A;  1G25 A;  2QJ0 A;  4R7E A;  3C6W A;  3GV4 A;  5TDW A;  4XI1 A;  4PPE A;  2M85 A;  2CRR A;  2KU3 A;  1X4U A;  2KFT A;  2P57 A;  3SOW A;  2KIZ A;  5H1T A;  4ZUX U;  1WGM A;  1DCQ A;  3LJU X;  2YQM A;  2YW8 A;  3HCU A;  4CA1 A;  2LGK A;  1U6G B;  5SVI A;  4GND A;  4QQ4 A;  3SHB A;  2D8S A;  4V3K C;  1VFY A;  4Z0R A;  2PUY A;  3N9L A;  3FL2 A;  2IQJ A;  1WEM A;  4LLB A;  2YSM A;  2CT2 A;  2F42 A;  2YRE A;  5C13 A;  4V3L C;  2XOC A;  4LKA A;  2LDR A;  1N87 A;  4YBS A;  2CSV A;  5D1L B;  2FUU A;  4B7Y C;  5KH3 A;  2H0D B;  4YBT A;  2EXU A;  2L7P A;  3U5O A;  3I2D A;  2BAY A;  3PHD A;  3Q1D A;  3FJU B;  5B77 A;  1DVP A;  3ZVY A;  2VPG A;  3SOX A;  2C2V S;  5JG6 A;  3SUB A;  3ASL A;  4A0C D;  1LDK C;  3FEH A;  2FD4 A;  4I7D A;  4H9D A;  4B86 C;  5C11 A;  2RSD A;  2CSZ A;  2VPD A;  3KNV A;  1E4U A;  2MUM A;  2LV9 A;  4OGE A;  2MD8 C;  4WZ0 A;  3FM8 C;  4FK5 A;  1X4J A;  2PNX A;  3ZYQ A;  1FBV A;  2CSY A;  2M6M A;  3N9O A;  2K1J A;  2Y43 A;  3PLW A;  4FIP A;  2M3H A;  3NG2 A;  5B78 A;  2MA6 A;  5SVX A;  3KV6 A;  2VNF A;  2G43 A;  2L43 A;  3RPG C;  4OGC A;  4S3O C;  2XEU A;  2LXP C;  2KKY A;  3T6R A;  4GB0 A;  3QZV A;  3N9N A;  2KYU A;  1RMD A;  4A49 A;  2L5U A;  3N9P A;  3JUE A;  2VJF A;  3EB5 A;  4TKP B;  1WEE A;  2VPB A;  5SVY A;  1WE9 A;  4QF3 A;  3PUQ A;  3MHS A;  3LQJ A;  2CKL B;  2MNY A;  5G04 B;  2K16 A;  2DJA A;  3ZPV E;  4Q6F A;  2ZET C;  3KQI A;  1WEN A;  3LQH A;  4N4F A;  2VPE A;  1F62 A;  4R2Y A;  5B75 A;  1JM7 B;  2CON A;  2CRW A;  2ECG A;  4S3O B;  1WIM A;  2LN0 A;  2L75 A;  3LQI A;  4AP4 A;  2XOY A;  2MD7 B;  5G0F A;  5TBN A;  2KRE A;  2JMJ A;  4UP5 A;  2KKX A;  2AN6 A;  1Z6U A;  2VJE B;  2I50 A;  3N9M A;  4PTB A;  4MSX A;  5EYA F;  5LKZ A;  5TRB A;  5DIN A;  3FAO A;  4O62 A;  2XP0 A;  5I3L A;  1Z60 A;  2LGG A;  3VK6 A;  5LCW B;  3IHP A;  3MHH A;  2JUN A;  4AUQ B;  4IC2 A;  2LQ6 A;  3U5M A;  2Y1N A;  2YUC A;  3V43 A;  3M63 A;  1MBM A;  2OWA A;  4L7X A;  3M7K A;  2EA6 A;  5TAB A;  2F6J A;  3ZTG A;  2E61 A;  1WEU A;  1WEQ A;  5LKX A;  2FFW A;  2ECW A;  2H0D A;  4A4B A;  1HYJ A;  3O33 A;  5DKA A;  3O7A A;  4LK9 A;  5G05 B;  4NN2 A;  4MVT A;  1ZBD B;  1VD4 A;  5D1M B;  5B76 A;  2UZG A;  4ZDT A;  2OXQ C;  3N9Q A;  2YHO A;  2KWJ A;  2D8U A;  5LKT A;  1T1H A;  1FP0 A;  4AVX A;  3U5N A;  4Z0O A;  1CHC A;  2MIQ A;  4I7C A;  3LVQ E;  3KDE C;  2B0O E;  4AYC A;  2F6N A;  2JRJ A;  3ZPV 1;  3H7H A;  4FO9 A;  1LDJ B;  5H1V A;  4UI9 B;  2LXH C;  2KWK A;  4I7B A;  4LJN A;  5FB0 A;  5AIU A;  5LKU A;  3HCT A;  3DQV R;  4FJC A;  5D1K B;  4GNF A;  2KE1 A;  2ECT A;  5SVI B;  1WIL A;  2MKE A;  3DDT A;  2MT5 A;  4WZ3 B;  3T7L A;  3O47 A;  4YAB A;  3O34 A;  4BBQ A;  2L80 A;  3L1Z B;  2K4D A;  5H1U A;  2JMD A;  3E2D A;  3RPG B;  4QF2 A;  2YSJ A;  2YHN A;  4C9Z A;  3M99 A;  4WA6 A;  3GL6 A;  1IYM A;  2M13 A;  1BOR A;  2FUI A;  2EOD A;  4CCG X;  3O35 A;  2CKL A;  1HYI A;  2YQL A;  1WEW A;  4YBM A;  4R8P K;  1VYX A;  2DSM A;  2XB1 A;  4L58 A;  2M1R A;  1MM3 A;  3L1X A; 
#chains in the Genus database with same CATH homology
 3ZNI A;  4O64 A;  2FSA A;  1JM7 A;  4IC3 A;  2YU4 A;  5B79 A;  2VP7 A;  4ZQL A;  1JOC A;  4A4C A;  1WFK A;  2QIZ A;  2KGI A;  2DX8 A;  3O37 A;  3RTR B;  3O70 A;  4YAT A;  1X4I A;  4LAD B;  2QIC A;  5KH9 A;  2C2L A;  4YAD A;  2LGV A;  2VJE A;  5KH7 A;  2JMI A;  2HDP A;  2RI7 A;  4YC9 A;  2YYR A;  2ECN A;  4GNG A;  5FB1 A;  3SOU A;  3ZVZ B;  2EGP A;  5AIT A;  4N3W A;  2MNZ A;  4GNE A;  3L11 A;  3DPL R;  1XWH A;  2LGL A;  2E6S A;  3KV5 A;  2YT5 A;  1V87 A;  2G6Q A;  3U5P A;  4AYC B;  3EB6 A;  2Y1M A;  4BHW A;  2KWN A;  2VJF B;  2KWO A;  2NAA A;  2ECJ A;  5TDR A;  5B8D A;  2MA5 A;  2L0B A;  4WZ2 A;  2KGG A;  2HYE D;  3HCS A;  2K17 A;  3M62 A;  1WEV A;  3HTK C;  2ECV A;  2IDA A;  4F52 B;  5FER A;  1WES A;  3LRQ A;  5J3X A;  1Z2Q A;  1MM2 A;  4YAX A;  2YUR A;  2KR4 A;  2E6R A;  4P5O B;  4W4U A;  4X3G A;  2ECI A;  1WEP A;  5H9M A;  3O36 A;  3C5K A;  4UP0 A;  3PUR A;  5FEY A;  1WEO A;  2LRI C;  2G45 A;  1K2F A;  1G25 A;  2QJ0 A;  4R7E A;  3C6W A;  3GV4 A;  5TDW A;  4XI1 A;  4PPE A;  2M85 A;  2KU3 A;  1X4U A;  2KFT A;  3SOW A;  2KIZ A;  5H1T A;  4ZUX U;  1WGM A;  2YQM A;  2YW8 A;  3HCU A;  4CA1 A;  2LGK A;  1U6G B;  4GND A;  3SHB A;  2D8S A;  4V3K C;  1VFY A;  2PUY A;  3FL2 A;  3N9L A;  1WEM A;  4LLB A;  2YSM A;  2CT2 A;  2F42 A;  2YRE A;  5C13 A;  4V3L C;  4LKA A;  2LDR A;  1N87 A;  4YBS A;  5D1L B;  2FUU A;  4B7Y C;  5KH3 A;  2H0D B;  4YBT A;  3U5O A;  3I2D A;  2BAY A;  3PHD A;  5B77 A;  1DVP A;  3ZVY A;  2VPG A;  3SOX A;  2C2V S;  5JG6 A;  3ASL A;  4A0C D;  1LDK C;  4I7D A;  4B86 C;  5C11 A;  2RSD A;  2CSZ A;  2VPD A;  3KNV A;  1E4U A;  2MUM A;  2LV9 A;  2MD8 C;  4WZ0 A;  4FK5 A;  1X4J A;  2PNX A;  3ZYQ A;  1FBV A;  2CSY A;  2M6M A;  3N9O A;  2K1J A;  2Y43 A;  4FIP A;  2M3H A;  3NG2 A;  5B78 A;  2MA6 A;  3KV6 A;  2VNF A;  2G43 A;  2L43 A;  3RPG C;  4S3O C;  2XEU A;  2LXP C;  3T6R A;  4GB0 A;  3QZV A;  3N9N A;  2KYU A;  1RMD A;  4A49 A;  2L5U A;  3N9P A;  2VJF A;  3EB5 A;  4TKP B;  1WEE A;  2VPB A;  1WE9 A;  4QF3 A;  3PUQ A;  3MHS A;  3LQJ A;  2CKL B;  2MNY A;  5G04 B;  2K16 A;  3ZPV E;  4Q6F A;  2ZET C;  3KQI A;  1WEN A;  3LQH A;  4N4F A;  2VPE A;  1F62 A;  4R2Y A;  5B75 A;  1JM7 B;  2ECG A;  4S3O B;  1WIM A;  2LN0 A;  2L75 A;  3LQI A;  4AP4 A;  2MD7 B;  5G0F A;  5TBN A;  2KRE A;  2JMJ A;  4UP5 A;  2AN6 A;  1Z6U A;  2VJE B;  2I50 A;  3N9M A;  4PTB A;  4MSX A;  5EYA F;  5LKZ A;  5TRB A;  5DIN A;  5I3L A;  1Z60 A;  2LGG A;  3VK6 A;  5LCW B;  3IHP A;  3MHH A;  4AUQ B;  4IC2 A;  2LQ6 A;  3U5M A;  2Y1N A;  2YUC A;  3V43 A;  3M63 A;  4L7X A;  2EA6 A;  5TAB A;  2F6J A;  3ZTG A;  1WEU A;  1WEQ A;  5LKX A;  2ECW A;  2H0D A;  4A4B A;  1HYJ A;  3O33 A;  5DKA A;  3O7A A;  4LK9 A;  5G05 B;  4NN2 A;  4MVT A;  1ZBD B;  1VD4 A;  5D1M B;  5B76 A;  2UZG A;  4ZDT A;  2OXQ C;  3N9Q A;  2YHO A;  2KWJ A;  5LKT A;  1T1H A;  1FP0 A;  4AVX A;  3U5N A;  1CHC A;  2MIQ A;  4I7C A;  4AYC A;  2F6N A;  2JRJ A;  3ZPV 1;  4FO9 A;  1LDJ B;  5H1V A;  4UI9 B;  2LXH C;  2KWK A;  4I7B A;  4LJN A;  5FB0 A;  5AIU A;  5LKU A;  3HCT A;  3DQV R;  4FJC A;  5D1K B;  4GNF A;  2KE1 A;  2ECT A;  1WIL A;  2MT5 A;  4WZ3 B;  3T7L A;  4YAB A;  3O34 A;  4BBQ A;  2L80 A;  3L1Z B;  2K4D A;  5H1U A;  2JMD A;  3RPG B;  4QF2 A;  2YSJ A;  2YHN A;  4C9Z A;  3M99 A;  4WA6 A;  3GL6 A;  1IYM A;  1BOR A;  2FUI A;  2EOD A;  4CCG X;  3O35 A;  2CKL A;  1HYI A;  2YQL A;  1WEW A;  4YBM A;  4R8P K;  1VYX A;  2XB1 A;  4L58 A;  2M1R A;  1MM3 A;  3L1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...