1WEOA

Solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords cellulose synthase, catalytic subunit (IRX3)
publication title Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase
rcsb
source organism Arabidopsis thaliana
total genus 7
structure length 93
sequence length 93
ec nomenclature ec 2.4.1.12: Cellulose synthase (UDP-forming).
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14569 zf-UDP Zinc-binding RING-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weoA00
1T1HA 2LGLA 2LN0A 2M3HA 3HTKC 4PTBA 5G04B 5DINA 2M1RA 4I7DA 1WESA 3RPGC 5FB0A 4A49A 4GNDA 3O33A 4QF2A 4I7BA 2G6QA 2KR4A 4LJNA 5AITA 1WE9A 2YQLA 4R2YA 1HYIA 2RI7A 5FEYA 4S3OC 2ECTA 1Z2QA 4YAXA 1JM7B 4B7YC 3KV5A 4YADA 2C2LA 4CA1A 5LCWB 2MA6A 3ZPV1 3I2DA 4V3KC 4ZDTA 4MSXA 5C11A 3PUQA 2YT5A 2KGIA 2F42A 4FJCA 1WEOA 4N4FA 4BHWA 3GL6A 5TDRA 2F6NA 5FB1A 3RTRB 5B79A 4AYCB 2AN6A 3ASLA 3O35A 1VD4A 2E6RA 1FBVA 1FP0A 2MD8C 3GV4A 4NN2A 4BBQA 2FUIA 2L80A 4GNGA 2H0DA 3N9QA 2MA5A 1U6GB 1CHCA 4YABA 1MM2A 3U5OA 1JOCA 4LKAA 3SHBA 5AIUA 5B8DA 3L1ZB 4XI1A 2MIQA 4S3OB 4YC9A 2LQ6A 2KE1A 2Y1NA 2MD7B 4Q6FA 3O36A 2HDPA 2KWOA 3QZVA 1RMDA 1X4IA 2G45A 5I3LA 1JM7A 2MNYA 2MT5A 5D1LB 2LGKA 3KNVA 5TBNA 2Y1MA 2KYUA 5D1MB 3O37A 3DQVR 5D1KB 2XEUA 4AUQB 5LKUA 2YHNA 5KH9A 2VPBA 3ZTGA 2UZGA 5B76A 1WGMA 2LXPC 1F62A 4YATA 3M63A 4AYCA 4QF3A 2L75A 2I50A 3EB6A 1WEWA 3DPLR 4LK9A 1WIMA 5EYAF 1X4UA 4A4BA 2QICA 4O64A 3M99A 2VJEA 4P5OB 2D8SA 2ECNA 2KWKA 1K2FA 3L11A 2DX8A 4IC3A 3PHDA 2K17A 2LGVA 2K4DA 3T6RA 2VJFB 4AVXA 2L43A 2ZETC 2HYED 4AP4A 1WEPA 2ECWA 4UP5A 3L1XA 4WZ2A 3V43A 4YBTA 1Z6UA 4FK5A 2ECJA 2ECVA 2CKLB 4GNEA 2YSJA 5LKXA 3N9OA 4I7CA 5G0FA 5TDWA 4YBSA 1WEUA 3M62A 5JG6A 2KWNA 2EA6A 2VJEB 5KH7A 3ZNIA 4CCGX 1WILA 3U5NA 2YURA 2KWJA 1VYXA 2KFTA 3ZVYA 3C5KA 3KV6A 5H9MA 4MVTA 2Y43A 4GB0A 3N9LA 2M6MA 2FSAA 3ZVZB 2YU4A 5LKTA 2L0BA 2MNZA 2EODA 2LXHC 4R7EA 3MHSA 3KQIA 2LV9A 3HCSA 3VK6A 1Z60A 2G43A 5C13A 1WEVA 1WEMA 2ECGA 2JRJA 3U5MA 2CSYA 4WA6A 3NG2A 4LADB 1ZBDB 3LQIA 2VJFA 2VPGA 4YBMA 4W4UA 3MHHA 3N9MA 2F6JA 3HCTA 4L58A 5H1UA 3EB5A 2PUYA 1N87A 3ZPVE 5LKZA 3LQHA 2NAAA 1WEEA 2CT2A 2CKLA 4B86C 5B77A 2VPEA 5H1VA 2CSZA 2OXQC 2PNXA 2YW8A 2KREA 4C9ZA 4FO9A 5FERA 4V3LC 2K1JA 3SOXA 5DKAA 2KU3A 5B75A 2K16A 1X4JA 3T7LA 2YREA 4FIPA 5KH3A 2L5UA 3SOWA 5G05B 2FUUA 1MM3A 4LLBA 2KIZA 1VFYA 1WENA 1BORA 2XB1A 2JMDA 4A4CA 2VPDA 4WZ0A 2YUCA 4WZ3B 1V87A 1XWHA 5J3XA 4UP0A 2M85A 5TRBA 2YQMA 1LDKC 1G25A 2ECIA 1IYMA 2QIZA 3ZYQA 2YHOA 4ZQLA 4GNFA 4F52B 3O34A 3O70A 1DVPA 3RPGB 2RSDA 4R8PK 3C6WA 2KGGA 2JMIA 2YSMA 4ZUXU 2VP7A 4UI9B 4L7XA 3U5PA 4N3WA 2YYRA 3HCUA 2MUMA 5H1TA 3SOUA 2JMJA 2IDAA 2LDRA 3N9PA 3FL2A 5B78A 2C2VS 4TKPB 3O7AA 4X3GA 2VNFA 4PPEA 3LQJA 1E4UA 4IC2A 2E6SA 5TABA 2LGGA 2LRIC 1WEQA 2BAYA 3IHPA 1WFKA 2H0DB 3LRQA 1LDJB 3N9NA 3PURA 2EGPA 4A0CD 1HYJA 2QJ0A
chains in the Genus database with same CATH superfamily
1T1HA 2LGLA 2LN0A 2P57A 2M3HA 3HTKC 4PTBA 5G04B 5DINA 2M1RA 4I7DA 1WESA 3RPGC 5FB0A 4A49A 4GNDA 3O33A 4QF2A 4I7BA 2B0OE 2G6QA 2KR4A 4LJNA 5AITA 1WE9A 2YQLA 4R2YA 1HYIA 2RI7A 5FEYA 4S3OC 2ECTA 1Z2QA 4YAXA 5SVYA 4B7YC 1JM7B 3KV5A 4YADA 4O62A 4H9DA 2C2LA 4CA1A 5LCWB 2MA6A 3ZPV1 3I2DA 4V3KC 4ZDTA 4MSXA 5K3QA 5C11A 3PUQA 2YT5A 2KGIA 2F42A 4FJCA 1WEOA 4N4FA 4BHWA 2KKYA 3GL6A 5TDRA 1MBMA 2F6NA 5FB1A 3RTRB 5B79A 4AYCB 2AN6A 3ASLA 3O35A 1VD4A 2E6RA 1FBVA 1FP0A 2MD8C 3GV4A 2FD4A 4NN2A 1DCQA 2FUIA 3SUBA 4BBQA 2L80A 4GNGA 2H0DA 3N9QA 2MA5A 1U6GB 3M7KA 1CHCA 4YABA 1MM2A 2XP0A 3U5OA 1JOCA 4LKAA 3SHBA 5AIUA 5B8DA 3L1ZB 2CRWA 4XI1A 2MIQA 4S3OB 4YC9A 2LQ6A 2KE1A 2Y1NA 3LVQE 2MD7B 4Q6FA 3O36A 2RR4A 2HDPA 2KWOA 3QZVA 1RMDA 1X4IA 2G45A 5I3LA 1JM7A 2MNYA 2MT5A 5D1LB 2LGKA 3KNVA 5TBNA 2Y1MA 2KYUA 5D1MB 3O37A 3DQVR 5D1KB 2XEUA 2D8UA 4AUQB 2L7PA 5LKUA 3LVRE 2MKEA 2YHNA 5KH9A 2VPBA 3ZTGA 2UZGA 5B76A 1WGMA 2LXPC 1F62A 4YATA 3M63A 4AYCA 4QF3A 2L75A 2KKXA 3FANA 2I50A 3EB6A 1WEWA 3DPLR 4LK9A 1WIMA 5EYAF 1X4UA 4A4BA 2QICA 4O64A 3M99A 2VJEA 4P5OB 2D8SA 2ECNA 2KWKA 2YVRA 2IQJA 1K2FA 3L11A 2JM3A 2DX8A 4IC3A 3PHDA 2K17A 2LGVA 2XOZA 2K4DA 3T6RA 5SVIA 2VJFB 4AVXA 4QQ4A 2DJAA 2L43A 2ZETC 3Q1DA 2HYED 4AP4A 1WEPA 2ECWA 4UP5A 3L1XA 4WZ2A 3FEHA 3V43A 4YBTA 1Z6UA 4FK5A 2ECJA 2ECVA 2EXUA 2CKLB 4GNEA 2YSJA 5LKXA 3N9OA 4I7CA 5G0FA 5TDWA 4YBSA 1WEUA 3M62A 5JG6A 2KWNA 2EA6A 2VJEB 5KH7A 3ZNIA 4CCGX 3JUEA 1WILA 3U5NA 2YURA 2KWJA 1VYXA 2KFTA 3ZVYA 5SVIB 3C5KA 3KV6A 5H9MA 3LDYA 4MVTA 2Y43A 4GB0A 3T9KA 3N9LA 2M6MA 2FSAA 3ZVZB 2YU4A 5LKTA 2DSMA 2L0BA 2MNZA 2EODA 3E2DA 4R7EA 2LXHC 4OGEA 3MHSA 3KQIA 2LV9A 3HCSA 3DDTA 3VK6A 1Z60A 2G43A 2EGMA 5C13A 1WEVA 1WEMA 2ECGA 2JRJA 3U5MA 2CSYA 4WA6A 3NG2A 4LADB 1ZBDB 3LQIA 2VJFA 2VPGA 2CSVA 4W4UA 4YBMA 3KDEC 3N9MA 3MHHA 2F6JA 3HCTA 4L58A 4OGCA 5H1UA 2XOCA 3EB5A 2PUYA 1N87A 3ZPVE 2XOYA 5LKZA 3LQHA 2NAAA 1WEEA 2CT2A 2CKLA 4B86C 5B77A 2VPEA 5H1VA 3PLWA 2E61A 2CSZA 3O47A 2OXQC 2PNXA 2YW8A 2KREA 4C9ZA 4FO9A 3FJUB 5SVXA 5FERA 4V3LC 2K1JA 3SOXA 5DKAA 2KU3A 5B75A 2K16A 2LAUA 1X4JA 4Z0OA 3T7LA 4F1PA 2YREA 4FIPA 5KH3A 2L5UA 3SOWA 2JUNA 5G05B 2CONA 2FUUA 1MM3A 4LLBA 2KIZA 1VFYA 1WENA 1BORA 2XB1A 2JMDA 4A4CA 2VPDA 4WZ0A 2YUCA 4WZ3B 1V87A 1XWHA 2M13A 5J3XA 4UP0A 2M85A 5TRBA 2YQMA 1LDKC 1G25A 2ECIA 1IYMA 2QIZA 3ZYQA 2YHOA 4ZQLA 4GNFA 4F52B 3O34A 2OWAA 3O70A 1DVPA 3RPGB 2RSDA 4R8PK 3C6WA 2KGGA 2JMIA 2YSMA 4ZUXU 2VP7A 4UI9B 4L7XA 3U5PA 2CRRA 4N3WA 2YYRA 3DWDA 3HCUA 4Z0RA 2MUMA 3LJUX 5H1TA 3SOUA 2JMJA 2IDAA 2LDRA 3N9PA 3FL2A 5B78A 2C2VS 4TKPB 3O7AA 4X3GA 2FFWA 3FM8C 2VNFA 3MDBC 4PPEA 3LQJA 1E4UA 4IC2A 2E6SA 5TABA 3H7HA 3FAOA 2LGGA 2LRIC 1WEQA 2BAYA 3IHPA 1WFKA 2H0DB 3LRQA 1LDJB 3N9NA 3PURA 2EGPA 4A0CD 1HYJA 2QJ0A
chains in the Genus database with same CATH topology
1T1HA 2LGLA 2LN0A 2M3HA 3HTKC 4PTBA 5G04B 5DINA 2M1RA 4I7DA 1WESA 3RPGC 5FB0A 4A49A 4GNDA 3O33A 4QF2A 4I7BA 2G6QA 2KR4A 4LJNA 5AITA 1WE9A 2YQLA 4R2YA 1HYIA 2RI7A 5FEYA 4S3OC 2ECTA 1Z2QA 4YAXA 1JM7B 4B7YC 3KV5A 4YADA 2C2LA 4CA1A 5LCWB 2MA6A 3ZPV1 3I2DA 4V3KC 4ZDTA 4MSXA 5C11A 3PUQA 2YT5A 2KGIA 2F42A 4FJCA 1WEOA 4N4FA 4BHWA 3GL6A 5TDRA 2F6NA 5FB1A 3RTRB 5B79A 4AYCB 2AN6A 3ASLA 3O35A 1VD4A 2E6RA 1FBVA 1FP0A 2MD8C 3GV4A 4NN2A 4BBQA 2FUIA 2L80A 4GNGA 2H0DA 3N9QA 2MA5A 1U6GB 1CHCA 4YABA 1MM2A 3U5OA 1JOCA 4LKAA 3SHBA 5AIUA 5B8DA 3L1ZB 4XI1A 2MIQA 4S3OB 4YC9A 2LQ6A 2KE1A 2Y1NA 2MD7B 4Q6FA 3O36A 2HDPA 2KWOA 3QZVA 1RMDA 1X4IA 2G45A 5I3LA 1JM7A 2MNYA 2MT5A 5D1LB 2LGKA 3KNVA 5TBNA 2Y1MA 2KYUA 5D1MB 3O37A 3DQVR 5D1KB 2XEUA 4AUQB 5LKUA 2YHNA 5KH9A 2VPBA 3ZTGA 2UZGA 5B76A 1WGMA 2LXPC 1F62A 4YATA 3M63A 4AYCA 4QF3A 2L75A 2I50A 3EB6A 1WEWA 3DPLR 4LK9A 1WIMA 5EYAF 1X4UA 4A4BA 2QICA 4O64A 3M99A 2VJEA 4P5OB 2D8SA 2ECNA 2KWKA 1K2FA 3L11A 2DX8A 4IC3A 3PHDA 2K17A 2LGVA 2K4DA 3T6RA 2VJFB 4AVXA 2L43A 2ZETC 2HYED 4AP4A 1WEPA 2ECWA 4UP5A 3L1XA 4WZ2A 3V43A 4YBTA 1Z6UA 4FK5A 2ECJA 2ECVA 2CKLB 4GNEA 2YSJA 5LKXA 3N9OA 4I7CA 5G0FA 5TDWA 4YBSA 1WEUA 3M62A 5JG6A 2KWNA 2EA6A 2VJEB 5KH7A 3ZNIA 4CCGX 1WILA 3U5NA 2YURA 2KWJA 1VYXA 2KFTA 3ZVYA 3C5KA 3KV6A 5H9MA 4MVTA 2Y43A 4GB0A 3N9LA 2M6MA 2FSAA 3ZVZB 2YU4A 5LKTA 2L0BA 2MNZA 2EODA 2LXHC 4R7EA 3MHSA 3KQIA 2LV9A 3HCSA 3VK6A 1Z60A 2G43A 5C13A 1WEVA 1WEMA 2ECGA 2JRJA 3U5MA 2CSYA 4WA6A 3NG2A 4LADB 1ZBDB 3LQIA 2VJFA 2VPGA 4YBMA 4W4UA 3MHHA 3N9MA 2F6JA 3HCTA 4L58A 5H1UA 3EB5A 2PUYA 1N87A 3ZPVE 5LKZA 3LQHA 2NAAA 1WEEA 2CT2A 2CKLA 4B86C 5B77A 2VPEA 5H1VA 2CSZA 2OXQC 2PNXA 2YW8A 2KREA 4C9ZA 4FO9A 5FERA 4V3LC 2K1JA 3SOXA 5DKAA 2KU3A 5B75A 2K16A 1X4JA 3T7LA 2YREA 4FIPA 5KH3A 2L5UA 3SOWA 5G05B 2FUUA 1MM3A 4LLBA 2KIZA 1VFYA 1WENA 1BORA 2XB1A 2JMDA 4A4CA 2VPDA 4WZ0A 2YUCA 4WZ3B 1V87A 1XWHA 5J3XA 4UP0A 2M85A 5TRBA 2YQMA 1LDKC 1G25A 2ECIA 1IYMA 2QIZA 3ZYQA 2YHOA 4ZQLA 4GNFA 4F52B 3O34A 3O70A 1DVPA 3RPGB 2RSDA 4R8PK 3C6WA 2KGGA 2JMIA 2YSMA 4ZUXU 2VP7A 4UI9B 4L7XA 3U5PA 4N3WA 2YYRA 3HCUA 2MUMA 5H1TA 3SOUA 2JMJA 2IDAA 2LDRA 3N9PA 3FL2A 5B78A 2C2VS 4TKPB 3O7AA 4X3GA 2VNFA 4PPEA 3LQJA 1E4UA 4IC2A 2E6SA 5TABA 2LGGA 2LRIC 1WEQA 2BAYA 3IHPA 1WFKA 2H0DB 3LRQA 1LDJB 3N9NA 3PURA 2EGPA 4A0CD 1HYJA 2QJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1H A;  2LGL A;  2LN0 A;  2M3H A;  3HTK C;  4PTB A;  5G04 B;  5DIN A;  2M1R A;  4I7D A;  1WES A;  3RPG C;  5FB0 A;  4A49 A;  4GND A;  3O33 A;  4QF2 A;  4I7B A;  2G6Q A;  2KR4 A;  4LJN A;  5AIT A;  1WE9 A;  2YQL A;  4R2Y A;  1HYI A;  2RI7 A;  5FEY A;  4S3O C;  2ECT A;  1Z2Q A;  4YAX A;  1JM7 B;  4B7Y C;  3KV5 A;  4YAD A;  2C2L A;  4CA1 A;  5LCW B;  2MA6 A;  3ZPV 1;  3I2D A;  4V3K C;  4ZDT A;  4MSX A;  5C11 A;  3PUQ A;  2YT5 A;  2KGI A;  2F42 A;  4FJC A;  1WEO A;  4N4F A;  4BHW A;  3GL6 A;  5TDR A;  2F6N A;  5FB1 A;  3RTR B;  5B79 A;  4AYC B;  2AN6 A;  3ASL A;  3O35 A;  1VD4 A;  2E6R A;  1FBV A;  1FP0 A;  2MD8 C;  3GV4 A;  4NN2 A;  4BBQ A;  2FUI A;  2L80 A;  4GNG A;  2H0D A;  3N9Q A;  2MA5 A;  1U6G B;  1CHC A;  4YAB A;  1MM2 A;  3U5O A;  1JOC A;  4LKA A;  3SHB A;  5AIU A;  5B8D A;  3L1Z B;  4XI1 A;  2MIQ A;  4S3O B;  4YC9 A;  2LQ6 A;  2KE1 A;  2Y1N A;  2MD7 B;  4Q6F A;  3O36 A;  2HDP A;  2KWO A;  3QZV A;  1RMD A;  1X4I A;  2G45 A;  5I3L A;  1JM7 A;  2MNY A;  2MT5 A;  5D1L B;  2LGK A;  3KNV A;  5TBN A;  2Y1M A;  2KYU A;  5D1M B;  3O37 A;  3DQV R;  5D1K B;  2XEU A;  4AUQ B;  5LKU A;  2YHN A;  5KH9 A;  2VPB A;  3ZTG A;  2UZG A;  5B76 A;  1WGM A;  2LXP C;  1F62 A;  4YAT A;  3M63 A;  4AYC A;  4QF3 A;  2L75 A;  2I50 A;  3EB6 A;  1WEW A;  3DPL R;  4LK9 A;  1WIM A;  5EYA F;  1X4U A;  4A4B A;  2QIC A;  4O64 A;  3M99 A;  2VJE A;  4P5O B;  2D8S A;  2ECN A;  2KWK A;  1K2F A;  3L11 A;  2DX8 A;  4IC3 A;  3PHD A;  2K17 A;  2LGV A;  2K4D A;  3T6R A;  2VJF B;  4AVX A;  2L43 A;  2ZET C;  2HYE D;  4AP4 A;  1WEP A;  2ECW A;  4UP5 A;  3L1X A;  4WZ2 A;  3V43 A;  4YBT A;  1Z6U A;  4FK5 A;  2ECJ A;  2ECV A;  2CKL B;  4GNE A;  2YSJ A;  5LKX A;  3N9O A;  4I7C A;  5G0F A;  5TDW A;  4YBS A;  1WEU A;  3M62 A;  5JG6 A;  2KWN A;  2EA6 A;  2VJE B;  5KH7 A;  3ZNI A;  4CCG X;  1WIL A;  3U5N A;  2YUR A;  2KWJ A;  1VYX A;  2KFT A;  3ZVY A;  3C5K A;  3KV6 A;  5H9M A;  4MVT A;  2Y43 A;  4GB0 A;  3N9L A;  2M6M A;  2FSA A;  3ZVZ B;  2YU4 A;  5LKT A;  2L0B A;  2MNZ A;  2EOD A;  2LXH C;  4R7E A;  3MHS A;  3KQI A;  2LV9 A;  3HCS A;  3VK6 A;  1Z60 A;  2G43 A;  5C13 A;  1WEV A;  1WEM A;  2ECG A;  2JRJ A;  3U5M A;  2CSY A;  4WA6 A;  3NG2 A;  4LAD B;  1ZBD B;  3LQI A;  2VJF A;  2VPG A;  4YBM A;  4W4U A;  3MHH A;  3N9M A;  2F6J A;  3HCT A;  4L58 A;  5H1U A;  3EB5 A;  2PUY A;  1N87 A;  3ZPV E;  5LKZ A;  3LQH A;  2NAA A;  1WEE A;  2CT2 A;  2CKL A;  4B86 C;  5B77 A;  2VPE A;  5H1V A;  2CSZ A;  2OXQ C;  2PNX A;  2YW8 A;  2KRE A;  4C9Z A;  4FO9 A;  5FER A;  4V3L C;  2K1J A;  3SOX A;  5DKA A;  2KU3 A;  5B75 A;  2K16 A;  1X4J A;  3T7L A;  2YRE A;  4FIP A;  5KH3 A;  2L5U A;  3SOW A;  5G05 B;  2FUU A;  1MM3 A;  4LLB A;  2KIZ A;  1VFY A;  1WEN A;  1BOR A;  2XB1 A;  2JMD A;  4A4C A;  2VPD A;  4WZ0 A;  2YUC A;  4WZ3 B;  1V87 A;  1XWH A;  5J3X A;  4UP0 A;  2M85 A;  5TRB A;  2YQM A;  1LDK C;  1G25 A;  2ECI A;  1IYM A;  2QIZ A;  3ZYQ A;  2YHO A;  4ZQL A;  4GNF A;  4F52 B;  3O34 A;  3O70 A;  1DVP A;  3RPG B;  2RSD A;  4R8P K;  3C6W A;  2KGG A;  2JMI A;  2YSM A;  4ZUX U;  2VP7 A;  4UI9 B;  4L7X A;  3U5P A;  4N3W A;  2YYR A;  3HCU A;  2MUM A;  5H1T A;  3SOU A;  2JMJ A;  2IDA A;  2LDR A;  3N9P A;  3FL2 A;  5B78 A;  2C2V S;  4TKP B;  3O7A A;  4X3G A;  2VNF A;  4PPE A;  3LQJ A;  1E4U A;  4IC2 A;  2E6S A;  5TAB A;  2LGG A;  2LRI C;  1WEQ A;  2BAY A;  3IHP A;  1WFK A;  2H0D B;  3LRQ A;  1LDJ B;  3N9N A;  3PUR A;  2EGP A;  4A0C D;  1HYJ A;  2QJ0 A; 
#chains in the Genus database with same CATH topology
 1T1H A;  2LGL A;  2LN0 A;  2P57 A;  2M3H A;  3HTK C;  4PTB A;  5G04 B;  5DIN A;  2M1R A;  4I7D A;  1WES A;  3RPG C;  5FB0 A;  4A49 A;  4GND A;  3O33 A;  4QF2 A;  4I7B A;  2B0O E;  2G6Q A;  2KR4 A;  4LJN A;  5AIT A;  1WE9 A;  2YQL A;  4R2Y A;  1HYI A;  2RI7 A;  5FEY A;  4S3O C;  2ECT A;  1Z2Q A;  4YAX A;  5SVY A;  4B7Y C;  1JM7 B;  3KV5 A;  4YAD A;  4O62 A;  4H9D A;  2C2L A;  4CA1 A;  5LCW B;  2MA6 A;  3ZPV 1;  3I2D A;  4V3K C;  4ZDT A;  4MSX A;  5K3Q A;  5C11 A;  3PUQ A;  2YT5 A;  2KGI A;  2F42 A;  4FJC A;  1WEO A;  4N4F A;  4BHW A;  2KKY A;  3GL6 A;  5TDR A;  1MBM A;  2F6N A;  5FB1 A;  3RTR B;  5B79 A;  4AYC B;  2AN6 A;  3ASL A;  3O35 A;  1VD4 A;  2E6R A;  1FBV A;  1FP0 A;  2MD8 C;  3GV4 A;  2FD4 A;  4NN2 A;  1DCQ A;  2FUI A;  3SUB A;  4BBQ A;  2L80 A;  4GNG A;  2H0D A;  3N9Q A;  2MA5 A;  1U6G B;  3M7K A;  1CHC A;  4YAB A;  1MM2 A;  2XP0 A;  3U5O A;  1JOC A;  4LKA A;  3SHB A;  5AIU A;  5B8D A;  3L1Z B;  2CRW A;  4XI1 A;  2MIQ A;  4S3O B;  4YC9 A;  2LQ6 A;  2KE1 A;  2Y1N A;  3LVQ E;  2MD7 B;  4Q6F A;  3O36 A;  2RR4 A;  2HDP A;  2KWO A;  3QZV A;  1RMD A;  1X4I A;  2G45 A;  5I3L A;  1JM7 A;  2MNY A;  2MT5 A;  5D1L B;  2LGK A;  3KNV A;  5TBN A;  2Y1M A;  2KYU A;  5D1M B;  3O37 A;  3DQV R;  5D1K B;  2XEU A;  2D8U A;  4AUQ B;  2L7P A;  5LKU A;  3LVR E;  2MKE A;  2YHN A;  5KH9 A;  2VPB A;  3ZTG A;  2UZG A;  5B76 A;  1WGM A;  2LXP C;  1F62 A;  4YAT A;  3M63 A;  4AYC A;  4QF3 A;  2L75 A;  2KKX A;  3FAN A;  2I50 A;  3EB6 A;  1WEW A;  3DPL R;  4LK9 A;  1WIM A;  5EYA F;  1X4U A;  4A4B A;  2QIC A;  4O64 A;  3M99 A;  2VJE A;  4P5O B;  2D8S A;  2ECN A;  2KWK A;  2YVR A;  2IQJ A;  1K2F A;  3L11 A;  2JM3 A;  2DX8 A;  4IC3 A;  3PHD A;  2K17 A;  2LGV A;  2XOZ A;  2K4D A;  3T6R A;  5SVI A;  2VJF B;  4AVX A;  4QQ4 A;  2DJA A;  2L43 A;  2ZET C;  3Q1D A;  2HYE D;  4AP4 A;  1WEP A;  2ECW A;  4UP5 A;  3L1X A;  4WZ2 A;  3FEH A;  3V43 A;  4YBT A;  1Z6U A;  4FK5 A;  2ECJ A;  2ECV A;  2EXU A;  2CKL B;  4GNE A;  2YSJ A;  5LKX A;  3N9O A;  4I7C A;  5G0F A;  5TDW A;  4YBS A;  1WEU A;  3M62 A;  5JG6 A;  2KWN A;  2EA6 A;  2VJE B;  5KH7 A;  3ZNI A;  4CCG X;  3JUE A;  1WIL A;  3U5N A;  2YUR A;  2KWJ A;  1VYX A;  2KFT A;  3ZVY A;  5SVI B;  3C5K A;  3KV6 A;  5H9M A;  3LDY A;  4MVT A;  2Y43 A;  4GB0 A;  3T9K A;  3N9L A;  2M6M A;  2FSA A;  3ZVZ B;  2YU4 A;  5LKT A;  2DSM A;  2L0B A;  2MNZ A;  2EOD A;  3E2D A;  4R7E A;  2LXH C;  4OGE A;  3MHS A;  3KQI A;  2LV9 A;  3HCS A;  3DDT A;  3VK6 A;  1Z60 A;  2G43 A;  2EGM A;  5C13 A;  1WEV A;  1WEM A;  2ECG A;  2JRJ A;  3U5M A;  2CSY A;  4WA6 A;  3NG2 A;  4LAD B;  1ZBD B;  3LQI A;  2VJF A;  2VPG A;  2CSV A;  4W4U A;  4YBM A;  3KDE C;  3N9M A;  3MHH A;  2F6J A;  3HCT A;  4L58 A;  4OGC A;  5H1U A;  2XOC A;  3EB5 A;  2PUY A;  1N87 A;  3ZPV E;  2XOY A;  5LKZ A;  3LQH A;  2NAA A;  1WEE A;  2CT2 A;  2CKL A;  4B86 C;  5B77 A;  2VPE A;  5H1V A;  3PLW A;  2E61 A;  2CSZ A;  3O47 A;  2OXQ C;  2PNX A;  2YW8 A;  2KRE A;  4C9Z A;  4FO9 A;  3FJU B;  5SVX A;  5FER A;  4V3L C;  2K1J A;  3SOX A;  5DKA A;  2KU3 A;  5B75 A;  2K16 A;  2LAU A;  1X4J A;  4Z0O A;  3T7L A;  4F1P A;  2YRE A;  4FIP A;  5KH3 A;  2L5U A;  3SOW A;  2JUN A;  5G05 B;  2CON A;  2FUU A;  1MM3 A;  4LLB A;  2KIZ A;  1VFY A;  1WEN A;  1BOR A;  2XB1 A;  2JMD A;  4A4C A;  2VPD A;  4WZ0 A;  2YUC A;  4WZ3 B;  1V87 A;  1XWH A;  2M13 A;  5J3X A;  4UP0 A;  2M85 A;  5TRB A;  2YQM A;  1LDK C;  1G25 A;  2ECI A;  1IYM A;  2QIZ A;  3ZYQ A;  2YHO A;  4ZQL A;  4GNF A;  4F52 B;  3O34 A;  2OWA A;  3O70 A;  1DVP A;  3RPG B;  2RSD A;  4R8P K;  3C6W A;  2KGG A;  2JMI A;  2YSM A;  4ZUX U;  2VP7 A;  4UI9 B;  4L7X A;  3U5P A;  2CRR A;  4N3W A;  2YYR A;  3DWD A;  3HCU A;  4Z0R A;  2MUM A;  3LJU X;  5H1T A;  3SOU A;  2JMJ A;  2IDA A;  2LDR A;  3N9P A;  3FL2 A;  5B78 A;  2C2V S;  4TKP B;  3O7A A;  4X3G A;  2FFW A;  3FM8 C;  2VNF A;  3MDB C;  4PPE A;  3LQJ A;  1E4U A;  4IC2 A;  2E6S A;  5TAB A;  3H7H A;  3FAO A;  2LGG A;  2LRI C;  1WEQ A;  2BAY A;  3IHP A;  1WFK A;  2H0D B;  3LRQ A;  1LDJ B;  3N9N A;  3PUR A;  2EGP A;  4A0C D;  1HYJ A;  2QJ0 A; 
#chains in the Genus database with same CATH homology
 1T1H A;  2LGL A;  2LN0 A;  2M3H A;  3HTK C;  4PTB A;  5G04 B;  5DIN A;  2M1R A;  4I7D A;  1WES A;  3RPG C;  5FB0 A;  4A49 A;  4GND A;  3O33 A;  4QF2 A;  4I7B A;  2G6Q A;  2KR4 A;  4LJN A;  5AIT A;  1WE9 A;  2YQL A;  4R2Y A;  1HYI A;  2RI7 A;  5FEY A;  4S3O C;  2ECT A;  1Z2Q A;  4YAX A;  1JM7 B;  4B7Y C;  3KV5 A;  4YAD A;  2C2L A;  4CA1 A;  5LCW B;  2MA6 A;  3ZPV 1;  3I2D A;  4V3K C;  4ZDT A;  4MSX A;  5C11 A;  3PUQ A;  2YT5 A;  2KGI A;  2F42 A;  4FJC A;  1WEO A;  4N4F A;  4BHW A;  3GL6 A;  5TDR A;  2F6N A;  5FB1 A;  3RTR B;  5B79 A;  4AYC B;  2AN6 A;  3ASL A;  3O35 A;  1VD4 A;  2E6R A;  1FBV A;  1FP0 A;  2MD8 C;  3GV4 A;  4NN2 A;  4BBQ A;  2FUI A;  2L80 A;  4GNG A;  2H0D A;  3N9Q A;  2MA5 A;  1U6G B;  1CHC A;  4YAB A;  1MM2 A;  3U5O A;  1JOC A;  4LKA A;  3SHB A;  5AIU A;  5B8D A;  3L1Z B;  4XI1 A;  2MIQ A;  4S3O B;  4YC9 A;  2LQ6 A;  2KE1 A;  2Y1N A;  2MD7 B;  4Q6F A;  3O36 A;  2HDP A;  2KWO A;  3QZV A;  1RMD A;  1X4I A;  2G45 A;  5I3L A;  1JM7 A;  2MNY A;  2MT5 A;  5D1L B;  2LGK A;  3KNV A;  5TBN A;  2Y1M A;  2KYU A;  5D1M B;  3O37 A;  3DQV R;  5D1K B;  2XEU A;  4AUQ B;  5LKU A;  2YHN A;  5KH9 A;  2VPB A;  3ZTG A;  2UZG A;  5B76 A;  1WGM A;  2LXP C;  1F62 A;  4YAT A;  3M63 A;  4AYC A;  4QF3 A;  2L75 A;  2I50 A;  3EB6 A;  1WEW A;  3DPL R;  4LK9 A;  1WIM A;  5EYA F;  1X4U A;  4A4B A;  2QIC A;  4O64 A;  3M99 A;  2VJE A;  4P5O B;  2D8S A;  2ECN A;  2KWK A;  1K2F A;  3L11 A;  2DX8 A;  4IC3 A;  3PHD A;  2K17 A;  2LGV A;  2K4D A;  3T6R A;  2VJF B;  4AVX A;  2L43 A;  2ZET C;  2HYE D;  4AP4 A;  1WEP A;  2ECW A;  4UP5 A;  3L1X A;  4WZ2 A;  3V43 A;  4YBT A;  1Z6U A;  4FK5 A;  2ECJ A;  2ECV A;  2CKL B;  4GNE A;  2YSJ A;  5LKX A;  3N9O A;  4I7C A;  5G0F A;  5TDW A;  4YBS A;  1WEU A;  3M62 A;  5JG6 A;  2KWN A;  2EA6 A;  2VJE B;  5KH7 A;  3ZNI A;  4CCG X;  1WIL A;  3U5N A;  2YUR A;  2KWJ A;  1VYX A;  2KFT A;  3ZVY A;  3C5K A;  3KV6 A;  5H9M A;  4MVT A;  2Y43 A;  4GB0 A;  3N9L A;  2M6M A;  2FSA A;  3ZVZ B;  2YU4 A;  5LKT A;  2L0B A;  2MNZ A;  2EOD A;  2LXH C;  4R7E A;  3MHS A;  3KQI A;  2LV9 A;  3HCS A;  3VK6 A;  1Z60 A;  2G43 A;  5C13 A;  1WEV A;  1WEM A;  2ECG A;  2JRJ A;  3U5M A;  2CSY A;  4WA6 A;  3NG2 A;  4LAD B;  1ZBD B;  3LQI A;  2VJF A;  2VPG A;  4YBM A;  4W4U A;  3MHH A;  3N9M A;  2F6J A;  3HCT A;  4L58 A;  5H1U A;  3EB5 A;  2PUY A;  1N87 A;  3ZPV E;  5LKZ A;  3LQH A;  2NAA A;  1WEE A;  2CT2 A;  2CKL A;  4B86 C;  5B77 A;  2VPE A;  5H1V A;  2CSZ A;  2OXQ C;  2PNX A;  2YW8 A;  2KRE A;  4C9Z A;  4FO9 A;  5FER A;  4V3L C;  2K1J A;  3SOX A;  5DKA A;  2KU3 A;  5B75 A;  2K16 A;  1X4J A;  3T7L A;  2YRE A;  4FIP A;  5KH3 A;  2L5U A;  3SOW A;  5G05 B;  2FUU A;  1MM3 A;  4LLB A;  2KIZ A;  1VFY A;  1WEN A;  1BOR A;  2XB1 A;  2JMD A;  4A4C A;  2VPD A;  4WZ0 A;  2YUC A;  4WZ3 B;  1V87 A;  1XWH A;  5J3X A;  4UP0 A;  2M85 A;  5TRB A;  2YQM A;  1LDK C;  1G25 A;  2ECI A;  1IYM A;  2QIZ A;  3ZYQ A;  2YHO A;  4ZQL A;  4GNF A;  4F52 B;  3O34 A;  3O70 A;  1DVP A;  3RPG B;  2RSD A;  4R8P K;  3C6W A;  2KGG A;  2JMI A;  2YSM A;  4ZUX U;  2VP7 A;  4UI9 B;  4L7X A;  3U5P A;  4N3W A;  2YYR A;  3HCU A;  2MUM A;  5H1T A;  3SOU A;  2JMJ A;  2IDA A;  2LDR A;  3N9P A;  3FL2 A;  5B78 A;  2C2V S;  4TKP B;  3O7A A;  4X3G A;  2VNF A;  4PPE A;  3LQJ A;  1E4U A;  4IC2 A;  2E6S A;  5TAB A;  2LGG A;  2LRI C;  1WEQ A;  2BAY A;  3IHP A;  1WFK A;  2H0D B;  3LRQ A;  1LDJ B;  3N9N A;  3PUR A;  2EGP A;  4A0C D;  1HYJ A;  2QJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...