1WEOA

Solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords cellulose synthase, catalytic subunit (IRX3)
total genus 7
structure length 93
sequence length 93
ec nomenclature ec 2.4.1.12: Cellulose synthase (UDP-forming).
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14569 zf-UDP Zinc-binding RING-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weoA00
5LCWB 3U5MA 2NAAA 4UI9B 2MUMA 2F6JA 5B8DA 1WEOA 2KE1A 1WEEA 4MVTA 2MNZA 3HCSA 3HTKC 2K1JA 4FIPA 4B86C 5KH7A 5D1MB 4I7DA 5FB0A 2I50A 3PUQA 3LQIA 4A4BA 4YABA 2LGKA 3O34A 3O35A 2K17A 3N9NA 4V3KC 3ZTGA 4YC9A 4YAXA 4W4UA 2E6SA 2QIZA 2L43A 2ECVA 2LGLA 3C5KA 4BBQA 2YUCA 1F62A 3U5OA 3C6WA 5B79A 2C2VS 3T7LA 3HCUA 2G43A 5LKZA 1WEQA 4NN2A 1WEMA 3O36A 2CKLA 1DVPA 4S3OB 2VJFA 2MIQA 2MD8C 4AYCA 4Q6FA 1WESA 2G6QA 4L58A 2MT5A 5TDRA 3L1ZB 3RTRB 2YHNA 1FP0A 2VPBA 2MA6A 4WZ3B 2ECJA 3QZVA 1K2FA 3SOXA 3ZPVE 2M85A 1Z6UA 1WE9A 4N3WA 3MHHA 4B7YC 1BORA 3T6RA 4LADB 4CCGX 5KH9A 3SOWA 2YURA 2KWKA 3O37A 2F42A 3N9PA 4A0CD 1WEUA 3O70A 2EGPA 4WZ2A 1VD4A 1Z60A 3L1XA 5G0FA 1JM7A 2YYRA 3EB5A 5D1KB 4R8PK 2VPDA 2Y1MA 2KU3A 5FB1A 3N9LA 1LDKC 4LJNA 2LDRA 2ECNA 2KREA 1WENA 3GL6A 3I2DA 4P5OB 2KR4A 2JMDA 2PUYA 5C13A 2XB1A 4I7BA 1T1HA 4MSXA 3FL2A 5FEYA 5J3XA 5TDWA 5H1UA 3O33A 2LXHC 5DINA 2RSDA 2VP7A 1LDJB 4AUQB 5B75A 4ZQLA 4IC2A 2M6MA 1WEVA 4R2YA 5B78A 4PPEA 1X4IA 2YW8A 4GNEA 2L80A 2CKLB 1FBVA 1HYJA 2VJFB 1JOCA 3LRQA 2XEUA 1VYXA 3LQHA 4LK9A 5G05B 4BHWA 2LQ6A 3MHSA 4AP4A 2VPEA 5AITA 1VFYA 4TKPB 2KGGA 4S3OC 2FUIA 3RPGB 2BAYA 2JRJA 1X4UA 5D1LB 4R7EA 2KIZA 2RI7A 1N87A 3DQVR 2CSYA 4PTBA 4X3GA 2UZGA 3U5NA 3KV6A 4FJCA 3ZNIA 2ECGA 2YQLA 2H0DA 2YHOA 1MM3A 1WEWA 2YQMA 2ECWA 1HYIA 2Y1NA 4YADA 4L7XA 3KQIA 2CSZA 2YSMA 2KGIA 1JM7B 2L0BA 3N9OA 1WEPA 4A49A 4V3LC 2C2LA 2G45A 2ECIA 3N9QA 4A4CA 2M3HA 4XI1A 3DPLR 5G04B 4GNFA 4N4FA 1RMDA 2PNXA 2KYUA 3KNVA 5EYAF 1WIMA 5LKXA 2LGGA 5H9MA 2MNYA 3ZYQA 3ASLA 2QICA 4QF2A 4ZDTA 3IHPA 4LKAA 2LXPC 3V43A 2VPGA 2D8SA 3EB6A 2EODA 4QF3A 4YATA 4YBSA 2Y43A 1WGMA 2MA5A 4FO9A 5LKUA 5KH3A 2LRIC 3ZVZB 1CHCA 2M1RA 2KWJA 4GNGA 3KV5A 4UP0A 2ECTA 1E4UA 3VK6A 4F52B 5B76A 2L75A 3SOUA 2YREA 5TRBA 4AVXA 2IDAA 1Z2QA 2E6RA 2F6NA 2FSAA 3N9MA 5FERA 3L11A 4ZUXU 2CT2A 5TBNA 1V87A 4WA6A 1MM2A 5LKTA 2ZETC 2YSJA 4YBTA 1XWHA 3M62A 1X4JA 4C9ZA 5H1VA 4GB0A 3PURA 2KWNA 1G25A 5JG6A 3HCTA 2MD7B 4IC3A 3U5PA 5TABA 2K16A 2LN0A 5AIUA 5B77A 3LQJA 4YBMA 2DX8A 4AYCB 2VNFA 3NG2A 2H0DB 2YU4A 2VJEA 2K4DA 2AN6A 1IYMA 4GNDA 5DKAA 2LV9A 5I3LA 2OXQC 3ZPV1 3ZVYA 2QJ0A 4I7CA 3SHBA 2JMIA 2HYED 2KWOA 1ZBDB 2KFTA 3GV4A 4UP5A 1WFKA 2YT5A 3M63A 3PHDA 4CA1A 2LGVA 2HDPA 3M99A 1U6GB 1WILA 2EA6A 2VJEB 5C11A 2FUUA 3RPGC 5H1TA 4FK5A 4LLBA 4O64A 4WZ0A 2JMJA 3O7AA 2L5UA
chains in the Genus database with same CATH superfamily
5LCWB 3U5MA 2NAAA 4UI9B 2MUMA 2F6JA 5B8DA 1WEOA 2KE1A 1WEEA 4MVTA 2MNZA 3HCSA 3HTKC 2K1JA 4FIPA 4B86C 5KH7A 5D1MB 4I7DA 5FB0A 2I50A 4OGCA 3PUQA 3LQIA 3JUEA 4A4BA 4YABA 2LGKA 3O34A 3O35A 2K17A 3N9NA 4V3KC 3ZTGA 4YC9A 4YAXA 2OWAA 4W4UA 2E6SA 2QIZA 2L43A 2ECVA 2LGLA 3C5KA 4BBQA 2YUCA 1F62A 3U5OA 3C6WA 5B79A 2C2VS 3T7LA 3HCUA 3Q1DA 2G43A 5LKZA 1WEQA 4NN2A 1WEMA 3O36A 2CKLA 1DVPA 4S3OB 2VJFA 2MIQA 2MD8C 2MKEA 4AYCA 4Q6FA 1WESA 2G6QA 4L58A 2MT5A 5TDRA 3L1ZB 3KDEC 3RTRB 2P57A 2YHNA 1FP0A 3M7KA 2VPBA 2MA6A 2KKYA 4WZ3B 4F1PA 2ECJA 3QZVA 1K2FA 2EXUA 3T9KA 3SOXA 3ZPVE 2M85A 1Z6UA 1WE9A 4N3WA 3MHHA 4B7YC 1BORA 3T6RA 4LADB 4CCGX 5KH9A 3SOWA 2YURA 2KWKA 3O37A 2F42A 3N9PA 4A0CD 1WEUA 3FANA 3O70A 2EGPA 4WZ2A 3E2DA 1DCQA 1VD4A 3LDYA 1Z60A 5SVYA 2XOCA 3L1XA 2DJAA 5G0FA 1JM7A 2YYRA 3EB5A 2CONA 5D1KB 3FM8C 3O47A 2VPDA 4R8PK 2Y1MA 2KU3A 5FB1A 3N9LA 1LDKC 4LJNA 2LDRA 2ECNA 3DWDA 2KREA 1WENA 2CRWA 3GL6A 3I2DA 4P5OB 2KR4A 2JMDA 2PUYA 5C13A 4O62A 2XB1A 4I7BA 2CRRA 1T1HA 4MSXA 3FL2A 5FEYA 5J3XA 2FD4A 5TDWA 5H1UA 4Z0RA 3O33A 3FAOA 2LXHC 3SUBA 3FJUB 5DINA 2RSDA 2VP7A 1LDJB 2FFWA 4AUQB 5B75A 2L7PA 4ZQLA 2JUNA 4IC2A 2M6MA 1WEVA 4R2YA 5B78A 3DDTA 4PPEA 1X4IA 2RR4A 2YW8A 4GNEA 2L80A 2CKLB 1FBVA 1HYJA 4OGEA 2VJFB 1JOCA 3LRQA 2XEUA 1VYXA 4H9DA 3LQHA 4LK9A 5G05B 3LVRE 3H7HA 4BHWA 2LQ6A 3MHSA 4AP4A 2VPEA 5AITA 1VFYA 4TKPB 2JM3A 3LVQE 2KGGA 4S3OC 2FUIA 3RPGB 2BAYA 2JRJA 1X4UA 5D1LB 4R7EA 2KIZA 2RI7A 1N87A 3DQVR 2CSYA 4PTBA 4X3GA 2UZGA 3U5NA 3KV6A 4FJCA 3ZNIA 2ECGA 2YQLA 2H0DA 2YHOA 1MM3A 1WEWA 2YQMA 2ECWA 1HYIA 2Y1NA 4YADA 4L7XA 3KQIA 2CSZA 2YSMA 2XOYA 2KGIA 1JM7B 2L0BA 3N9OA 1WEPA 4A49A 4V3LC 2C2LA 2G45A 2ECIA 3N9QA 4A4CA 2M3HA 4XI1A 3DPLR 5G04B 4GNFA 4N4FA 1RMDA 2PNXA 2KYUA 3KNVA 5EYAF 1WIMA 5LKXA 2LGGA 2LAUA 1MBMA 5H9MA 2MNYA 3ZYQA 3ASLA 2QICA 3PLWA 4QF2A 4ZDTA 3IHPA 4LKAA 2LXPC 5K3QA 3V43A 2VPGA 2D8SA 2E61A 3EB6A 2EODA 4QF3A 4YATA 4YBSA 2Y43A 1WGMA 2MA5A 4FO9A 5LKUA 5KH3A 2LRIC 3ZVZB 1CHCA 2M1RA 2B0OE 2KWJA 4GNGA 3KV5A 4UP0A 2ECTA 1E4UA 3VK6A 4F52B 5B76A 2L75A 3SOUA 2KKXA 2YREA 2IQJA 5TRBA 4AVXA 2IDAA 3MDBC 1Z2QA 2E6RA 2F6NA 4Z0OA 2FSAA 3N9MA 5FERA 3L11A 4ZUXU 2CT2A 5TBNA 1V87A 4WA6A 1MM2A 5LKTA 2ZETC 2YSJA 4YBTA 1XWHA 3M62A 1X4JA 4C9ZA 5H1VA 4GB0A 3PURA 2M13A 2KWNA 5SVIA 1G25A 5JG6A 3LJUX 3HCTA 2MD7B 4IC3A 2D8UA 3U5PA 5TABA 2K16A 2LN0A 5AIUA 5B77A 3LQJA 4YBMA 2XOZA 2DX8A 4AYCB 2VNFA 3NG2A 2CSVA 2H0DB 2YU4A 3FEHA 2VJEA 2K4DA 2AN6A 1IYMA 4GNDA 5DKAA 2LV9A 5I3LA 2OXQC 3ZPV1 5SVIB 3ZVYA 2QJ0A 4I7CA 3SHBA 2JMIA 2HYED 2KWOA 2YVRA 1ZBDB 2KFTA 3GV4A 4UP5A 1WFKA 2YT5A 3M63A 3PHDA 4CA1A 2LGVA 2HDPA 3M99A 1U6GB 5SVXA 4QQ4A 1WILA 2EA6A 2VJEB 2DSMA 2XP0A 5C11A 2FUUA 3RPGC 5H1TA 4FK5A 2EGMA 4LLBA 4O64A 4WZ0A 2JMJA 3O7AA 2L5UA
chains in the Genus database with same CATH topology
5LCWB 3U5MA 2NAAA 4UI9B 2MUMA 2F6JA 5B8DA 1WEOA 2KE1A 1WEEA 4MVTA 2MNZA 3HCSA 3HTKC 2K1JA 4FIPA 4B86C 5KH7A 5D1MB 4I7DA 5FB0A 2I50A 3PUQA 3LQIA 4A4BA 4YABA 2LGKA 3O34A 3O35A 2K17A 3N9NA 4V3KC 3ZTGA 4YC9A 4YAXA 4W4UA 2E6SA 2QIZA 2L43A 2ECVA 2LGLA 3C5KA 4BBQA 2YUCA 1F62A 3U5OA 3C6WA 5B79A 2C2VS 3T7LA 3HCUA 2G43A 5LKZA 1WEQA 4NN2A 1WEMA 3O36A 2CKLA 1DVPA 4S3OB 2VJFA 2MIQA 2MD8C 4AYCA 4Q6FA 1WESA 2G6QA 4L58A 2MT5A 5TDRA 3L1ZB 3RTRB 2YHNA 1FP0A 2VPBA 2MA6A 4WZ3B 2ECJA 3QZVA 1K2FA 3SOXA 3ZPVE 2M85A 1Z6UA 1WE9A 4N3WA 3MHHA 4B7YC 1BORA 3T6RA 4LADB 4CCGX 5KH9A 3SOWA 2YURA 2KWKA 3O37A 2F42A 3N9PA 4A0CD 1WEUA 3O70A 2EGPA 4WZ2A 1VD4A 1Z60A 3L1XA 5G0FA 1JM7A 2YYRA 3EB5A 5D1KB 4R8PK 2VPDA 2Y1MA 2KU3A 5FB1A 3N9LA 1LDKC 4LJNA 2LDRA 2ECNA 2KREA 1WENA 3GL6A 3I2DA 4P5OB 2KR4A 2JMDA 2PUYA 5C13A 2XB1A 4I7BA 1T1HA 4MSXA 3FL2A 5FEYA 5J3XA 5TDWA 5H1UA 3O33A 2LXHC 5DINA 2RSDA 2VP7A 1LDJB 4AUQB 5B75A 4ZQLA 4IC2A 2M6MA 1WEVA 4R2YA 5B78A 4PPEA 1X4IA 2YW8A 4GNEA 2L80A 2CKLB 1FBVA 1HYJA 2VJFB 1JOCA 3LRQA 2XEUA 1VYXA 3LQHA 4LK9A 5G05B 4BHWA 2LQ6A 3MHSA 4AP4A 2VPEA 5AITA 1VFYA 4TKPB 2KGGA 4S3OC 2FUIA 3RPGB 2BAYA 2JRJA 1X4UA 5D1LB 4R7EA 2KIZA 2RI7A 1N87A 3DQVR 2CSYA 4PTBA 4X3GA 2UZGA 3U5NA 3KV6A 4FJCA 3ZNIA 2ECGA 2YQLA 2H0DA 2YHOA 1MM3A 1WEWA 2YQMA 2ECWA 1HYIA 2Y1NA 4YADA 4L7XA 3KQIA 2CSZA 2YSMA 2KGIA 1JM7B 2L0BA 3N9OA 1WEPA 4A49A 4V3LC 2C2LA 2G45A 2ECIA 3N9QA 4A4CA 2M3HA 4XI1A 3DPLR 5G04B 4GNFA 4N4FA 1RMDA 2PNXA 2KYUA 3KNVA 5EYAF 1WIMA 5LKXA 2LGGA 5H9MA 2MNYA 3ZYQA 3ASLA 2QICA 4QF2A 4ZDTA 3IHPA 4LKAA 2LXPC 3V43A 2VPGA 2D8SA 3EB6A 2EODA 4QF3A 4YATA 4YBSA 2Y43A 1WGMA 2MA5A 4FO9A 5LKUA 5KH3A 2LRIC 3ZVZB 1CHCA 2M1RA 2KWJA 4GNGA 3KV5A 4UP0A 2ECTA 1E4UA 3VK6A 4F52B 5B76A 2L75A 3SOUA 2YREA 5TRBA 4AVXA 2IDAA 1Z2QA 2E6RA 2F6NA 2FSAA 3N9MA 5FERA 3L11A 4ZUXU 2CT2A 5TBNA 1V87A 4WA6A 1MM2A 5LKTA 2ZETC 2YSJA 4YBTA 1XWHA 3M62A 1X4JA 4C9ZA 5H1VA 4GB0A 3PURA 2KWNA 1G25A 5JG6A 3HCTA 2MD7B 4IC3A 3U5PA 5TABA 2K16A 2LN0A 5AIUA 5B77A 3LQJA 4YBMA 2DX8A 4AYCB 2VNFA 3NG2A 2H0DB 2YU4A 2VJEA 2K4DA 2AN6A 1IYMA 4GNDA 5DKAA 2LV9A 5I3LA 2OXQC 3ZPV1 3ZVYA 2QJ0A 4I7CA 3SHBA 2JMIA 2HYED 2KWOA 1ZBDB 2KFTA 3GV4A 4UP5A 1WFKA 2YT5A 3M63A 3PHDA 4CA1A 2LGVA 2HDPA 3M99A 1U6GB 1WILA 2EA6A 2VJEB 5C11A 2FUUA 3RPGC 5H1TA 4FK5A 4LLBA 4O64A 4WZ0A 2JMJA 3O7AA 2L5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCW B;  3U5M A;  2NAA A;  4UI9 B;  2MUM A;  2F6J A;  5B8D A;  1WEO A;  2KE1 A;  1WEE A;  4MVT A;  2MNZ A;  3HCS A;  3HTK C;  2K1J A;  4FIP A;  4B86 C;  5KH7 A;  5D1M B;  4I7D A;  5FB0 A;  2I50 A;  3PUQ A;  3LQI A;  4A4B A;  4YAB A;  2LGK A;  3O34 A;  3O35 A;  2K17 A;  3N9N A;  4V3K C;  3ZTG A;  4YC9 A;  4YAX A;  4W4U A;  2E6S A;  2QIZ A;  2L43 A;  2ECV A;  2LGL A;  3C5K A;  4BBQ A;  2YUC A;  1F62 A;  3U5O A;  3C6W A;  5B79 A;  2C2V S;  3T7L A;  3HCU A;  2G43 A;  5LKZ A;  1WEQ A;  4NN2 A;  1WEM A;  3O36 A;  2CKL A;  1DVP A;  4S3O B;  2VJF A;  2MIQ A;  2MD8 C;  4AYC A;  4Q6F A;  1WES A;  2G6Q A;  4L58 A;  2MT5 A;  5TDR A;  3L1Z B;  3RTR B;  2YHN A;  1FP0 A;  2VPB A;  2MA6 A;  4WZ3 B;  2ECJ A;  3QZV A;  1K2F A;  3SOX A;  3ZPV E;  2M85 A;  1Z6U A;  1WE9 A;  4N3W A;  3MHH A;  4B7Y C;  1BOR A;  3T6R A;  4LAD B;  4CCG X;  5KH9 A;  3SOW A;  2YUR A;  2KWK A;  3O37 A;  2F42 A;  3N9P A;  4A0C D;  1WEU A;  3O70 A;  2EGP A;  4WZ2 A;  1VD4 A;  1Z60 A;  3L1X A;  5G0F A;  1JM7 A;  2YYR A;  3EB5 A;  5D1K B;  4R8P K;  2VPD A;  2Y1M A;  2KU3 A;  5FB1 A;  3N9L A;  1LDK C;  4LJN A;  2LDR A;  2ECN A;  2KRE A;  1WEN A;  3GL6 A;  3I2D A;  4P5O B;  2KR4 A;  2JMD A;  2PUY A;  5C13 A;  2XB1 A;  4I7B A;  1T1H A;  4MSX A;  3FL2 A;  5FEY A;  5J3X A;  5TDW A;  5H1U A;  3O33 A;  2LXH C;  5DIN A;  2RSD A;  2VP7 A;  1LDJ B;  4AUQ B;  5B75 A;  4ZQL A;  4IC2 A;  2M6M A;  1WEV A;  4R2Y A;  5B78 A;  4PPE A;  1X4I A;  2YW8 A;  4GNE A;  2L80 A;  2CKL B;  1FBV A;  1HYJ A;  2VJF B;  1JOC A;  3LRQ A;  2XEU A;  1VYX A;  3LQH A;  4LK9 A;  5G05 B;  4BHW A;  2LQ6 A;  3MHS A;  4AP4 A;  2VPE A;  5AIT A;  1VFY A;  4TKP B;  2KGG A;  4S3O C;  2FUI A;  3RPG B;  2BAY A;  2JRJ A;  1X4U A;  5D1L B;  4R7E A;  2KIZ A;  2RI7 A;  1N87 A;  3DQV R;  2CSY A;  4PTB A;  4X3G A;  2UZG A;  3U5N A;  3KV6 A;  4FJC A;  3ZNI A;  2ECG A;  2YQL A;  2H0D A;  2YHO A;  1MM3 A;  1WEW A;  2YQM A;  2ECW A;  1HYI A;  2Y1N A;  4YAD A;  4L7X A;  3KQI A;  2CSZ A;  2YSM A;  2KGI A;  1JM7 B;  2L0B A;  3N9O A;  1WEP A;  4A49 A;  4V3L C;  2C2L A;  2G45 A;  2ECI A;  3N9Q A;  4A4C A;  2M3H A;  4XI1 A;  3DPL R;  5G04 B;  4GNF A;  4N4F A;  1RMD A;  2PNX A;  2KYU A;  3KNV A;  5EYA F;  1WIM A;  5LKX A;  2LGG A;  5H9M A;  2MNY A;  3ZYQ A;  3ASL A;  2QIC A;  4QF2 A;  4ZDT A;  3IHP A;  4LKA A;  2LXP C;  3V43 A;  2VPG A;  2D8S A;  3EB6 A;  2EOD A;  4QF3 A;  4YAT A;  4YBS A;  2Y43 A;  1WGM A;  2MA5 A;  4FO9 A;  5LKU A;  5KH3 A;  2LRI C;  3ZVZ B;  1CHC A;  2M1R A;  2KWJ A;  4GNG A;  3KV5 A;  4UP0 A;  2ECT A;  1E4U A;  3VK6 A;  4F52 B;  5B76 A;  2L75 A;  3SOU A;  2YRE A;  5TRB A;  4AVX A;  2IDA A;  1Z2Q A;  2E6R A;  2F6N A;  2FSA A;  3N9M A;  5FER A;  3L11 A;  4ZUX U;  2CT2 A;  5TBN A;  1V87 A;  4WA6 A;  1MM2 A;  5LKT A;  2ZET C;  2YSJ A;  4YBT A;  1XWH A;  3M62 A;  1X4J A;  4C9Z A;  5H1V A;  4GB0 A;  3PUR A;  2KWN A;  1G25 A;  5JG6 A;  3HCT A;  2MD7 B;  4IC3 A;  3U5P A;  5TAB A;  2K16 A;  2LN0 A;  5AIU A;  5B77 A;  3LQJ A;  4YBM A;  2DX8 A;  4AYC B;  2VNF A;  3NG2 A;  2H0D B;  2YU4 A;  2VJE A;  2K4D A;  2AN6 A;  1IYM A;  4GND A;  5DKA A;  2LV9 A;  5I3L A;  2OXQ C;  3ZPV 1;  3ZVY A;  2QJ0 A;  4I7C A;  3SHB A;  2JMI A;  2HYE D;  2KWO A;  1ZBD B;  2KFT A;  3GV4 A;  4UP5 A;  1WFK A;  2YT5 A;  3M63 A;  3PHD A;  4CA1 A;  2LGV A;  2HDP A;  3M99 A;  1U6G B;  1WIL A;  2EA6 A;  2VJE B;  5C11 A;  2FUU A;  3RPG C;  5H1T A;  4FK5 A;  4LLB A;  4O64 A;  4WZ0 A;  2JMJ A;  3O7A A;  2L5U A; 
#chains in the Genus database with same CATH topology
 5LCW B;  3U5M A;  2NAA A;  4UI9 B;  2MUM A;  2F6J A;  5B8D A;  1WEO A;  2KE1 A;  1WEE A;  4MVT A;  2MNZ A;  3HCS A;  3HTK C;  2K1J A;  4FIP A;  4B86 C;  5KH7 A;  5D1M B;  4I7D A;  5FB0 A;  2I50 A;  4OGC A;  3PUQ A;  3LQI A;  3JUE A;  4A4B A;  4YAB A;  2LGK A;  3O34 A;  3O35 A;  2K17 A;  3N9N A;  4V3K C;  3ZTG A;  4YC9 A;  4YAX A;  2OWA A;  4W4U A;  2E6S A;  2QIZ A;  2L43 A;  2ECV A;  2LGL A;  3C5K A;  4BBQ A;  2YUC A;  1F62 A;  3U5O A;  3C6W A;  5B79 A;  2C2V S;  3T7L A;  3HCU A;  3Q1D A;  2G43 A;  5LKZ A;  1WEQ A;  4NN2 A;  1WEM A;  3O36 A;  2CKL A;  1DVP A;  4S3O B;  2VJF A;  2MIQ A;  2MD8 C;  2MKE A;  4AYC A;  4Q6F A;  1WES A;  2G6Q A;  4L58 A;  2MT5 A;  5TDR A;  3L1Z B;  3KDE C;  3RTR B;  2P57 A;  2YHN A;  1FP0 A;  3M7K A;  2VPB A;  2MA6 A;  2KKY A;  4WZ3 B;  4F1P A;  2ECJ A;  3QZV A;  1K2F A;  2EXU A;  3T9K A;  3SOX A;  3ZPV E;  2M85 A;  1Z6U A;  1WE9 A;  4N3W A;  3MHH A;  4B7Y C;  1BOR A;  3T6R A;  4LAD B;  4CCG X;  5KH9 A;  3SOW A;  2YUR A;  2KWK A;  3O37 A;  2F42 A;  3N9P A;  4A0C D;  1WEU A;  3FAN A;  3O70 A;  2EGP A;  4WZ2 A;  3E2D A;  1DCQ A;  1VD4 A;  3LDY A;  1Z60 A;  5SVY A;  2XOC A;  3L1X A;  2DJA A;  5G0F A;  1JM7 A;  2YYR A;  3EB5 A;  2CON A;  5D1K B;  3FM8 C;  3O47 A;  2VPD A;  4R8P K;  2Y1M A;  2KU3 A;  5FB1 A;  3N9L A;  1LDK C;  4LJN A;  2LDR A;  2ECN A;  3DWD A;  2KRE A;  1WEN A;  2CRW A;  3GL6 A;  3I2D A;  4P5O B;  2KR4 A;  2JMD A;  2PUY A;  5C13 A;  4O62 A;  2XB1 A;  4I7B A;  2CRR A;  1T1H A;  4MSX A;  3FL2 A;  5FEY A;  5J3X A;  2FD4 A;  5TDW A;  5H1U A;  4Z0R A;  3O33 A;  3FAO A;  2LXH C;  3SUB A;  3FJU B;  5DIN A;  2RSD A;  2VP7 A;  1LDJ B;  2FFW A;  4AUQ B;  5B75 A;  2L7P A;  4ZQL A;  2JUN A;  4IC2 A;  2M6M A;  1WEV A;  4R2Y A;  5B78 A;  3DDT A;  4PPE A;  1X4I A;  2RR4 A;  2YW8 A;  4GNE A;  2L80 A;  2CKL B;  1FBV A;  1HYJ A;  4OGE A;  2VJF B;  1JOC A;  3LRQ A;  2XEU A;  1VYX A;  4H9D A;  3LQH A;  4LK9 A;  5G05 B;  3LVR E;  3H7H A;  4BHW A;  2LQ6 A;  3MHS A;  4AP4 A;  2VPE A;  5AIT A;  1VFY A;  4TKP B;  2JM3 A;  3LVQ E;  2KGG A;  4S3O C;  2FUI A;  3RPG B;  2BAY A;  2JRJ A;  1X4U A;  5D1L B;  4R7E A;  2KIZ A;  2RI7 A;  1N87 A;  3DQV R;  2CSY A;  4PTB A;  4X3G A;  2UZG A;  3U5N A;  3KV6 A;  4FJC A;  3ZNI A;  2ECG A;  2YQL A;  2H0D A;  2YHO A;  1MM3 A;  1WEW A;  2YQM A;  2ECW A;  1HYI A;  2Y1N A;  4YAD A;  4L7X A;  3KQI A;  2CSZ A;  2YSM A;  2XOY A;  2KGI A;  1JM7 B;  2L0B A;  3N9O A;  1WEP A;  4A49 A;  4V3L C;  2C2L A;  2G45 A;  2ECI A;  3N9Q A;  4A4C A;  2M3H A;  4XI1 A;  3DPL R;  5G04 B;  4GNF A;  4N4F A;  1RMD A;  2PNX A;  2KYU A;  3KNV A;  5EYA F;  1WIM A;  5LKX A;  2LGG A;  2LAU A;  1MBM A;  5H9M A;  2MNY A;  3ZYQ A;  3ASL A;  2QIC A;  3PLW A;  4QF2 A;  4ZDT A;  3IHP A;  4LKA A;  2LXP C;  5K3Q A;  3V43 A;  2VPG A;  2D8S A;  2E61 A;  3EB6 A;  2EOD A;  4QF3 A;  4YAT A;  4YBS A;  2Y43 A;  1WGM A;  2MA5 A;  4FO9 A;  5LKU A;  5KH3 A;  2LRI C;  3ZVZ B;  1CHC A;  2M1R A;  2B0O E;  2KWJ A;  4GNG A;  3KV5 A;  4UP0 A;  2ECT A;  1E4U A;  3VK6 A;  4F52 B;  5B76 A;  2L75 A;  3SOU A;  2KKX A;  2YRE A;  2IQJ A;  5TRB A;  4AVX A;  2IDA A;  3MDB C;  1Z2Q A;  2E6R A;  2F6N A;  4Z0O A;  2FSA A;  3N9M A;  5FER A;  3L11 A;  4ZUX U;  2CT2 A;  5TBN A;  1V87 A;  4WA6 A;  1MM2 A;  5LKT A;  2ZET C;  2YSJ A;  4YBT A;  1XWH A;  3M62 A;  1X4J A;  4C9Z A;  5H1V A;  4GB0 A;  3PUR A;  2M13 A;  2KWN A;  5SVI A;  1G25 A;  5JG6 A;  3LJU X;  3HCT A;  2MD7 B;  4IC3 A;  2D8U A;  3U5P A;  5TAB A;  2K16 A;  2LN0 A;  5AIU A;  5B77 A;  3LQJ A;  4YBM A;  2XOZ A;  2DX8 A;  4AYC B;  2VNF A;  3NG2 A;  2CSV A;  2H0D B;  2YU4 A;  3FEH A;  2VJE A;  2K4D A;  2AN6 A;  1IYM A;  4GND A;  5DKA A;  2LV9 A;  5I3L A;  2OXQ C;  3ZPV 1;  5SVI B;  3ZVY A;  2QJ0 A;  4I7C A;  3SHB A;  2JMI A;  2HYE D;  2KWO A;  2YVR A;  1ZBD B;  2KFT A;  3GV4 A;  4UP5 A;  1WFK A;  2YT5 A;  3M63 A;  3PHD A;  4CA1 A;  2LGV A;  2HDP A;  3M99 A;  1U6G B;  5SVX A;  4QQ4 A;  1WIL A;  2EA6 A;  2VJE B;  2DSM A;  2XP0 A;  5C11 A;  2FUU A;  3RPG C;  5H1T A;  4FK5 A;  2EGM A;  4LLB A;  4O64 A;  4WZ0 A;  2JMJ A;  3O7A A;  2L5U A; 
#chains in the Genus database with same CATH homology
 5LCW B;  3U5M A;  2NAA A;  4UI9 B;  2MUM A;  2F6J A;  5B8D A;  1WEO A;  2KE1 A;  1WEE A;  4MVT A;  2MNZ A;  3HCS A;  3HTK C;  2K1J A;  4FIP A;  4B86 C;  5KH7 A;  5D1M B;  4I7D A;  5FB0 A;  2I50 A;  3PUQ A;  3LQI A;  4A4B A;  4YAB A;  2LGK A;  3O34 A;  3O35 A;  2K17 A;  3N9N A;  4V3K C;  3ZTG A;  4YC9 A;  4YAX A;  4W4U A;  2E6S A;  2QIZ A;  2L43 A;  2ECV A;  2LGL A;  3C5K A;  4BBQ A;  2YUC A;  1F62 A;  3U5O A;  3C6W A;  5B79 A;  2C2V S;  3T7L A;  3HCU A;  2G43 A;  5LKZ A;  1WEQ A;  4NN2 A;  1WEM A;  3O36 A;  2CKL A;  1DVP A;  4S3O B;  2VJF A;  2MIQ A;  2MD8 C;  4AYC A;  4Q6F A;  1WES A;  2G6Q A;  4L58 A;  2MT5 A;  5TDR A;  3L1Z B;  3RTR B;  2YHN A;  1FP0 A;  2VPB A;  2MA6 A;  4WZ3 B;  2ECJ A;  3QZV A;  1K2F A;  3SOX A;  3ZPV E;  2M85 A;  1Z6U A;  1WE9 A;  4N3W A;  3MHH A;  4B7Y C;  1BOR A;  3T6R A;  4LAD B;  4CCG X;  5KH9 A;  3SOW A;  2YUR A;  2KWK A;  3O37 A;  2F42 A;  3N9P A;  4A0C D;  1WEU A;  3O70 A;  2EGP A;  4WZ2 A;  1VD4 A;  1Z60 A;  3L1X A;  5G0F A;  1JM7 A;  2YYR A;  3EB5 A;  5D1K B;  4R8P K;  2VPD A;  2Y1M A;  2KU3 A;  5FB1 A;  3N9L A;  1LDK C;  4LJN A;  2LDR A;  2ECN A;  2KRE A;  1WEN A;  3GL6 A;  3I2D A;  4P5O B;  2KR4 A;  2JMD A;  2PUY A;  5C13 A;  2XB1 A;  4I7B A;  1T1H A;  4MSX A;  3FL2 A;  5FEY A;  5J3X A;  5TDW A;  5H1U A;  3O33 A;  2LXH C;  5DIN A;  2RSD A;  2VP7 A;  1LDJ B;  4AUQ B;  5B75 A;  4ZQL A;  4IC2 A;  2M6M A;  1WEV A;  4R2Y A;  5B78 A;  4PPE A;  1X4I A;  2YW8 A;  4GNE A;  2L80 A;  2CKL B;  1FBV A;  1HYJ A;  2VJF B;  1JOC A;  3LRQ A;  2XEU A;  1VYX A;  3LQH A;  4LK9 A;  5G05 B;  4BHW A;  2LQ6 A;  3MHS A;  4AP4 A;  2VPE A;  5AIT A;  1VFY A;  4TKP B;  2KGG A;  4S3O C;  2FUI A;  3RPG B;  2BAY A;  2JRJ A;  1X4U A;  5D1L B;  4R7E A;  2KIZ A;  2RI7 A;  1N87 A;  3DQV R;  2CSY A;  4PTB A;  4X3G A;  2UZG A;  3U5N A;  3KV6 A;  4FJC A;  3ZNI A;  2ECG A;  2YQL A;  2H0D A;  2YHO A;  1MM3 A;  1WEW A;  2YQM A;  2ECW A;  1HYI A;  2Y1N A;  4YAD A;  4L7X A;  3KQI A;  2CSZ A;  2YSM A;  2KGI A;  1JM7 B;  2L0B A;  3N9O A;  1WEP A;  4A49 A;  4V3L C;  2C2L A;  2G45 A;  2ECI A;  3N9Q A;  4A4C A;  2M3H A;  4XI1 A;  3DPL R;  5G04 B;  4GNF A;  4N4F A;  1RMD A;  2PNX A;  2KYU A;  3KNV A;  5EYA F;  1WIM A;  5LKX A;  2LGG A;  5H9M A;  2MNY A;  3ZYQ A;  3ASL A;  2QIC A;  4QF2 A;  4ZDT A;  3IHP A;  4LKA A;  2LXP C;  3V43 A;  2VPG A;  2D8S A;  3EB6 A;  2EOD A;  4QF3 A;  4YAT A;  4YBS A;  2Y43 A;  1WGM A;  2MA5 A;  4FO9 A;  5LKU A;  5KH3 A;  2LRI C;  3ZVZ B;  1CHC A;  2M1R A;  2KWJ A;  4GNG A;  3KV5 A;  4UP0 A;  2ECT A;  1E4U A;  3VK6 A;  4F52 B;  5B76 A;  2L75 A;  3SOU A;  2YRE A;  5TRB A;  4AVX A;  2IDA A;  1Z2Q A;  2E6R A;  2F6N A;  2FSA A;  3N9M A;  5FER A;  3L11 A;  4ZUX U;  2CT2 A;  5TBN A;  1V87 A;  4WA6 A;  1MM2 A;  5LKT A;  2ZET C;  2YSJ A;  4YBT A;  1XWH A;  3M62 A;  1X4J A;  4C9Z A;  5H1V A;  4GB0 A;  3PUR A;  2KWN A;  1G25 A;  5JG6 A;  3HCT A;  2MD7 B;  4IC3 A;  3U5P A;  5TAB A;  2K16 A;  2LN0 A;  5AIU A;  5B77 A;  3LQJ A;  4YBM A;  2DX8 A;  4AYC B;  2VNF A;  3NG2 A;  2H0D B;  2YU4 A;  2VJE A;  2K4D A;  2AN6 A;  1IYM A;  4GND A;  5DKA A;  2LV9 A;  5I3L A;  2OXQ C;  3ZPV 1;  3ZVY A;  2QJ0 A;  4I7C A;  3SHB A;  2JMI A;  2HYE D;  2KWO A;  1ZBD B;  2KFT A;  3GV4 A;  4UP5 A;  1WFK A;  2YT5 A;  3M63 A;  3PHD A;  4CA1 A;  2LGV A;  2HDP A;  3M99 A;  1U6G B;  1WIL A;  2EA6 A;  2VJE B;  5C11 A;  2FUU A;  3RPG C;  5H1T A;  4FK5 A;  4LLB A;  4O64 A;  4WZ0 A;  2JMJ A;  3O7A A;  2L5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...