4GNDA

Crystal structure of nsd3 tandem phd5-c5hch domains
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase NSD3
publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 98
sequence length 98
chains with identical sequence C
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gndA00
4IC3A 2MNYA 2LRIC 2KE1A 3SHBA 2LDRA 3MHHA 1WE9A 2M3HA 5B78A 3N9QA 5FEYA 3M62A 4I7BA 5B75A 4F52B 2EODA 2YQMA 2CSYA 4GNGA 3KNVA 1HYIA 2K17A 1WFKA 4AVXA 5AITA 2CKLB 5FB1A 4YAXA 2LGGA 2VPGA 3T6RA 2UZGA 3DPLR 2Y1NA 2YURA 5LCWB 4A49A 5JG6A 3PURA 2KWNA 1RMDA 3KV5A 4XI1A 2KWKA 2YHNA 2MA5A 3U5OA 3V43A 2XEUA 2F42A 5G05B 1WEPA 2LGLA 3M63A 2L80A 2LGKA 5KH3A 4WZ3B 5B77A 1LDJB 4GNDA 3ZVYA 3U5MA 2K16A 5B76A 4P5OB 3LRQA 5C11A 4MSXA 2XB1A 3L1ZB 4L58A 2L0BA 4ZQLA 1CHCA 2KR4A 2VJEA 3RPGC 4YC9A 2C2LA 3SOUA 2CSZA 1HYJA 3HTKC 4C9ZA 2M1RA 2JMIA 4N4FA 1WEEA 4AYCA 2G43A 1V87A 3ZTGA 4R8PK 3MHSA 4UI9B 4AUQB 3ZNIA 2DX8A 5B8DA 2YT5A 1DVPA 2LV9A 2YU4A 4LK9A 4ZDTA 2EGPA 3HCSA 1LDKC 2ZETC 5H1UA 3O35A 3U5PA 1MM3A 3IHPA 3O34A 5D1KB 3N9NA 1WENA 2QJ0A 1T1HA 4L7XA 2VPBA 3M99A 2KU3A 2CT2A 3RTRB 1BORA 1X4JA 5TRBA 4LKAA 2M6MA 3ASLA 4O64A 3NG2A 1WILA 2ECNA 5H1VA 2LQ6A 4BBQA 2FSAA 2JMJA 1JM7A 4R7EA 3C5KA 3KV6A 1Z2QA 2ECIA 4UP5A 3RPGB 4CA1A 5FB0A 3ZVZB 5DKAA 3ZPVE 2L5UA 2H0DA 2KYUA 1VYXA 4V3LC 2YSMA 4IC2A 5KH9A 3LQIA 2HDPA 2MNZA 4QF3A 2L43A 4PTBA 2KIZA 4BHWA 1ZBDB 1MM2A 4MVTA 4N3WA 1WESA 5H9MA 2YW8A 3LQJA 1F62A 4GNFA 4A4BA 2LGVA 2VPDA 5B79A 2MD8C 5LKXA 2ECTA 4I7DA 5G04B 2VPEA 2FUUA 3C6WA 2MD7B 4WZ0A 4GNEA 2C2VS 2FUIA 2MUMA 2MT5A 4W4UA 2RSDA 2ECGA 2D8SA 2AN6A 2BAYA 5C13A 2YSJA 2KREA 1Z6UA 3I2DA 2KFTA 2ECVA 1WEOA 1WEVA 3N9OA 2G6QA 3N9MA 3DQVR 4YBSA 4V3KC 2F6NA 3VK6A 4PPEA 2YREA 2YHOA 3N9PA 3PHDA 2CKLA 4FJCA 5EYAF 2E6RA 3KQIA 3HCUA 2VJFB 3O33A 4NN2A 2LXPC 2YQLA 2VJEB 3O37A 3EB5A 3L11A 5J3XA 1FBVA 1VD4A 5AIUA 3O70A 3SOWA 1X4IA 5LKTA 3SOXA 2HYED 4AP4A 2F6JA 4B86C 4YATA 1X4UA 4AYCB 1WEUA 2JMDA 5KH7A 2YYRA 2KWJA 2VP7A 4YADA 5DINA 1WIMA 3HCTA 1K2FA 3ZYQA 3U5NA 1E4UA 4QF2A 4S3OC 3O7AA 2IDAA 2M85A 1WGMA 2MIQA 4R2YA 5TBNA 2PUYA 5FERA 2Y43A 3GV4A 4CCGX 4LLBA 4TKPB 2K1JA 2LN0A 3L1XA 2I50A 4FK5A 3T7LA 3ZPV1 4LJNA 4YABA 1XWHA 2K4DA 3FL2A 4ZUXU 5LKZA 1IYMA 2JRJA 4FO9A 1U6GB 3EB6A 2MA6A 2VNFA 1Z60A 2QIZA 2YUCA 4A0CD 1WEWA 4FIPA 3QZVA 1JM7B 5G0FA 2E6SA 2QICA 2ECWA 1WEQA 5H1TA 5D1MB 1WEMA 1N87A 2VJFA 2ECJA 4YBTA 4WZ2A 2KGGA 2H0DB 2PNXA 2LXHC 2OXQC 3LQHA 1FP0A 2KWOA 2RI7A 2NAAA 4YBMA 1VFYA 2EA6A 3N9LA 5TDRA 4S3OB 3GL6A 1JOCA 3O36A 4Q6FA 4X3GA 4WA6A 1G25A 3PUQA 5D1LB 5LKUA 2Y1MA 5I3LA 4UP0A 4I7CA 4GB0A 4LADB 4B7YC 5TABA 2G45A 2L75A 2KGIA 5TDWA 4A4CA
chains in the Genus database with same CATH superfamily
4IC3A 2CSVA 2MNYA 2LRIC 2KE1A 2OWAA 3SHBA 2LDRA 2D8UA 3MHHA 1WE9A 2M3HA 5B78A 3N9QA 5SVIB 5FEYA 3M62A 4I7BA 5B75A 4F52B 2EODA 2YQMA 2CSYA 2P57A 4GNGA 3KNVA 1HYIA 2K17A 1WFKA 4AVXA 5AITA 2CKLB 5FB1A 4YAXA 2LGGA 2VPGA 2CRRA 3T6RA 2UZGA 3DPLR 2Y1NA 2YURA 5LCWB 2CONA 2DJAA 4A49A 5JG6A 3PURA 3LJUX 2KWNA 1RMDA 3KV5A 4XI1A 2KWKA 2XOZA 3H7HA 2YHNA 2MA5A 3U5OA 3V43A 2XEUA 2F42A 5G05B 1WEPA 2LGLA 3M63A 2RR4A 2L80A 2LGKA 5KH3A 4WZ3B 2FD4A 5B77A 1LDJB 4GNDA 3ZVYA 3U5MA 2K16A 5B76A 4P5OB 3LRQA 5C11A 4MSXA 2XB1A 3L1ZB 4L58A 2L0BA 4ZQLA 1CHCA 2KR4A 2VJEA 3RPGC 4YC9A 2C2LA 3SOUA 2CSZA 1HYJA 3LDYA 2KKYA 3HTKC 4F1PA 4C9ZA 2M1RA 2JMIA 4N4FA 1WEEA 4AYCA 2G43A 1V87A 3ZTGA 4R8PK 3MHSA 4UI9B 4AUQB 3ZNIA 3FEHA 2DX8A 5B8DA 2YT5A 1DVPA 2LV9A 3DDTA 2FFWA 2CRWA 2YU4A 4LK9A 4ZDTA 2EGPA 3HCSA 1LDKC 2ZETC 5H1UA 1DCQA 3KDEC 3O35A 3U5PA 1MBMA 1MM3A 2IQJA 3IHPA 3O34A 5D1KB 3N9NA 1WENA 2QJ0A 1T1HA 4L7XA 4O62A 2VPBA 3SUBA 3M99A 2KU3A 2CT2A 3RTRB 4Z0OA 3O47A 1BORA 1X4JA 5TRBA 4LKAA 2M6MA 3ASLA 4O64A 3NG2A 1WILA 2LAUA 2ECNA 2LQ6A 5H1VA 4BBQA 2FSAA 4OGCA 2JMJA 1JM7A 4R7EA 3C5KA 3KV6A 1Z2QA 2ECIA 4UP5A 3RPGB 4CA1A 5FB0A 2E61A 3ZVZB 5DKAA 3ZPVE 2L5UA 2H0DA 2KYUA 1VYXA 4V3LC 2YSMA 4IC2A 2JUNA 4Z0RA 5KH9A 3LQIA 2EGMA 2HDPA 2MNZA 4QF3A 5K3QA 2L43A 4PTBA 2KIZA 4BHWA 1ZBDB 1MM2A 4MVTA 4N3WA 1WESA 5SVXA 5H9MA 2YW8A 3LQJA 1F62A 4GNFA 4A4BA 2LGVA 2VPDA 3FJUB 5B79A 2MD8C 5LKXA 2ECTA 4I7DA 5G04B 2VPEA 2FUUA 3C6WA 3T9KA 2MD7B 4WZ0A 4GNEA 2C2VS 2FUIA 2MUMA 2MT5A 4W4UA 2RSDA 2ECGA 2D8SA 2AN6A 2BAYA 5SVIA 5C13A 2YSJA 2KREA 2L7PA 1Z6UA 3I2DA 2B0OE 2KFTA 2ECVA 1WEOA 1WEVA 3N9OA 2G6QA 3N9MA 3DQVR 4YBSA 3LVRE 4V3KC 2F6NA 3VK6A 4PPEA 2YREA 2YHOA 3LVQE 3N9PA 3PHDA 2CKLA 4FJCA 5EYAF 2E6RA 3KQIA 3HCUA 2VJFB 3O33A 4NN2A 2LXPC 2YQLA 2VJEB 2DSMA 3O37A 3EB5A 3L11A 5J3XA 1FBVA 1VD4A 5AIUA 3O70A 3SOWA 1X4IA 2EXUA 5LKTA 4QQ4A 3SOXA 2HYED 4AP4A 2F6JA 4B86C 4YATA 1X4UA 4AYCB 1WEUA 2JMDA 2XOYA 5KH7A 2YYRA 2KWJA 2VP7A 4YADA 5DINA 1WIMA 3HCTA 1K2FA 3FAOA 3ZYQA 3U5NA 1E4UA 4QF2A 3DWDA 2XP0A 4S3OC 3O7AA 2IDAA 2KKXA 2M85A 1WGMA 2MIQA 4R2YA 5TBNA 2PUYA 3FANA 2Y43A 5FERA 3GV4A 4CCGX 4LLBA 4TKPB 2K1JA 2LN0A 3L1XA 2I50A 3FM8C 4FK5A 3T7LA 3ZPV1 4LJNA 4YABA 1XWHA 2XOCA 2K4DA 3FL2A 4ZUXU 5LKZA 1IYMA 2JRJA 4FO9A 1U6GB 3EB6A 3JUEA 2MA6A 2VNFA 2MKEA 1Z60A 2QIZA 2YUCA 4A0CD 1WEWA 4FIPA 2YVRA 3QZVA 1JM7B 3E2DA 5G0FA 2E6SA 2QICA 2ECWA 1WEQA 5H1TA 5D1MB 1WEMA 1N87A 2VJFA 2ECJA 4YBTA 4WZ2A 2KGGA 4OGEA 2H0DB 2PNXA 3MDBC 2LXHC 2JM3A 2OXQC 3LQHA 1FP0A 2KWOA 2RI7A 2NAAA 3M7KA 4YBMA 1VFYA 2EA6A 3N9LA 5TDRA 4S3OB 3GL6A 1JOCA 3O36A 4Q6FA 4X3GA 4WA6A 1G25A 4H9DA 3PUQA 5D1LB 5LKUA 2Y1MA 5I3LA 3PLWA 4UP0A 2M13A 4I7CA 4GB0A 5SVYA 4LADB 3Q1DA 4B7YC 5TABA 2G45A 2L75A 2KGIA 5TDWA 4A4CA
chains in the Genus database with same CATH topology
4IC3A 2MNYA 2LRIC 2KE1A 3SHBA 2LDRA 3MHHA 1WE9A 2M3HA 5B78A 3N9QA 5FEYA 3M62A 4I7BA 5B75A 4F52B 2EODA 2YQMA 2CSYA 4GNGA 3KNVA 1HYIA 2K17A 1WFKA 4AVXA 5AITA 2CKLB 5FB1A 4YAXA 2LGGA 2VPGA 3T6RA 2UZGA 3DPLR 2Y1NA 2YURA 5LCWB 4A49A 5JG6A 3PURA 2KWNA 1RMDA 3KV5A 4XI1A 2KWKA 2YHNA 2MA5A 3U5OA 3V43A 2XEUA 2F42A 5G05B 1WEPA 2LGLA 3M63A 2L80A 2LGKA 5KH3A 4WZ3B 5B77A 1LDJB 4GNDA 3ZVYA 3U5MA 2K16A 5B76A 4P5OB 3LRQA 5C11A 4MSXA 2XB1A 3L1ZB 4L58A 2L0BA 4ZQLA 1CHCA 2KR4A 2VJEA 3RPGC 4YC9A 2C2LA 3SOUA 2CSZA 1HYJA 3HTKC 4C9ZA 2M1RA 2JMIA 4N4FA 1WEEA 4AYCA 2G43A 1V87A 3ZTGA 4R8PK 3MHSA 4UI9B 4AUQB 3ZNIA 2DX8A 5B8DA 2YT5A 1DVPA 2LV9A 2YU4A 4LK9A 4ZDTA 2EGPA 3HCSA 1LDKC 2ZETC 5H1UA 3O35A 3U5PA 1MM3A 3IHPA 3O34A 5D1KB 3N9NA 1WENA 2QJ0A 1T1HA 4L7XA 2VPBA 3M99A 2KU3A 2CT2A 3RTRB 1BORA 1X4JA 5TRBA 4LKAA 2M6MA 3ASLA 4O64A 3NG2A 1WILA 2ECNA 5H1VA 2LQ6A 4BBQA 2FSAA 2JMJA 1JM7A 4R7EA 3C5KA 3KV6A 1Z2QA 2ECIA 4UP5A 3RPGB 4CA1A 5FB0A 3ZVZB 5DKAA 3ZPVE 2L5UA 2H0DA 2KYUA 1VYXA 4V3LC 2YSMA 4IC2A 5KH9A 3LQIA 2HDPA 2MNZA 4QF3A 2L43A 4PTBA 2KIZA 4BHWA 1ZBDB 1MM2A 4MVTA 4N3WA 1WESA 5H9MA 2YW8A 3LQJA 1F62A 4GNFA 4A4BA 2LGVA 2VPDA 5B79A 2MD8C 5LKXA 2ECTA 4I7DA 5G04B 2VPEA 2FUUA 3C6WA 2MD7B 4WZ0A 4GNEA 2C2VS 2FUIA 2MUMA 2MT5A 4W4UA 2RSDA 2ECGA 2D8SA 2AN6A 2BAYA 5C13A 2YSJA 2KREA 1Z6UA 3I2DA 2KFTA 2ECVA 1WEOA 1WEVA 3N9OA 2G6QA 3N9MA 3DQVR 4YBSA 4V3KC 2F6NA 3VK6A 4PPEA 2YREA 2YHOA 3N9PA 3PHDA 2CKLA 4FJCA 5EYAF 2E6RA 3KQIA 3HCUA 2VJFB 3O33A 4NN2A 2LXPC 2YQLA 2VJEB 3O37A 3EB5A 3L11A 5J3XA 1FBVA 1VD4A 5AIUA 3O70A 3SOWA 1X4IA 5LKTA 3SOXA 2HYED 4AP4A 2F6JA 4B86C 4YATA 1X4UA 4AYCB 1WEUA 2JMDA 5KH7A 2YYRA 2KWJA 2VP7A 4YADA 5DINA 1WIMA 3HCTA 1K2FA 3ZYQA 3U5NA 1E4UA 4QF2A 4S3OC 3O7AA 2IDAA 2M85A 1WGMA 2MIQA 4R2YA 5TBNA 2PUYA 5FERA 2Y43A 3GV4A 4CCGX 4LLBA 4TKPB 2K1JA 2LN0A 3L1XA 2I50A 4FK5A 3T7LA 3ZPV1 4LJNA 4YABA 1XWHA 2K4DA 3FL2A 4ZUXU 5LKZA 1IYMA 2JRJA 4FO9A 1U6GB 3EB6A 2MA6A 2VNFA 1Z60A 2QIZA 2YUCA 4A0CD 1WEWA 4FIPA 3QZVA 1JM7B 5G0FA 2E6SA 2QICA 2ECWA 1WEQA 5H1TA 5D1MB 1WEMA 1N87A 2VJFA 2ECJA 4YBTA 4WZ2A 2KGGA 2H0DB 2PNXA 2LXHC 2OXQC 3LQHA 1FP0A 2KWOA 2RI7A 2NAAA 4YBMA 1VFYA 2EA6A 3N9LA 5TDRA 4S3OB 3GL6A 1JOCA 3O36A 4Q6FA 4X3GA 4WA6A 1G25A 3PUQA 5D1LB 5LKUA 2Y1MA 5I3LA 4UP0A 4I7CA 4GB0A 4LADB 4B7YC 5TABA 2G45A 2L75A 2KGIA 5TDWA 4A4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC3 A;  2MNY A;  2LRI C;  2KE1 A;  3SHB A;  2LDR A;  3MHH A;  1WE9 A;  2M3H A;  5B78 A;  3N9Q A;  5FEY A;  3M62 A;  4I7B A;  5B75 A;  4F52 B;  2EOD A;  2YQM A;  2CSY A;  4GNG A;  3KNV A;  1HYI A;  2K17 A;  1WFK A;  4AVX A;  5AIT A;  2CKL B;  5FB1 A;  4YAX A;  2LGG A;  2VPG A;  3T6R A;  2UZG A;  3DPL R;  2Y1N A;  2YUR A;  5LCW B;  4A49 A;  5JG6 A;  3PUR A;  2KWN A;  1RMD A;  3KV5 A;  4XI1 A;  2KWK A;  2YHN A;  2MA5 A;  3U5O A;  3V43 A;  2XEU A;  2F42 A;  5G05 B;  1WEP A;  2LGL A;  3M63 A;  2L80 A;  2LGK A;  5KH3 A;  4WZ3 B;  5B77 A;  1LDJ B;  4GND A;  3ZVY A;  3U5M A;  2K16 A;  5B76 A;  4P5O B;  3LRQ A;  5C11 A;  4MSX A;  2XB1 A;  3L1Z B;  4L58 A;  2L0B A;  4ZQL A;  1CHC A;  2KR4 A;  2VJE A;  3RPG C;  4YC9 A;  2C2L A;  3SOU A;  2CSZ A;  1HYJ A;  3HTK C;  4C9Z A;  2M1R A;  2JMI A;  4N4F A;  1WEE A;  4AYC A;  2G43 A;  1V87 A;  3ZTG A;  4R8P K;  3MHS A;  4UI9 B;  4AUQ B;  3ZNI A;  2DX8 A;  5B8D A;  2YT5 A;  1DVP A;  2LV9 A;  2YU4 A;  4LK9 A;  4ZDT A;  2EGP A;  3HCS A;  1LDK C;  2ZET C;  5H1U A;  3O35 A;  3U5P A;  1MM3 A;  3IHP A;  3O34 A;  5D1K B;  3N9N A;  1WEN A;  2QJ0 A;  1T1H A;  4L7X A;  2VPB A;  3M99 A;  2KU3 A;  2CT2 A;  3RTR B;  1BOR A;  1X4J A;  5TRB A;  4LKA A;  2M6M A;  3ASL A;  4O64 A;  3NG2 A;  1WIL A;  2ECN A;  5H1V A;  2LQ6 A;  4BBQ A;  2FSA A;  2JMJ A;  1JM7 A;  4R7E A;  3C5K A;  3KV6 A;  1Z2Q A;  2ECI A;  4UP5 A;  3RPG B;  4CA1 A;  5FB0 A;  3ZVZ B;  5DKA A;  3ZPV E;  2L5U A;  2H0D A;  2KYU A;  1VYX A;  4V3L C;  2YSM A;  4IC2 A;  5KH9 A;  3LQI A;  2HDP A;  2MNZ A;  4QF3 A;  2L43 A;  4PTB A;  2KIZ A;  4BHW A;  1ZBD B;  1MM2 A;  4MVT A;  4N3W A;  1WES A;  5H9M A;  2YW8 A;  3LQJ A;  1F62 A;  4GNF A;  4A4B A;  2LGV A;  2VPD A;  5B79 A;  2MD8 C;  5LKX A;  2ECT A;  4I7D A;  5G04 B;  2VPE A;  2FUU A;  3C6W A;  2MD7 B;  4WZ0 A;  4GNE A;  2C2V S;  2FUI A;  2MUM A;  2MT5 A;  4W4U A;  2RSD A;  2ECG A;  2D8S A;  2AN6 A;  2BAY A;  5C13 A;  2YSJ A;  2KRE A;  1Z6U A;  3I2D A;  2KFT A;  2ECV A;  1WEO A;  1WEV A;  3N9O A;  2G6Q A;  3N9M A;  3DQV R;  4YBS A;  4V3K C;  2F6N A;  3VK6 A;  4PPE A;  2YRE A;  2YHO A;  3N9P A;  3PHD A;  2CKL A;  4FJC A;  5EYA F;  2E6R A;  3KQI A;  3HCU A;  2VJF B;  3O33 A;  4NN2 A;  2LXP C;  2YQL A;  2VJE B;  3O37 A;  3EB5 A;  3L11 A;  5J3X A;  1FBV A;  1VD4 A;  5AIU A;  3O70 A;  3SOW A;  1X4I A;  5LKT A;  3SOX A;  2HYE D;  4AP4 A;  2F6J A;  4B86 C;  4YAT A;  1X4U A;  4AYC B;  1WEU A;  2JMD A;  5KH7 A;  2YYR A;  2KWJ A;  2VP7 A;  4YAD A;  5DIN A;  1WIM A;  3HCT A;  1K2F A;  3ZYQ A;  3U5N A;  1E4U A;  4QF2 A;  4S3O C;  3O7A A;  2IDA A;  2M85 A;  1WGM A;  2MIQ A;  4R2Y A;  5TBN A;  2PUY A;  5FER A;  2Y43 A;  3GV4 A;  4CCG X;  4LLB A;  4TKP B;  2K1J A;  2LN0 A;  3L1X A;  2I50 A;  4FK5 A;  3T7L A;  3ZPV 1;  4LJN A;  4YAB A;  1XWH A;  2K4D A;  3FL2 A;  4ZUX U;  5LKZ A;  1IYM A;  2JRJ A;  4FO9 A;  1U6G B;  3EB6 A;  2MA6 A;  2VNF A;  1Z60 A;  2QIZ A;  2YUC A;  4A0C D;  1WEW A;  4FIP A;  3QZV A;  1JM7 B;  5G0F A;  2E6S A;  2QIC A;  2ECW A;  1WEQ A;  5H1T A;  5D1M B;  1WEM A;  1N87 A;  2VJF A;  2ECJ A;  4YBT A;  4WZ2 A;  2KGG A;  2H0D B;  2PNX A;  2LXH C;  2OXQ C;  3LQH A;  1FP0 A;  2KWO A;  2RI7 A;  2NAA A;  4YBM A;  1VFY A;  2EA6 A;  3N9L A;  5TDR A;  4S3O B;  3GL6 A;  1JOC A;  3O36 A;  4Q6F A;  4X3G A;  4WA6 A;  1G25 A;  3PUQ A;  5D1L B;  5LKU A;  2Y1M A;  5I3L A;  4UP0 A;  4I7C A;  4GB0 A;  4LAD B;  4B7Y C;  5TAB A;  2G45 A;  2L75 A;  2KGI A;  5TDW A;  4A4C A; 
#chains in the Genus database with same CATH topology
 4IC3 A;  2CSV A;  2MNY A;  2LRI C;  2KE1 A;  2OWA A;  3SHB A;  2LDR A;  2D8U A;  3MHH A;  1WE9 A;  2M3H A;  5B78 A;  3N9Q A;  5SVI B;  5FEY A;  3M62 A;  4I7B A;  5B75 A;  4F52 B;  2EOD A;  2YQM A;  2CSY A;  2P57 A;  4GNG A;  3KNV A;  1HYI A;  2K17 A;  1WFK A;  4AVX A;  5AIT A;  2CKL B;  5FB1 A;  4YAX A;  2LGG A;  2VPG A;  2CRR A;  3T6R A;  2UZG A;  3DPL R;  2Y1N A;  2YUR A;  5LCW B;  2CON A;  2DJA A;  4A49 A;  5JG6 A;  3PUR A;  3LJU X;  2KWN A;  1RMD A;  3KV5 A;  4XI1 A;  2KWK A;  2XOZ A;  3H7H A;  2YHN A;  2MA5 A;  3U5O A;  3V43 A;  2XEU A;  2F42 A;  5G05 B;  1WEP A;  2LGL A;  3M63 A;  2RR4 A;  2L80 A;  2LGK A;  5KH3 A;  4WZ3 B;  2FD4 A;  5B77 A;  1LDJ B;  4GND A;  3ZVY A;  3U5M A;  2K16 A;  5B76 A;  4P5O B;  3LRQ A;  5C11 A;  4MSX A;  2XB1 A;  3L1Z B;  4L58 A;  2L0B A;  4ZQL A;  1CHC A;  2KR4 A;  2VJE A;  3RPG C;  4YC9 A;  2C2L A;  3SOU A;  2CSZ A;  1HYJ A;  3LDY A;  2KKY A;  3HTK C;  4F1P A;  4C9Z A;  2M1R A;  2JMI A;  4N4F A;  1WEE A;  4AYC A;  2G43 A;  1V87 A;  3ZTG A;  4R8P K;  3MHS A;  4UI9 B;  4AUQ B;  3ZNI A;  3FEH A;  2DX8 A;  5B8D A;  2YT5 A;  1DVP A;  2LV9 A;  3DDT A;  2FFW A;  2CRW A;  2YU4 A;  4LK9 A;  4ZDT A;  2EGP A;  3HCS A;  1LDK C;  2ZET C;  5H1U A;  1DCQ A;  3KDE C;  3O35 A;  3U5P A;  1MBM A;  1MM3 A;  2IQJ A;  3IHP A;  3O34 A;  5D1K B;  3N9N A;  1WEN A;  2QJ0 A;  1T1H A;  4L7X A;  4O62 A;  2VPB A;  3SUB A;  3M99 A;  2KU3 A;  2CT2 A;  3RTR B;  4Z0O A;  3O47 A;  1BOR A;  1X4J A;  5TRB A;  4LKA A;  2M6M A;  3ASL A;  4O64 A;  3NG2 A;  1WIL A;  2LAU A;  2ECN A;  2LQ6 A;  5H1V A;  4BBQ A;  2FSA A;  4OGC A;  2JMJ A;  1JM7 A;  4R7E A;  3C5K A;  3KV6 A;  1Z2Q A;  2ECI A;  4UP5 A;  3RPG B;  4CA1 A;  5FB0 A;  2E61 A;  3ZVZ B;  5DKA A;  3ZPV E;  2L5U A;  2H0D A;  2KYU A;  1VYX A;  4V3L C;  2YSM A;  4IC2 A;  2JUN A;  4Z0R A;  5KH9 A;  3LQI A;  2EGM A;  2HDP A;  2MNZ A;  4QF3 A;  5K3Q A;  2L43 A;  4PTB A;  2KIZ A;  4BHW A;  1ZBD B;  1MM2 A;  4MVT A;  4N3W A;  1WES A;  5SVX A;  5H9M A;  2YW8 A;  3LQJ A;  1F62 A;  4GNF A;  4A4B A;  2LGV A;  2VPD A;  3FJU B;  5B79 A;  2MD8 C;  5LKX A;  2ECT A;  4I7D A;  5G04 B;  2VPE A;  2FUU A;  3C6W A;  3T9K A;  2MD7 B;  4WZ0 A;  4GNE A;  2C2V S;  2FUI A;  2MUM A;  2MT5 A;  4W4U A;  2RSD A;  2ECG A;  2D8S A;  2AN6 A;  2BAY A;  5SVI A;  5C13 A;  2YSJ A;  2KRE A;  2L7P A;  1Z6U A;  3I2D A;  2B0O E;  2KFT A;  2ECV A;  1WEO A;  1WEV A;  3N9O A;  2G6Q A;  3N9M A;  3DQV R;  4YBS A;  3LVR E;  4V3K C;  2F6N A;  3VK6 A;  4PPE A;  2YRE A;  2YHO A;  3LVQ E;  3N9P A;  3PHD A;  2CKL A;  4FJC A;  5EYA F;  2E6R A;  3KQI A;  3HCU A;  2VJF B;  3O33 A;  4NN2 A;  2LXP C;  2YQL A;  2VJE B;  2DSM A;  3O37 A;  3EB5 A;  3L11 A;  5J3X A;  1FBV A;  1VD4 A;  5AIU A;  3O70 A;  3SOW A;  1X4I A;  2EXU A;  5LKT A;  4QQ4 A;  3SOX A;  2HYE D;  4AP4 A;  2F6J A;  4B86 C;  4YAT A;  1X4U A;  4AYC B;  1WEU A;  2JMD A;  2XOY A;  5KH7 A;  2YYR A;  2KWJ A;  2VP7 A;  4YAD A;  5DIN A;  1WIM A;  3HCT A;  1K2F A;  3FAO A;  3ZYQ A;  3U5N A;  1E4U A;  4QF2 A;  3DWD A;  2XP0 A;  4S3O C;  3O7A A;  2IDA A;  2KKX A;  2M85 A;  1WGM A;  2MIQ A;  4R2Y A;  5TBN A;  2PUY A;  3FAN A;  2Y43 A;  5FER A;  3GV4 A;  4CCG X;  4LLB A;  4TKP B;  2K1J A;  2LN0 A;  3L1X A;  2I50 A;  3FM8 C;  4FK5 A;  3T7L A;  3ZPV 1;  4LJN A;  4YAB A;  1XWH A;  2XOC A;  2K4D A;  3FL2 A;  4ZUX U;  5LKZ A;  1IYM A;  2JRJ A;  4FO9 A;  1U6G B;  3EB6 A;  3JUE A;  2MA6 A;  2VNF A;  2MKE A;  1Z60 A;  2QIZ A;  2YUC A;  4A0C D;  1WEW A;  4FIP A;  2YVR A;  3QZV A;  1JM7 B;  3E2D A;  5G0F A;  2E6S A;  2QIC A;  2ECW A;  1WEQ A;  5H1T A;  5D1M B;  1WEM A;  1N87 A;  2VJF A;  2ECJ A;  4YBT A;  4WZ2 A;  2KGG A;  4OGE A;  2H0D B;  2PNX A;  3MDB C;  2LXH C;  2JM3 A;  2OXQ C;  3LQH A;  1FP0 A;  2KWO A;  2RI7 A;  2NAA A;  3M7K A;  4YBM A;  1VFY A;  2EA6 A;  3N9L A;  5TDR A;  4S3O B;  3GL6 A;  1JOC A;  3O36 A;  4Q6F A;  4X3G A;  4WA6 A;  1G25 A;  4H9D A;  3PUQ A;  5D1L B;  5LKU A;  2Y1M A;  5I3L A;  3PLW A;  4UP0 A;  2M13 A;  4I7C A;  4GB0 A;  5SVY A;  4LAD B;  3Q1D A;  4B7Y C;  5TAB A;  2G45 A;  2L75 A;  2KGI A;  5TDW A;  4A4C A; 
#chains in the Genus database with same CATH homology
 4IC3 A;  2MNY A;  2LRI C;  2KE1 A;  3SHB A;  2LDR A;  3MHH A;  1WE9 A;  2M3H A;  5B78 A;  3N9Q A;  5FEY A;  3M62 A;  4I7B A;  5B75 A;  4F52 B;  2EOD A;  2YQM A;  2CSY A;  4GNG A;  3KNV A;  1HYI A;  2K17 A;  1WFK A;  4AVX A;  5AIT A;  2CKL B;  5FB1 A;  4YAX A;  2LGG A;  2VPG A;  3T6R A;  2UZG A;  3DPL R;  2Y1N A;  2YUR A;  5LCW B;  4A49 A;  5JG6 A;  3PUR A;  2KWN A;  1RMD A;  3KV5 A;  4XI1 A;  2KWK A;  2YHN A;  2MA5 A;  3U5O A;  3V43 A;  2XEU A;  2F42 A;  5G05 B;  1WEP A;  2LGL A;  3M63 A;  2L80 A;  2LGK A;  5KH3 A;  4WZ3 B;  5B77 A;  1LDJ B;  4GND A;  3ZVY A;  3U5M A;  2K16 A;  5B76 A;  4P5O B;  3LRQ A;  5C11 A;  4MSX A;  2XB1 A;  3L1Z B;  4L58 A;  2L0B A;  4ZQL A;  1CHC A;  2KR4 A;  2VJE A;  3RPG C;  4YC9 A;  2C2L A;  3SOU A;  2CSZ A;  1HYJ A;  3HTK C;  4C9Z A;  2M1R A;  2JMI A;  4N4F A;  1WEE A;  4AYC A;  2G43 A;  1V87 A;  3ZTG A;  4R8P K;  3MHS A;  4UI9 B;  4AUQ B;  3ZNI A;  2DX8 A;  5B8D A;  2YT5 A;  1DVP A;  2LV9 A;  2YU4 A;  4LK9 A;  4ZDT A;  2EGP A;  3HCS A;  1LDK C;  2ZET C;  5H1U A;  3O35 A;  3U5P A;  1MM3 A;  3IHP A;  3O34 A;  5D1K B;  3N9N A;  1WEN A;  2QJ0 A;  1T1H A;  4L7X A;  2VPB A;  3M99 A;  2KU3 A;  2CT2 A;  3RTR B;  1BOR A;  1X4J A;  5TRB A;  4LKA A;  2M6M A;  3ASL A;  4O64 A;  3NG2 A;  1WIL A;  2ECN A;  5H1V A;  2LQ6 A;  4BBQ A;  2FSA A;  2JMJ A;  1JM7 A;  4R7E A;  3C5K A;  3KV6 A;  1Z2Q A;  2ECI A;  4UP5 A;  3RPG B;  4CA1 A;  5FB0 A;  3ZVZ B;  5DKA A;  3ZPV E;  2L5U A;  2H0D A;  2KYU A;  1VYX A;  4V3L C;  2YSM A;  4IC2 A;  5KH9 A;  3LQI A;  2HDP A;  2MNZ A;  4QF3 A;  2L43 A;  4PTB A;  2KIZ A;  4BHW A;  1ZBD B;  1MM2 A;  4MVT A;  4N3W A;  1WES A;  5H9M A;  2YW8 A;  3LQJ A;  1F62 A;  4GNF A;  4A4B A;  2LGV A;  2VPD A;  5B79 A;  2MD8 C;  5LKX A;  2ECT A;  4I7D A;  5G04 B;  2VPE A;  2FUU A;  3C6W A;  2MD7 B;  4WZ0 A;  4GNE A;  2C2V S;  2FUI A;  2MUM A;  2MT5 A;  4W4U A;  2RSD A;  2ECG A;  2D8S A;  2AN6 A;  2BAY A;  5C13 A;  2YSJ A;  2KRE A;  1Z6U A;  3I2D A;  2KFT A;  2ECV A;  1WEO A;  1WEV A;  3N9O A;  2G6Q A;  3N9M A;  3DQV R;  4YBS A;  4V3K C;  2F6N A;  3VK6 A;  4PPE A;  2YRE A;  2YHO A;  3N9P A;  3PHD A;  2CKL A;  4FJC A;  5EYA F;  2E6R A;  3KQI A;  3HCU A;  2VJF B;  3O33 A;  4NN2 A;  2LXP C;  2YQL A;  2VJE B;  3O37 A;  3EB5 A;  3L11 A;  5J3X A;  1FBV A;  1VD4 A;  5AIU A;  3O70 A;  3SOW A;  1X4I A;  5LKT A;  3SOX A;  2HYE D;  4AP4 A;  2F6J A;  4B86 C;  4YAT A;  1X4U A;  4AYC B;  1WEU A;  2JMD A;  5KH7 A;  2YYR A;  2KWJ A;  2VP7 A;  4YAD A;  5DIN A;  1WIM A;  3HCT A;  1K2F A;  3ZYQ A;  3U5N A;  1E4U A;  4QF2 A;  4S3O C;  3O7A A;  2IDA A;  2M85 A;  1WGM A;  2MIQ A;  4R2Y A;  5TBN A;  2PUY A;  5FER A;  2Y43 A;  3GV4 A;  4CCG X;  4LLB A;  4TKP B;  2K1J A;  2LN0 A;  3L1X A;  2I50 A;  4FK5 A;  3T7L A;  3ZPV 1;  4LJN A;  4YAB A;  1XWH A;  2K4D A;  3FL2 A;  4ZUX U;  5LKZ A;  1IYM A;  2JRJ A;  4FO9 A;  1U6G B;  3EB6 A;  2MA6 A;  2VNF A;  1Z60 A;  2QIZ A;  2YUC A;  4A0C D;  1WEW A;  4FIP A;  3QZV A;  1JM7 B;  5G0F A;  2E6S A;  2QIC A;  2ECW A;  1WEQ A;  5H1T A;  5D1M B;  1WEM A;  1N87 A;  2VJF A;  2ECJ A;  4YBT A;  4WZ2 A;  2KGG A;  2H0D B;  2PNX A;  2LXH C;  2OXQ C;  3LQH A;  1FP0 A;  2KWO A;  2RI7 A;  2NAA A;  4YBM A;  1VFY A;  2EA6 A;  3N9L A;  5TDR A;  4S3O B;  3GL6 A;  1JOC A;  3O36 A;  4Q6F A;  4X3G A;  4WA6 A;  1G25 A;  3PUQ A;  5D1L B;  5LKU A;  2Y1M A;  5I3L A;  4UP0 A;  4I7C A;  4GB0 A;  4LAD B;  4B7Y C;  5TAB A;  2G45 A;  2L75 A;  2KGI A;  5TDW A;  4A4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...