1WEOA

Solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords cellulose synthase, catalytic subunit (IRX3)
total genus 7
structure length 93
sequence length 93
ec nomenclature ec 2.4.1.12: Cellulose synthase (UDP-forming).
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14569 zf-UDP Zinc-binding RING-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weoA00
2YHNA 2CKLA 3N9OA 1LDKC 3T7LA 4YATA 1CHCA 4B86C 1WEQA 4TKPB 2KWOA 5KH3A 2K16A 4WA6A 5TABA 3LQJA 2I50A 2RI7A 1WESA 2QICA 4X3GA 2LN0A 2G43A 4BBQA 2ECIA 2VPEA 5D1KB 3O35A 3PHDA 2KE1A 1VD4A 3O70A 1Z6UA 3VK6A 2C2LA 2MNZA 4MVTA 1DVPA 5H1VA 2LGGA 4FJCA 2Y1MA 4FIPA 5B78A 3ZPV1 2ECGA 2KFTA 2OXQC 2QJ0A 3LRQA 5C13A 2VJEA 4L7XA 2F42A 4V3LC 4FK5A 2VP7A 1T1HA 4F52B 4LJNA 3M99A 2ECJA 3PURA 2F6NA 5I3LA 3GV4A 3GL6A 1HYIA 2MD7B 1FP0A 2YREA 3RPGC 2YU4A 2KU3A 1WIMA 5FERA 2LRIC 2E6RA 2PNXA 5LKXA 4YABA 2JMDA 4O64A 2QIZA 5H9MA 2RSDA 4YBSA 2L75A 1Z2QA 2L43A 5B77A 5DKAA 4I7CA 3RTRB 2K4DA 4R2YA 2VPDA 1U6GB 2MT5A 2L0BA 2EGPA 4GNFA 4IC2A 1K2FA 4ZQLA 5TRBA 4AYCA 1WENA 2LQ6A 2M3HA 2FUIA 4UI9B 2LGVA 3KNVA 3O36A 2C2VS 2YQMA 2ECTA 2K17A 4GNGA 2YURA 2LV9A 3N9QA 4N3WA 3IHPA 5J3XA 3L1ZB 5H1TA 2VJFB 5LKZA 3N9NA 4LLBA 3ZVZB 5B79A 3DQVR 2EODA 2D8SA 1WEEA 2LDRA 4WZ0A 1JOCA 4AYCB 3ASLA 2YHOA 3ZVYA 2KIZA 2KYUA 3PUQA 4MSXA 5LCWB 2Y43A 3U5PA 2KWKA 4GNDA 2H0DB 3ZTGA 1X4UA 2LGKA 1V87A 3T6RA 5LKTA 3SHBA 1Z60A 4GNEA 2FUUA 5AITA 1FBVA 5G04B 2CKLB 4A0CD 2CT2A 1WEWA 3M63A 5TDWA 4S3OC 2EA6A 2NAAA 5DINA 3HCUA 2ZETC 4QF3A 1BORA 2LXHC 4AVXA 2YUCA 4I7DA 2ECWA 4A4CA 2UZGA 3O7AA 3SOXA 3L11A 1WEVA 3MHHA 4A49A 2KWNA 3DPLR 4CCGX 3U5NA 3U5OA 2FSAA 2ECVA 5B75A 4S3OB 2ECNA 5H1UA 1F62A 5B76A 4P5OB 4LADB 2YQLA 5KH7A 2MA6A 5TBNA 3ZNIA 5FB0A 4UP0A 3FL2A 3SOUA 4R7EA 2KGIA 2L5UA 4PTBA 3MHSA 2MNYA 2G45A 1G25A 3RPGB 1LDJB 4WZ2A 2MD8C 2BAYA 5TDRA 1MM3A 3O34A 3NG2A 5FB1A 1VFYA 4W4UA 2KWJA 4ZUXU 3C5KA 1HYJA 1WEUA 5G05B 3L1XA 4NN2A 3M62A 2HYED 2MA5A 3C6WA 5LKUA 3O33A 4A4BA 4R8PK 2XEUA 1WE9A 2H0DA 4N4FA 4ZDTA 3EB5A 2M1RA 3KQIA 4LKAA 1VYXA 3LQIA 2Y1NA 4YBTA 2XB1A 2JMIA 1WEMA 2MIQA 1E4UA 5G0FA 1X4IA 2KR4A 2VNFA 1WEOA 4PPEA 3I2DA 2JRJA 2KGGA 4AUQB 4YC9A 3ZYQA 1WILA 1XWHA 2VJEB 1N87A 3QZVA 3EB6A 5KH9A 2G6QA 1ZBDB 1JM7B 3HCTA 2DX8A 5EYAF 4B7YC 4XI1A 4YADA 1X4JA 3HCSA 3N9PA 5D1LB 1MM2A 2CSYA 1WGMA 3N9MA 4AP4A 2IDAA 2MUMA 3HTKC 2VJFA 3KV5A 2KREA 2M85A 4I7BA 3U5MA 2K1JA 4CA1A 5B8DA 4FO9A 1RMDA 1IYMA 2LGLA 2HDPA 2M6MA 4BHWA 5FEYA 3KV6A 2E6SA 1WFKA 3N9LA 4IC3A 1JM7A 2L80A 5JG6A 4LK9A 2VPBA 2AN6A 3SOWA 2CSZA 2YYRA 3V43A 4C9ZA 4GB0A 4WZ3B 4YAXA 2F6JA 1WEPA 3LQHA 2YSJA 4Q6FA 3ZPVE 5D1MB 2VPGA 2PUYA 3O37A 2YSMA 4L58A 4YBMA 5C11A 4QF2A 5AIUA 2LXPC 2JMJA 2YT5A 4UP5A 2YW8A 4V3KC
chains in the Genus database with same CATH superfamily
2EGMA 2YHNA 2XP0A 2CKLA 3N9OA 1LDKC 3T7LA 4YATA 1CHCA 4B86C 1WEQA 4TKPB 2XOCA 2KWOA 5KH3A 2K16A 4WA6A 5K3QA 5TABA 3LQJA 2I50A 2RI7A 1WESA 2QICA 3T9KA 3FJUB 4X3GA 2LN0A 2G43A 2MKEA 2M13A 4BBQA 2ECIA 2VPEA 5D1KB 3O35A 3PHDA 2KE1A 4H9DA 1VD4A 3O70A 1Z6UA 3VK6A 2C2LA 2MNZA 3DDTA 4MVTA 3SUBA 1DVPA 3FEHA 3FANA 5H1VA 3PLWA 2LGGA 4FJCA 2Y1MA 4FIPA 5B78A 3ZPV1 2ECGA 2KFTA 2OXQC 2QJ0A 3DWDA 3LRQA 5C13A 2VJEA 4L7XA 2F42A 4V3LC 4FK5A 2VP7A 1T1HA 4F52B 4LJNA 3M99A 2ECJA 3PURA 2F6NA 2B0OE 5I3LA 3GV4A 1MBMA 3GL6A 1HYIA 2MD7B 1FP0A 2YREA 3RPGC 3KDEC 2YU4A 2KU3A 1WIMA 5FERA 2LRIC 4OGEA 2E6RA 2PNXA 5LKXA 4YABA 2JMDA 4O64A 2QIZA 5H9MA 2RSDA 4YBSA 2L75A 1Z2QA 2L43A 5B77A 5DKAA 4I7CA 3RTRB 2K4DA 4R2YA 3MDBC 2VPDA 1U6GB 2MT5A 2L0BA 2EGPA 4GNFA 4IC2A 1K2FA 4ZQLA 5TRBA 4AYCA 1WENA 2LQ6A 2M3HA 2FUIA 4UI9B 2LGVA 3KNVA 3O36A 2C2VS 2YQMA 2ECTA 2K17A 4GNGA 2YURA 2LV9A 3N9QA 4N3WA 3IHPA 5J3XA 3L1ZB 5H1TA 2VJFB 5LKZA 3N9NA 4LLBA 3ZVZB 5B79A 3DQVR 2EODA 2D8SA 4Z0OA 1WEEA 2LDRA 4WZ0A 1JOCA 4AYCB 3ASLA 2YHOA 3ZVYA 2KIZA 2KYUA 3PUQA 4MSXA 5LCWB 2Y43A 3U5PA 2KWKA 4GNDA 2H0DB 5SVIB 3ZTGA 1X4UA 4Z0RA 2LGKA 1V87A 3T6RA 5LKTA 5SVYA 3SHBA 1Z60A 4GNEA 2FUUA 2YVRA 5AITA 1FBVA 5G04B 2CKLB 4A0CD 2CT2A 2CONA 1WEWA 3M63A 5TDWA 4S3OC 2EA6A 2NAAA 5DINA 3HCUA 2ZETC 4QF3A 1BORA 2LXHC 4AVXA 2YUCA 4I7DA 2ECWA 4F1PA 4A4CA 2LAUA 3FAOA 2UZGA 3O7AA 5SVXA 3SOXA 3L11A 1WEVA 3MHHA 4A49A 2KWNA 3DPLR 4CCGX 3U5NA 3U5OA 2FSAA 2DSMA 2ECVA 3JUEA 5B75A 2EXUA 2P57A 4S3OB 2ECNA 5H1UA 1F62A 2FFWA 5B76A 4P5OB 4LADB 2YQLA 5KH7A 2MA6A 5TBNA 3ZNIA 5FB0A 4UP0A 3FL2A 3SOUA 4R7EA 2OWAA 2KGIA 2E61A 2L5UA 4PTBA 2KKYA 3MHSA 2MNYA 2G45A 1G25A 3RPGB 1LDJB 4WZ2A 2MD8C 2BAYA 5TDRA 1MM3A 3O34A 3NG2A 5FB1A 1VFYA 4W4UA 4O62A 2L7PA 2KWJA 4ZUXU 3C5KA 1HYJA 1WEUA 5G05B 3L1XA 2CRWA 4NN2A 3M62A 2FD4A 3E2DA 2HYED 2MA5A 3C6WA 5LKUA 2KKXA 3O33A 2DJAA 4A4BA 4R8PK 2XEUA 1WE9A 2H0DA 4N4FA 4ZDTA 5SVIA 3LDYA 3EB5A 2M1RA 3KQIA 4LKAA 1VYXA 3LQIA 2Y1NA 4YBTA 2XB1A 2JMIA 1WEMA 2MIQA 1E4UA 5G0FA 1X4IA 2KR4A 3H7HA 2VNFA 3O47A 1WEOA 4PPEA 3I2DA 2JRJA 2KGGA 4AUQB 2CSVA 4YC9A 3ZYQA 1WILA 4QQ4A 1XWHA 2VJEB 1N87A 3QZVA 3EB6A 5KH9A 2G6QA 1ZBDB 1JM7B 3HCTA 2DX8A 5EYAF 3LVRE 4B7YC 1DCQA 4XI1A 4YADA 1X4JA 3HCSA 3N9PA 5D1LB 1MM2A 2CSYA 1WGMA 2D8UA 3N9MA 4AP4A 2CRRA 2IQJA 2IDAA 2MUMA 3HTKC 3FM8C 2VJFA 3KV5A 2KREA 2M85A 4I7BA 3U5MA 2K1JA 4CA1A 5B8DA 4FO9A 1RMDA 1IYMA 2LGLA 2HDPA 3LVQE 2M6MA 2RR4A 4BHWA 5FEYA 3KV6A 2E6SA 2JUNA 1WFKA 3N9LA 4IC3A 1JM7A 2L80A 5JG6A 4LK9A 2VPBA 2AN6A 3SOWA 2CSZA 3Q1DA 2YYRA 3LJUX 3V43A 4C9ZA 4GB0A 2XOZA 3M7KA 4WZ3B 4YAXA 2XOYA 4OGCA 2F6JA 1WEPA 3LQHA 2YSJA 4Q6FA 5D1MB 3ZPVE 2VPGA 2PUYA 3O37A 2JM3A 2YSMA 4L58A 4YBMA 5C11A 4QF2A 5AIUA 2LXPC 2JMJA 2YT5A 4UP5A 2YW8A 4V3KC
chains in the Genus database with same CATH topology
2YHNA 2CKLA 3N9OA 1LDKC 3T7LA 4YATA 1CHCA 4B86C 1WEQA 4TKPB 2KWOA 5KH3A 2K16A 4WA6A 5TABA 3LQJA 2I50A 2RI7A 1WESA 2QICA 4X3GA 2LN0A 2G43A 4BBQA 2ECIA 2VPEA 5D1KB 3O35A 3PHDA 2KE1A 1VD4A 3O70A 1Z6UA 3VK6A 2C2LA 2MNZA 4MVTA 1DVPA 5H1VA 2LGGA 4FJCA 2Y1MA 4FIPA 5B78A 3ZPV1 2ECGA 2KFTA 2OXQC 2QJ0A 3LRQA 5C13A 2VJEA 4L7XA 2F42A 4V3LC 4FK5A 2VP7A 1T1HA 4F52B 4LJNA 3M99A 2ECJA 3PURA 2F6NA 5I3LA 3GV4A 3GL6A 1HYIA 2MD7B 1FP0A 2YREA 3RPGC 2YU4A 2KU3A 1WIMA 5FERA 2LRIC 2E6RA 2PNXA 5LKXA 4YABA 2JMDA 4O64A 2QIZA 5H9MA 2RSDA 4YBSA 2L75A 1Z2QA 2L43A 5B77A 5DKAA 4I7CA 3RTRB 2K4DA 4R2YA 2VPDA 1U6GB 2MT5A 2L0BA 2EGPA 4GNFA 4IC2A 1K2FA 4ZQLA 5TRBA 4AYCA 1WENA 2LQ6A 2M3HA 2FUIA 4UI9B 2LGVA 3KNVA 3O36A 2C2VS 2YQMA 2ECTA 2K17A 4GNGA 2YURA 2LV9A 3N9QA 4N3WA 3IHPA 5J3XA 3L1ZB 5H1TA 2VJFB 5LKZA 3N9NA 4LLBA 3ZVZB 5B79A 3DQVR 2EODA 2D8SA 1WEEA 2LDRA 4WZ0A 1JOCA 4AYCB 3ASLA 2YHOA 3ZVYA 2KIZA 2KYUA 3PUQA 4MSXA 5LCWB 2Y43A 3U5PA 2KWKA 4GNDA 2H0DB 3ZTGA 1X4UA 2LGKA 1V87A 3T6RA 5LKTA 3SHBA 1Z60A 4GNEA 2FUUA 5AITA 1FBVA 5G04B 2CKLB 4A0CD 2CT2A 1WEWA 3M63A 5TDWA 4S3OC 2EA6A 2NAAA 5DINA 3HCUA 2ZETC 4QF3A 1BORA 2LXHC 4AVXA 2YUCA 4I7DA 2ECWA 4A4CA 2UZGA 3O7AA 3SOXA 3L11A 1WEVA 3MHHA 4A49A 2KWNA 3DPLR 4CCGX 3U5NA 3U5OA 2FSAA 2ECVA 5B75A 4S3OB 2ECNA 5H1UA 1F62A 5B76A 4P5OB 4LADB 2YQLA 5KH7A 2MA6A 5TBNA 3ZNIA 5FB0A 4UP0A 3FL2A 3SOUA 4R7EA 2KGIA 2L5UA 4PTBA 3MHSA 2MNYA 2G45A 1G25A 3RPGB 1LDJB 4WZ2A 2MD8C 2BAYA 5TDRA 1MM3A 3O34A 3NG2A 5FB1A 1VFYA 4W4UA 2KWJA 4ZUXU 3C5KA 1HYJA 1WEUA 5G05B 3L1XA 4NN2A 3M62A 2HYED 2MA5A 3C6WA 5LKUA 3O33A 4A4BA 4R8PK 2XEUA 1WE9A 2H0DA 4N4FA 4ZDTA 3EB5A 2M1RA 3KQIA 4LKAA 1VYXA 3LQIA 2Y1NA 4YBTA 2XB1A 2JMIA 1WEMA 2MIQA 1E4UA 5G0FA 1X4IA 2KR4A 2VNFA 1WEOA 4PPEA 3I2DA 2JRJA 2KGGA 4AUQB 4YC9A 3ZYQA 1WILA 1XWHA 2VJEB 1N87A 3QZVA 3EB6A 5KH9A 2G6QA 1ZBDB 1JM7B 3HCTA 2DX8A 5EYAF 4B7YC 4XI1A 4YADA 1X4JA 3HCSA 3N9PA 5D1LB 1MM2A 2CSYA 1WGMA 3N9MA 4AP4A 2IDAA 2MUMA 3HTKC 2VJFA 3KV5A 2KREA 2M85A 4I7BA 3U5MA 2K1JA 4CA1A 5B8DA 4FO9A 1RMDA 1IYMA 2LGLA 2HDPA 2M6MA 4BHWA 5FEYA 3KV6A 2E6SA 1WFKA 3N9LA 4IC3A 1JM7A 2L80A 5JG6A 4LK9A 2VPBA 2AN6A 3SOWA 2CSZA 2YYRA 3V43A 4C9ZA 4GB0A 4WZ3B 4YAXA 2F6JA 1WEPA 3LQHA 2YSJA 4Q6FA 3ZPVE 5D1MB 2VPGA 2PUYA 3O37A 2YSMA 4L58A 4YBMA 5C11A 4QF2A 5AIUA 2LXPC 2JMJA 2YT5A 4UP5A 2YW8A 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHN A;  2CKL A;  3N9O A;  1LDK C;  3T7L A;  4YAT A;  1CHC A;  4B86 C;  1WEQ A;  4TKP B;  2KWO A;  5KH3 A;  2K16 A;  4WA6 A;  5TAB A;  3LQJ A;  2I50 A;  2RI7 A;  1WES A;  2QIC A;  4X3G A;  2LN0 A;  2G43 A;  4BBQ A;  2ECI A;  2VPE A;  5D1K B;  3O35 A;  3PHD A;  2KE1 A;  1VD4 A;  3O70 A;  1Z6U A;  3VK6 A;  2C2L A;  2MNZ A;  4MVT A;  1DVP A;  5H1V A;  2LGG A;  4FJC A;  2Y1M A;  4FIP A;  5B78 A;  3ZPV 1;  2ECG A;  2KFT A;  2OXQ C;  2QJ0 A;  3LRQ A;  5C13 A;  2VJE A;  4L7X A;  2F42 A;  4V3L C;  4FK5 A;  2VP7 A;  1T1H A;  4F52 B;  4LJN A;  3M99 A;  2ECJ A;  3PUR A;  2F6N A;  5I3L A;  3GV4 A;  3GL6 A;  1HYI A;  2MD7 B;  1FP0 A;  2YRE A;  3RPG C;  2YU4 A;  2KU3 A;  1WIM A;  5FER A;  2LRI C;  2E6R A;  2PNX A;  5LKX A;  4YAB A;  2JMD A;  4O64 A;  2QIZ A;  5H9M A;  2RSD A;  4YBS A;  2L75 A;  1Z2Q A;  2L43 A;  5B77 A;  5DKA A;  4I7C A;  3RTR B;  2K4D A;  4R2Y A;  2VPD A;  1U6G B;  2MT5 A;  2L0B A;  2EGP A;  4GNF A;  4IC2 A;  1K2F A;  4ZQL A;  5TRB A;  4AYC A;  1WEN A;  2LQ6 A;  2M3H A;  2FUI A;  4UI9 B;  2LGV A;  3KNV A;  3O36 A;  2C2V S;  2YQM A;  2ECT A;  2K17 A;  4GNG A;  2YUR A;  2LV9 A;  3N9Q A;  4N3W A;  3IHP A;  5J3X A;  3L1Z B;  5H1T A;  2VJF B;  5LKZ A;  3N9N A;  4LLB A;  3ZVZ B;  5B79 A;  3DQV R;  2EOD A;  2D8S A;  1WEE A;  2LDR A;  4WZ0 A;  1JOC A;  4AYC B;  3ASL A;  2YHO A;  3ZVY A;  2KIZ A;  2KYU A;  3PUQ A;  4MSX A;  5LCW B;  2Y43 A;  3U5P A;  2KWK A;  4GND A;  2H0D B;  3ZTG A;  1X4U A;  2LGK A;  1V87 A;  3T6R A;  5LKT A;  3SHB A;  1Z60 A;  4GNE A;  2FUU A;  5AIT A;  1FBV A;  5G04 B;  2CKL B;  4A0C D;  2CT2 A;  1WEW A;  3M63 A;  5TDW A;  4S3O C;  2EA6 A;  2NAA A;  5DIN A;  3HCU A;  2ZET C;  4QF3 A;  1BOR A;  2LXH C;  4AVX A;  2YUC A;  4I7D A;  2ECW A;  4A4C A;  2UZG A;  3O7A A;  3SOX A;  3L11 A;  1WEV A;  3MHH A;  4A49 A;  2KWN A;  3DPL R;  4CCG X;  3U5N A;  3U5O A;  2FSA A;  2ECV A;  5B75 A;  4S3O B;  2ECN A;  5H1U A;  1F62 A;  5B76 A;  4P5O B;  4LAD B;  2YQL A;  5KH7 A;  2MA6 A;  5TBN A;  3ZNI A;  5FB0 A;  4UP0 A;  3FL2 A;  3SOU A;  4R7E A;  2KGI A;  2L5U A;  4PTB A;  3MHS A;  2MNY A;  2G45 A;  1G25 A;  3RPG B;  1LDJ B;  4WZ2 A;  2MD8 C;  2BAY A;  5TDR A;  1MM3 A;  3O34 A;  3NG2 A;  5FB1 A;  1VFY A;  4W4U A;  2KWJ A;  4ZUX U;  3C5K A;  1HYJ A;  1WEU A;  5G05 B;  3L1X A;  4NN2 A;  3M62 A;  2HYE D;  2MA5 A;  3C6W A;  5LKU A;  3O33 A;  4A4B A;  4R8P K;  2XEU A;  1WE9 A;  2H0D A;  4N4F A;  4ZDT A;  3EB5 A;  2M1R A;  3KQI A;  4LKA A;  1VYX A;  3LQI A;  2Y1N A;  4YBT A;  2XB1 A;  2JMI A;  1WEM A;  2MIQ A;  1E4U A;  5G0F A;  1X4I A;  2KR4 A;  2VNF A;  1WEO A;  4PPE A;  3I2D A;  2JRJ A;  2KGG A;  4AUQ B;  4YC9 A;  3ZYQ A;  1WIL A;  1XWH A;  2VJE B;  1N87 A;  3QZV A;  3EB6 A;  5KH9 A;  2G6Q A;  1ZBD B;  1JM7 B;  3HCT A;  2DX8 A;  5EYA F;  4B7Y C;  4XI1 A;  4YAD A;  1X4J A;  3HCS A;  3N9P A;  5D1L B;  1MM2 A;  2CSY A;  1WGM A;  3N9M A;  4AP4 A;  2IDA A;  2MUM A;  3HTK C;  2VJF A;  3KV5 A;  2KRE A;  2M85 A;  4I7B A;  3U5M A;  2K1J A;  4CA1 A;  5B8D A;  4FO9 A;  1RMD A;  1IYM A;  2LGL A;  2HDP A;  2M6M A;  4BHW A;  5FEY A;  3KV6 A;  2E6S A;  1WFK A;  3N9L A;  4IC3 A;  1JM7 A;  2L80 A;  5JG6 A;  4LK9 A;  2VPB A;  2AN6 A;  3SOW A;  2CSZ A;  2YYR A;  3V43 A;  4C9Z A;  4GB0 A;  4WZ3 B;  4YAX A;  2F6J A;  1WEP A;  3LQH A;  2YSJ A;  4Q6F A;  3ZPV E;  5D1M B;  2VPG A;  2PUY A;  3O37 A;  2YSM A;  4L58 A;  4YBM A;  5C11 A;  4QF2 A;  5AIU A;  2LXP C;  2JMJ A;  2YT5 A;  4UP5 A;  2YW8 A;  4V3K C; 
#chains in the Genus database with same CATH topology
 2EGM A;  2YHN A;  2XP0 A;  2CKL A;  3N9O A;  1LDK C;  3T7L A;  4YAT A;  1CHC A;  4B86 C;  1WEQ A;  4TKP B;  2XOC A;  2KWO A;  5KH3 A;  2K16 A;  4WA6 A;  5K3Q A;  5TAB A;  3LQJ A;  2I50 A;  2RI7 A;  1WES A;  2QIC A;  3T9K A;  3FJU B;  4X3G A;  2LN0 A;  2G43 A;  2MKE A;  2M13 A;  4BBQ A;  2ECI A;  2VPE A;  5D1K B;  3O35 A;  3PHD A;  2KE1 A;  4H9D A;  1VD4 A;  3O70 A;  1Z6U A;  3VK6 A;  2C2L A;  2MNZ A;  3DDT A;  4MVT A;  3SUB A;  1DVP A;  3FEH A;  3FAN A;  5H1V A;  3PLW A;  2LGG A;  4FJC A;  2Y1M A;  4FIP A;  5B78 A;  3ZPV 1;  2ECG A;  2KFT A;  2OXQ C;  2QJ0 A;  3DWD A;  3LRQ A;  5C13 A;  2VJE A;  4L7X A;  2F42 A;  4V3L C;  4FK5 A;  2VP7 A;  1T1H A;  4F52 B;  4LJN A;  3M99 A;  2ECJ A;  3PUR A;  2F6N A;  2B0O E;  5I3L A;  3GV4 A;  1MBM A;  3GL6 A;  1HYI A;  2MD7 B;  1FP0 A;  2YRE A;  3RPG C;  3KDE C;  2YU4 A;  2KU3 A;  1WIM A;  5FER A;  2LRI C;  4OGE A;  2E6R A;  2PNX A;  5LKX A;  4YAB A;  2JMD A;  4O64 A;  2QIZ A;  5H9M A;  2RSD A;  4YBS A;  2L75 A;  1Z2Q A;  2L43 A;  5B77 A;  5DKA A;  4I7C A;  3RTR B;  2K4D A;  4R2Y A;  3MDB C;  2VPD A;  1U6G B;  2MT5 A;  2L0B A;  2EGP A;  4GNF A;  4IC2 A;  1K2F A;  4ZQL A;  5TRB A;  4AYC A;  1WEN A;  2LQ6 A;  2M3H A;  2FUI A;  4UI9 B;  2LGV A;  3KNV A;  3O36 A;  2C2V S;  2YQM A;  2ECT A;  2K17 A;  4GNG A;  2YUR A;  2LV9 A;  3N9Q A;  4N3W A;  3IHP A;  5J3X A;  3L1Z B;  5H1T A;  2VJF B;  5LKZ A;  3N9N A;  4LLB A;  3ZVZ B;  5B79 A;  3DQV R;  2EOD A;  2D8S A;  4Z0O A;  1WEE A;  2LDR A;  4WZ0 A;  1JOC A;  4AYC B;  3ASL A;  2YHO A;  3ZVY A;  2KIZ A;  2KYU A;  3PUQ A;  4MSX A;  5LCW B;  2Y43 A;  3U5P A;  2KWK A;  4GND A;  2H0D B;  5SVI B;  3ZTG A;  1X4U A;  4Z0R A;  2LGK A;  1V87 A;  3T6R A;  5LKT A;  5SVY A;  3SHB A;  1Z60 A;  4GNE A;  2FUU A;  2YVR A;  5AIT A;  1FBV A;  5G04 B;  2CKL B;  4A0C D;  2CT2 A;  2CON A;  1WEW A;  3M63 A;  5TDW A;  4S3O C;  2EA6 A;  2NAA A;  5DIN A;  3HCU A;  2ZET C;  4QF3 A;  1BOR A;  2LXH C;  4AVX A;  2YUC A;  4I7D A;  2ECW A;  4F1P A;  4A4C A;  2LAU A;  3FAO A;  2UZG A;  3O7A A;  5SVX A;  3SOX A;  3L11 A;  1WEV A;  3MHH A;  4A49 A;  2KWN A;  3DPL R;  4CCG X;  3U5N A;  3U5O A;  2FSA A;  2DSM A;  2ECV A;  3JUE A;  5B75 A;  2EXU A;  2P57 A;  4S3O B;  2ECN A;  5H1U A;  1F62 A;  2FFW A;  5B76 A;  4P5O B;  4LAD B;  2YQL A;  5KH7 A;  2MA6 A;  5TBN A;  3ZNI A;  5FB0 A;  4UP0 A;  3FL2 A;  3SOU A;  4R7E A;  2OWA A;  2KGI A;  2E61 A;  2L5U A;  4PTB A;  2KKY A;  3MHS A;  2MNY A;  2G45 A;  1G25 A;  3RPG B;  1LDJ B;  4WZ2 A;  2MD8 C;  2BAY A;  5TDR A;  1MM3 A;  3O34 A;  3NG2 A;  5FB1 A;  1VFY A;  4W4U A;  4O62 A;  2L7P A;  2KWJ A;  4ZUX U;  3C5K A;  1HYJ A;  1WEU A;  5G05 B;  3L1X A;  2CRW A;  4NN2 A;  3M62 A;  2FD4 A;  3E2D A;  2HYE D;  2MA5 A;  3C6W A;  5LKU A;  2KKX A;  3O33 A;  2DJA A;  4A4B A;  4R8P K;  2XEU A;  1WE9 A;  2H0D A;  4N4F A;  4ZDT A;  5SVI A;  3LDY A;  3EB5 A;  2M1R A;  3KQI A;  4LKA A;  1VYX A;  3LQI A;  2Y1N A;  4YBT A;  2XB1 A;  2JMI A;  1WEM A;  2MIQ A;  1E4U A;  5G0F A;  1X4I A;  2KR4 A;  3H7H A;  2VNF A;  3O47 A;  1WEO A;  4PPE A;  3I2D A;  2JRJ A;  2KGG A;  4AUQ B;  2CSV A;  4YC9 A;  3ZYQ A;  1WIL A;  4QQ4 A;  1XWH A;  2VJE B;  1N87 A;  3QZV A;  3EB6 A;  5KH9 A;  2G6Q A;  1ZBD B;  1JM7 B;  3HCT A;  2DX8 A;  5EYA F;  3LVR E;  4B7Y C;  1DCQ A;  4XI1 A;  4YAD A;  1X4J A;  3HCS A;  3N9P A;  5D1L B;  1MM2 A;  2CSY A;  1WGM A;  2D8U A;  3N9M A;  4AP4 A;  2CRR A;  2IQJ A;  2IDA A;  2MUM A;  3HTK C;  3FM8 C;  2VJF A;  3KV5 A;  2KRE A;  2M85 A;  4I7B A;  3U5M A;  2K1J A;  4CA1 A;  5B8D A;  4FO9 A;  1RMD A;  1IYM A;  2LGL A;  2HDP A;  3LVQ E;  2M6M A;  2RR4 A;  4BHW A;  5FEY A;  3KV6 A;  2E6S A;  2JUN A;  1WFK A;  3N9L A;  4IC3 A;  1JM7 A;  2L80 A;  5JG6 A;  4LK9 A;  2VPB A;  2AN6 A;  3SOW A;  2CSZ A;  3Q1D A;  2YYR A;  3LJU X;  3V43 A;  4C9Z A;  4GB0 A;  2XOZ A;  3M7K A;  4WZ3 B;  4YAX A;  2XOY A;  4OGC A;  2F6J A;  1WEP A;  3LQH A;  2YSJ A;  4Q6F A;  5D1M B;  3ZPV E;  2VPG A;  2PUY A;  3O37 A;  2JM3 A;  2YSM A;  4L58 A;  4YBM A;  5C11 A;  4QF2 A;  5AIU A;  2LXP C;  2JMJ A;  2YT5 A;  4UP5 A;  2YW8 A;  4V3K C; 
#chains in the Genus database with same CATH homology
 2YHN A;  2CKL A;  3N9O A;  1LDK C;  3T7L A;  4YAT A;  1CHC A;  4B86 C;  1WEQ A;  4TKP B;  2KWO A;  5KH3 A;  2K16 A;  4WA6 A;  5TAB A;  3LQJ A;  2I50 A;  2RI7 A;  1WES A;  2QIC A;  4X3G A;  2LN0 A;  2G43 A;  4BBQ A;  2ECI A;  2VPE A;  5D1K B;  3O35 A;  3PHD A;  2KE1 A;  1VD4 A;  3O70 A;  1Z6U A;  3VK6 A;  2C2L A;  2MNZ A;  4MVT A;  1DVP A;  5H1V A;  2LGG A;  4FJC A;  2Y1M A;  4FIP A;  5B78 A;  3ZPV 1;  2ECG A;  2KFT A;  2OXQ C;  2QJ0 A;  3LRQ A;  5C13 A;  2VJE A;  4L7X A;  2F42 A;  4V3L C;  4FK5 A;  2VP7 A;  1T1H A;  4F52 B;  4LJN A;  3M99 A;  2ECJ A;  3PUR A;  2F6N A;  5I3L A;  3GV4 A;  3GL6 A;  1HYI A;  2MD7 B;  1FP0 A;  2YRE A;  3RPG C;  2YU4 A;  2KU3 A;  1WIM A;  5FER A;  2LRI C;  2E6R A;  2PNX A;  5LKX A;  4YAB A;  2JMD A;  4O64 A;  2QIZ A;  5H9M A;  2RSD A;  4YBS A;  2L75 A;  1Z2Q A;  2L43 A;  5B77 A;  5DKA A;  4I7C A;  3RTR B;  2K4D A;  4R2Y A;  2VPD A;  1U6G B;  2MT5 A;  2L0B A;  2EGP A;  4GNF A;  4IC2 A;  1K2F A;  4ZQL A;  5TRB A;  4AYC A;  1WEN A;  2LQ6 A;  2M3H A;  2FUI A;  4UI9 B;  2LGV A;  3KNV A;  3O36 A;  2C2V S;  2YQM A;  2ECT A;  2K17 A;  4GNG A;  2YUR A;  2LV9 A;  3N9Q A;  4N3W A;  3IHP A;  5J3X A;  3L1Z B;  5H1T A;  2VJF B;  5LKZ A;  3N9N A;  4LLB A;  3ZVZ B;  5B79 A;  3DQV R;  2EOD A;  2D8S A;  1WEE A;  2LDR A;  4WZ0 A;  1JOC A;  4AYC B;  3ASL A;  2YHO A;  3ZVY A;  2KIZ A;  2KYU A;  3PUQ A;  4MSX A;  5LCW B;  2Y43 A;  3U5P A;  2KWK A;  4GND A;  2H0D B;  3ZTG A;  1X4U A;  2LGK A;  1V87 A;  3T6R A;  5LKT A;  3SHB A;  1Z60 A;  4GNE A;  2FUU A;  5AIT A;  1FBV A;  5G04 B;  2CKL B;  4A0C D;  2CT2 A;  1WEW A;  3M63 A;  5TDW A;  4S3O C;  2EA6 A;  2NAA A;  5DIN A;  3HCU A;  2ZET C;  4QF3 A;  1BOR A;  2LXH C;  4AVX A;  2YUC A;  4I7D A;  2ECW A;  4A4C A;  2UZG A;  3O7A A;  3SOX A;  3L11 A;  1WEV A;  3MHH A;  4A49 A;  2KWN A;  3DPL R;  4CCG X;  3U5N A;  3U5O A;  2FSA A;  2ECV A;  5B75 A;  4S3O B;  2ECN A;  5H1U A;  1F62 A;  5B76 A;  4P5O B;  4LAD B;  2YQL A;  5KH7 A;  2MA6 A;  5TBN A;  3ZNI A;  5FB0 A;  4UP0 A;  3FL2 A;  3SOU A;  4R7E A;  2KGI A;  2L5U A;  4PTB A;  3MHS A;  2MNY A;  2G45 A;  1G25 A;  3RPG B;  1LDJ B;  4WZ2 A;  2MD8 C;  2BAY A;  5TDR A;  1MM3 A;  3O34 A;  3NG2 A;  5FB1 A;  1VFY A;  4W4U A;  2KWJ A;  4ZUX U;  3C5K A;  1HYJ A;  1WEU A;  5G05 B;  3L1X A;  4NN2 A;  3M62 A;  2HYE D;  2MA5 A;  3C6W A;  5LKU A;  3O33 A;  4A4B A;  4R8P K;  2XEU A;  1WE9 A;  2H0D A;  4N4F A;  4ZDT A;  3EB5 A;  2M1R A;  3KQI A;  4LKA A;  1VYX A;  3LQI A;  2Y1N A;  4YBT A;  2XB1 A;  2JMI A;  1WEM A;  2MIQ A;  1E4U A;  5G0F A;  1X4I A;  2KR4 A;  2VNF A;  1WEO A;  4PPE A;  3I2D A;  2JRJ A;  2KGG A;  4AUQ B;  4YC9 A;  3ZYQ A;  1WIL A;  1XWH A;  2VJE B;  1N87 A;  3QZV A;  3EB6 A;  5KH9 A;  2G6Q A;  1ZBD B;  1JM7 B;  3HCT A;  2DX8 A;  5EYA F;  4B7Y C;  4XI1 A;  4YAD A;  1X4J A;  3HCS A;  3N9P A;  5D1L B;  1MM2 A;  2CSY A;  1WGM A;  3N9M A;  4AP4 A;  2IDA A;  2MUM A;  3HTK C;  2VJF A;  3KV5 A;  2KRE A;  2M85 A;  4I7B A;  3U5M A;  2K1J A;  4CA1 A;  5B8D A;  4FO9 A;  1RMD A;  1IYM A;  2LGL A;  2HDP A;  2M6M A;  4BHW A;  5FEY A;  3KV6 A;  2E6S A;  1WFK A;  3N9L A;  4IC3 A;  1JM7 A;  2L80 A;  5JG6 A;  4LK9 A;  2VPB A;  2AN6 A;  3SOW A;  2CSZ A;  2YYR A;  3V43 A;  4C9Z A;  4GB0 A;  4WZ3 B;  4YAX A;  2F6J A;  1WEP A;  3LQH A;  2YSJ A;  4Q6F A;  3ZPV E;  5D1M B;  2VPG A;  2PUY A;  3O37 A;  2YSM A;  4L58 A;  4YBM A;  5C11 A;  4QF2 A;  5AIU A;  2LXP C;  2JMJ A;  2YT5 A;  4UP5 A;  2YW8 A;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...