1WEOA

Solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
GSSGSSGPKPLKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEEDIDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulose synthase, catalytic subunit (IRX3)
publication title Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 7
structure length 93
sequence length 93
ec nomenclature ec 2.4.1.12: Cellulose synthase (UDP-forming).
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14569 zf-UDP Zinc-binding RING-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weoA00
1Z6UA 2EODA 4LK9A 5G04B 2VPEA 3PHDA 3T7LA 2MA6A 2LN0A 1X4JA 2K1JA 1K2FA 3ZVZB 1JOCA 2H0DB 3N9MA 3EB5A 1WEOA 2MNYA 3FL2A 5D1MB 2E6RA 2ECNA 2NAAA 1WENA 4MVTA 1HYJA 1IYMA 2RI7A 5C13A 2MA5A 1ZBDB 4Q6FA 3SOXA 4FIPA 2ECIA 2YT5A 2FUUA 2I50A 5B75A 2LGGA 5LCWB 2M3HA 3U5MA 1HYIA 2MUMA 4QF3A 4X3GA 2VJFB 3C6WA 4C9ZA 3SHBA 2KGIA 2ECTA 4YAXA 4V3KC 2G6QA 1WFKA 3M62A 3O36A 4YADA 2ECWA 2YHNA 2YQLA 5H1VA 2YSMA 4R8PK 3O37A 1X4IA 2MT5A 2LV9A 2LGLA 5FERA 3N9NA 3U5PA 2LDRA 1F62A 4AVXA 3O33A 4BHWA 2F6JA 2KR4A 4PPEA 4L58A 2L75A 4LKAA 2QJ0A 2L5UA 4YBMA 4AP4A 4A49A 3RTRB 2MD7B 4WZ0A 3RPGB 3N9LA 2KFTA 1Z60A 2KYUA 3KV6A 1X4UA 3O7AA 2RSDA 4V3LC 2HDPA 3IHPA 2EA6A 1WE9A 2VP7A 3LQHA 4YBSA 2ZETC 2K4DA 3O34A 1VYXA 3ZTGA 2M6MA 5LKXA 2VPGA 4B7YC 2JMIA 1CHCA 1MM2A 4S3OB 2H0DA 1WESA 2BAYA 5TDWA 4I7CA 2G45A 3GL6A 3KQIA 3VK6A 3L11A 3QZVA 4WZ3B 3LQIA 3N9QA 4NN2A 2CSYA 3HCTA 3N9PA 3HCSA 2Y43A 5D1KB 4ZDTA 4CA1A 2UZGA 2YW8A 3DPLR 5AIUA 3ZPV1 4GB0A 1XWHA 5H1UA 3O70A 2YYRA 2JRJA 2OXQC 1FBVA 5C11A 2G43A 5B77A 5KH3A 4R2YA 3U5NA 2IDAA 3ZVYA 2YUCA 3RPGC 5B79A 4GNEA 2KIZA 2KREA 2C2VS 4IC2A 4UI9B 2VJFA 2CKLB 5EYAF 4LJNA 1JM7B 2ECJA 1Z2QA 5LKZA 1DVPA 2LGVA 3N9OA 3PURA 2L0BA 4YABA 2CT2A 2AN6A 4XI1A 4F52B 2MD8C 2Y1NA 4LLBA 2DX8A 3DQVR 2KWJA 2PNXA 2F42A 2QICA 2YSJA 2YREA 2JMJA 1VD4A 4MSXA 4AYCB 3HTKC 2KE1A 1V87A 2LRIC 2MNZA 3U5OA 3T6RA 5AITA 3ZYQA 2L80A 2F6NA 2VJEB 2JMDA 5TABA 2EGPA 1WEVA 2VPDA 1U6GB 4UP0A 2YURA 4BBQA 3ZPVE 4A4CA 5LKTA 1MM3A 3LQJA 4R7EA 2D8SA 1WEPA 2LQ6A 5JG6A 3M99A 2E6SA 4GNFA 3SOUA 1N87A 1RMDA 5FB1A 5TRBA 5B78A 5H1TA 3L1XA 4A4BA 5I3LA 4WZ2A 1VFYA 1WEEA 3GV4A 2LXHC 2MIQA 2YQMA 3M63A 4YC9A 3NG2A 5H9MA 2M85A 2QIZA 2YU4A 4GNDA 5KH7A 1WEUA 5KH9A 3KV5A 4GNGA 2KWOA 2FSAA 2ECGA 2VNFA 2L43A 1E4UA 5DINA 5B76A 2K16A 3O35A 4IC3A 1BORA 3MHSA 5FB0A 4AUQB 2CSZA 4A0CD 5D1LB 1LDKC 3ASLA 5TBNA 5J3XA 2VPBA 4QF2A 1WEQA 4FO9A 2PUYA 2KU3A 5FEYA 2XB1A 2LGKA 2CKLA 4B86C 1JM7A 3PUQA 1WEMA 3I2DA 5DKAA 5G05B 2KGGA 2M1RA 4UP5A 3C5KA 1WIMA 3MHHA 1T1HA 4S3OC 4CCGX 2KWNA 2Y1MA 4O64A 4FK5A 1WGMA 4TKPB 1G25A 2K17A 1WEWA 4P5OB 4ZQLA 2KWKA 2FUIA 3KNVA 3V43A 1WILA 2HYED 4LADB 4N4FA 4ZUXU 5G0FA 5TDRA 2LXPC 4AYCA 4N3WA 5B8DA 3EB6A 1FP0A 3HCUA 4L7XA 5LKUA 4PTBA 4YBTA 2C2LA 2VJEA 2XEUA 4FJCA 3SOWA 4I7BA 2ECVA 4W4UA 4WA6A 3ZNIA 3L1ZB 1LDJB 2YHOA 4I7DA 4YATA 3LRQA
chains in the Genus database with same CATH superfamily
1Z6UA 2EODA 4LK9A 5G04B 2VPEA 3PHDA 3T7LA 2MA6A 2LN0A 1X4JA 2K1JA 1K2FA 3ZVZB 1JOCA 2H0DB 3N9MA 1MBMA 3EB5A 2P57A 1WEOA 2MNYA 3KDEC 3FL2A 5D1MB 2E6RA 2ECNA 2NAAA 1WENA 4MVTA 1HYJA 1IYMA 2RI7A 5C13A 2MA5A 1ZBDB 4Q6FA 3FAOA 3SOXA 4FIPA 2ECIA 2YT5A 4F1PA 2FUUA 2M13A 2I50A 5B75A 2LGGA 5LCWB 2M3HA 2XOYA 3U5MA 1HYIA 1DCQA 2CRWA 2MUMA 4QF3A 4X3GA 2JM3A 2VJFB 3C6WA 4C9ZA 3SHBA 3FJUB 2KGIA 4O62A 2ECTA 4YAXA 4V3KC 2G6QA 1WFKA 3M62A 3O36A 4YADA 2ECWA 2YHNA 2YQLA 5H1VA 2YSMA 4R8PK 3O37A 1X4IA 2MT5A 2LV9A 2LGLA 3FANA 5FERA 3N9NA 3U5PA 2LDRA 1F62A 4AVXA 3O33A 4BHWA 2F6JA 2KR4A 4PPEA 4L58A 2L75A 4LKAA 2QJ0A 2L5UA 4YBMA 4AP4A 2DJAA 4A49A 3RTRB 2MD7B 4WZ0A 3RPGB 3N9LA 2KFTA 1Z60A 2KYUA 3KV6A 2OWAA 1X4UA 3O7AA 2RSDA 2XP0A 4V3LC 2HDPA 3IHPA 2EA6A 1WE9A 2VP7A 3JUEA 5SVIB 2XOCA 3LQHA 2B0OE 4YBSA 2ZETC 2K4DA 3O34A 1VYXA 3MDBC 2YVRA 3ZTGA 2M6MA 5LKXA 2VPGA 4B7YC 3LDYA 2JMIA 1CHCA 1MM2A 4S3OB 2H0DA 1WESA 2BAYA 5TDWA 4I7CA 4QQ4A 2G45A 3O47A 3GL6A 3KQIA 3VK6A 3L11A 3QZVA 4WZ3B 3LQIA 3N9QA 2EGMA 4NN2A 2CSYA 3HCTA 3LVQE 3N9PA 3HCSA 2Y43A 4H9DA 5D1KB 4ZDTA 4CA1A 2UZGA 2YW8A 3DPLR 3Q1DA 5AIUA 3ZPV1 4GB0A 1XWHA 5H1UA 3O70A 2YYRA 2JRJA 2OXQC 1FBVA 5K3QA 2G43A 5C11A 5B77A 5KH3A 4R2YA 5SVYA 3U5NA 2IDAA 2MKEA 3ZVYA 2E61A 2YUCA 3RPGC 5SVXA 5B79A 4GNEA 2KIZA 2KREA 3PLWA 2C2VS 4IC2A 4UI9B 2VJFA 2CKLB 5EYAF 4LJNA 1JM7B 2ECJA 1Z2QA 4OGCA 5LKZA 1DVPA 2LGVA 3N9OA 3PURA 2L0BA 4YABA 2CT2A 2AN6A 3DWDA 4XI1A 3FM8C 4F52B 2MD8C 2Y1NA 4LLBA 2DX8A 3DQVR 2KWJA 2PNXA 2F42A 4Z0RA 2DSMA 2QICA 2YSJA 2YREA 2JUNA 2JMJA 1VD4A 4MSXA 4Z0OA 4AYCB 3HTKC 2KE1A 1V87A 2LRIC 2MNZA 3U5OA 3T6RA 5AITA 2EXUA 3ZYQA 2L80A 2F6NA 2VJEB 2JMDA 2XOZA 5TABA 2EGPA 1WEVA 2VPDA 1U6GB 4UP0A 2YURA 4BBQA 3ZPVE 4A4CA 5LKTA 1MM3A 3LQJA 4R7EA 2D8SA 1WEPA 2LQ6A 2KKXA 5JG6A 2FFWA 3M99A 2E6SA 4GNFA 3SOUA 5SVIA 1N87A 1RMDA 5FB1A 5TRBA 5B78A 5H1TA 3L1XA 4A4BA 5I3LA 4WZ2A 1VFYA 1WEEA 2IQJA 3LVRE 3GV4A 3SUBA 2LXHC 2MIQA 2YQMA 2RR4A 3M63A 4YC9A 3NG2A 5H9MA 2M85A 2QIZA 2CRRA 2YU4A 4GNDA 3H7HA 3DDTA 5KH7A 1WEUA 5KH9A 3KV5A 4GNGA 2KWOA 2FSAA 2ECGA 2VNFA 2L43A 1E4UA 5DINA 5B76A 2K16A 3O35A 4IC3A 1BORA 3MHSA 5FB0A 2CSVA 3E2DA 4AUQB 2CSZA 4A0CD 2CONA 5D1LB 1LDKC 2FD4A 3ASLA 5TBNA 5J3XA 2VPBA 4QF2A 1WEQA 4FO9A 2PUYA 2KU3A 5FEYA 2XB1A 2LGKA 2CKLA 4OGEA 4B86C 1JM7A 3PUQA 1WEMA 3I2DA 5DKAA 2KGGA 5G05B 2M1RA 4UP5A 3C5KA 1WIMA 2D8UA 3MHHA 1T1HA 4S3OC 4CCGX 2KWNA 2Y1MA 4O64A 4FK5A 1WGMA 4TKPB 1G25A 2K17A 1WEWA 4P5OB 4ZQLA 2KWKA 2FUIA 3KNVA 3V43A 1WILA 2HYED 4LADB 4N4FA 4ZUXU 5G0FA 5TDRA 2LXPC 2L7PA 3FEHA 4N3WA 4AYCA 5B8DA 3EB6A 1FP0A 3HCUA 4L7XA 3T9KA 5LKUA 4PTBA 4YBTA 2C2LA 3LJUX 2VJEA 2XEUA 4FJCA 3SOWA 4I7BA 2ECVA 4W4UA 4WA6A 3ZNIA 2KKYA 3L1ZB 3M7KA 1LDJB 2LAUA 2YHOA 4I7DA 4YATA 3LRQA
chains in the Genus database with same CATH topology
1Z6UA 2EODA 4LK9A 5G04B 2VPEA 3PHDA 3T7LA 2MA6A 2LN0A 1X4JA 2K1JA 1K2FA 3ZVZB 1JOCA 2H0DB 3N9MA 3EB5A 1WEOA 2MNYA 3FL2A 5D1MB 2E6RA 2ECNA 2NAAA 1WENA 4MVTA 1HYJA 1IYMA 2RI7A 5C13A 2MA5A 1ZBDB 4Q6FA 3SOXA 4FIPA 2ECIA 2YT5A 2FUUA 2I50A 5B75A 2LGGA 5LCWB 2M3HA 3U5MA 1HYIA 2MUMA 4QF3A 4X3GA 2VJFB 3C6WA 4C9ZA 3SHBA 2KGIA 2ECTA 4YAXA 4V3KC 2G6QA 1WFKA 3M62A 3O36A 4YADA 2ECWA 2YHNA 2YQLA 5H1VA 2YSMA 4R8PK 3O37A 1X4IA 2MT5A 2LV9A 2LGLA 5FERA 3N9NA 3U5PA 2LDRA 1F62A 4AVXA 3O33A 4BHWA 2F6JA 2KR4A 4PPEA 4L58A 2L75A 4LKAA 2QJ0A 2L5UA 4YBMA 4AP4A 4A49A 3RTRB 2MD7B 4WZ0A 3RPGB 3N9LA 2KFTA 1Z60A 2KYUA 3KV6A 1X4UA 3O7AA 2RSDA 4V3LC 2HDPA 3IHPA 2EA6A 1WE9A 2VP7A 3LQHA 4YBSA 2ZETC 2K4DA 3O34A 1VYXA 3ZTGA 2M6MA 5LKXA 2VPGA 4B7YC 2JMIA 1CHCA 1MM2A 4S3OB 2H0DA 1WESA 2BAYA 5TDWA 4I7CA 2G45A 3GL6A 3KQIA 3VK6A 3L11A 3QZVA 4WZ3B 3LQIA 3N9QA 4NN2A 2CSYA 3HCTA 3N9PA 3HCSA 2Y43A 5D1KB 4ZDTA 4CA1A 2UZGA 2YW8A 3DPLR 5AIUA 3ZPV1 4GB0A 1XWHA 5H1UA 3O70A 2YYRA 2JRJA 2OXQC 1FBVA 5C11A 2G43A 5B77A 5KH3A 4R2YA 3U5NA 2IDAA 3ZVYA 2YUCA 3RPGC 5B79A 4GNEA 2KIZA 2KREA 2C2VS 4IC2A 4UI9B 2VJFA 2CKLB 5EYAF 4LJNA 1JM7B 2ECJA 1Z2QA 5LKZA 1DVPA 2LGVA 3N9OA 3PURA 2L0BA 4YABA 2CT2A 2AN6A 4XI1A 4F52B 2MD8C 2Y1NA 4LLBA 2DX8A 3DQVR 2KWJA 2PNXA 2F42A 2QICA 2YSJA 2YREA 2JMJA 1VD4A 4MSXA 4AYCB 3HTKC 2KE1A 1V87A 2LRIC 2MNZA 3U5OA 3T6RA 5AITA 3ZYQA 2L80A 2F6NA 2VJEB 2JMDA 5TABA 2EGPA 1WEVA 2VPDA 1U6GB 4UP0A 2YURA 4BBQA 3ZPVE 4A4CA 5LKTA 1MM3A 3LQJA 4R7EA 2D8SA 1WEPA 2LQ6A 5JG6A 3M99A 2E6SA 4GNFA 3SOUA 1N87A 1RMDA 5FB1A 5TRBA 5B78A 5H1TA 3L1XA 4A4BA 5I3LA 4WZ2A 1VFYA 1WEEA 3GV4A 2LXHC 2MIQA 2YQMA 3M63A 4YC9A 3NG2A 5H9MA 2M85A 2QIZA 2YU4A 4GNDA 5KH7A 1WEUA 5KH9A 3KV5A 4GNGA 2KWOA 2FSAA 2ECGA 2VNFA 2L43A 1E4UA 5DINA 5B76A 2K16A 3O35A 4IC3A 1BORA 3MHSA 5FB0A 4AUQB 2CSZA 4A0CD 5D1LB 1LDKC 3ASLA 5TBNA 5J3XA 2VPBA 4QF2A 1WEQA 4FO9A 2PUYA 2KU3A 5FEYA 2XB1A 2LGKA 2CKLA 4B86C 1JM7A 3PUQA 1WEMA 3I2DA 5DKAA 5G05B 2KGGA 2M1RA 4UP5A 3C5KA 1WIMA 3MHHA 1T1HA 4S3OC 4CCGX 2KWNA 2Y1MA 4O64A 4FK5A 1WGMA 4TKPB 1G25A 2K17A 1WEWA 4P5OB 4ZQLA 2KWKA 2FUIA 3KNVA 3V43A 1WILA 2HYED 4LADB 4N4FA 4ZUXU 5G0FA 5TDRA 2LXPC 4AYCA 4N3WA 5B8DA 3EB6A 1FP0A 3HCUA 4L7XA 5LKUA 4PTBA 4YBTA 2C2LA 2VJEA 2XEUA 4FJCA 3SOWA 4I7BA 2ECVA 4W4UA 4WA6A 3ZNIA 3L1ZB 1LDJB 2YHOA 4I7DA 4YATA 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6U A;  2EOD A;  4LK9 A;  5G04 B;  2VPE A;  3PHD A;  3T7L A;  2MA6 A;  2LN0 A;  1X4J A;  2K1J A;  1K2F A;  3ZVZ B;  1JOC A;  2H0D B;  3N9M A;  3EB5 A;  1WEO A;  2MNY A;  3FL2 A;  5D1M B;  2E6R A;  2ECN A;  2NAA A;  1WEN A;  4MVT A;  1HYJ A;  1IYM A;  2RI7 A;  5C13 A;  2MA5 A;  1ZBD B;  4Q6F A;  3SOX A;  4FIP A;  2ECI A;  2YT5 A;  2FUU A;  2I50 A;  5B75 A;  2LGG A;  5LCW B;  2M3H A;  3U5M A;  1HYI A;  2MUM A;  4QF3 A;  4X3G A;  2VJF B;  3C6W A;  4C9Z A;  3SHB A;  2KGI A;  2ECT A;  4YAX A;  4V3K C;  2G6Q A;  1WFK A;  3M62 A;  3O36 A;  4YAD A;  2ECW A;  2YHN A;  2YQL A;  5H1V A;  2YSM A;  4R8P K;  3O37 A;  1X4I A;  2MT5 A;  2LV9 A;  2LGL A;  5FER A;  3N9N A;  3U5P A;  2LDR A;  1F62 A;  4AVX A;  3O33 A;  4BHW A;  2F6J A;  2KR4 A;  4PPE A;  4L58 A;  2L75 A;  4LKA A;  2QJ0 A;  2L5U A;  4YBM A;  4AP4 A;  4A49 A;  3RTR B;  2MD7 B;  4WZ0 A;  3RPG B;  3N9L A;  2KFT A;  1Z60 A;  2KYU A;  3KV6 A;  1X4U A;  3O7A A;  2RSD A;  4V3L C;  2HDP A;  3IHP A;  2EA6 A;  1WE9 A;  2VP7 A;  3LQH A;  4YBS A;  2ZET C;  2K4D A;  3O34 A;  1VYX A;  3ZTG A;  2M6M A;  5LKX A;  2VPG A;  4B7Y C;  2JMI A;  1CHC A;  1MM2 A;  4S3O B;  2H0D A;  1WES A;  2BAY A;  5TDW A;  4I7C A;  2G45 A;  3GL6 A;  3KQI A;  3VK6 A;  3L11 A;  3QZV A;  4WZ3 B;  3LQI A;  3N9Q A;  4NN2 A;  2CSY A;  3HCT A;  3N9P A;  3HCS A;  2Y43 A;  5D1K B;  4ZDT A;  4CA1 A;  2UZG A;  2YW8 A;  3DPL R;  5AIU A;  3ZPV 1;  4GB0 A;  1XWH A;  5H1U A;  3O70 A;  2YYR A;  2JRJ A;  2OXQ C;  1FBV A;  5C11 A;  2G43 A;  5B77 A;  5KH3 A;  4R2Y A;  3U5N A;  2IDA A;  3ZVY A;  2YUC A;  3RPG C;  5B79 A;  4GNE A;  2KIZ A;  2KRE A;  2C2V S;  4IC2 A;  4UI9 B;  2VJF A;  2CKL B;  5EYA F;  4LJN A;  1JM7 B;  2ECJ A;  1Z2Q A;  5LKZ A;  1DVP A;  2LGV A;  3N9O A;  3PUR A;  2L0B A;  4YAB A;  2CT2 A;  2AN6 A;  4XI1 A;  4F52 B;  2MD8 C;  2Y1N A;  4LLB A;  2DX8 A;  3DQV R;  2KWJ A;  2PNX A;  2F42 A;  2QIC A;  2YSJ A;  2YRE A;  2JMJ A;  1VD4 A;  4MSX A;  4AYC B;  3HTK C;  2KE1 A;  1V87 A;  2LRI C;  2MNZ A;  3U5O A;  3T6R A;  5AIT A;  3ZYQ A;  2L80 A;  2F6N A;  2VJE B;  2JMD A;  5TAB A;  2EGP A;  1WEV A;  2VPD A;  1U6G B;  4UP0 A;  2YUR A;  4BBQ A;  3ZPV E;  4A4C A;  5LKT A;  1MM3 A;  3LQJ A;  4R7E A;  2D8S A;  1WEP A;  2LQ6 A;  5JG6 A;  3M99 A;  2E6S A;  4GNF A;  3SOU A;  1N87 A;  1RMD A;  5FB1 A;  5TRB A;  5B78 A;  5H1T A;  3L1X A;  4A4B A;  5I3L A;  4WZ2 A;  1VFY A;  1WEE A;  3GV4 A;  2LXH C;  2MIQ A;  2YQM A;  3M63 A;  4YC9 A;  3NG2 A;  5H9M A;  2M85 A;  2QIZ A;  2YU4 A;  4GND A;  5KH7 A;  1WEU A;  5KH9 A;  3KV5 A;  4GNG A;  2KWO A;  2FSA A;  2ECG A;  2VNF A;  2L43 A;  1E4U A;  5DIN A;  5B76 A;  2K16 A;  3O35 A;  4IC3 A;  1BOR A;  3MHS A;  5FB0 A;  4AUQ B;  2CSZ A;  4A0C D;  5D1L B;  1LDK C;  3ASL A;  5TBN A;  5J3X A;  2VPB A;  4QF2 A;  1WEQ A;  4FO9 A;  2PUY A;  2KU3 A;  5FEY A;  2XB1 A;  2LGK A;  2CKL A;  4B86 C;  1JM7 A;  3PUQ A;  1WEM A;  3I2D A;  5DKA A;  5G05 B;  2KGG A;  2M1R A;  4UP5 A;  3C5K A;  1WIM A;  3MHH A;  1T1H A;  4S3O C;  4CCG X;  2KWN A;  2Y1M A;  4O64 A;  4FK5 A;  1WGM A;  4TKP B;  1G25 A;  2K17 A;  1WEW A;  4P5O B;  4ZQL A;  2KWK A;  2FUI A;  3KNV A;  3V43 A;  1WIL A;  2HYE D;  4LAD B;  4N4F A;  4ZUX U;  5G0F A;  5TDR A;  2LXP C;  4AYC A;  4N3W A;  5B8D A;  3EB6 A;  1FP0 A;  3HCU A;  4L7X A;  5LKU A;  4PTB A;  4YBT A;  2C2L A;  2VJE A;  2XEU A;  4FJC A;  3SOW A;  4I7B A;  2ECV A;  4W4U A;  4WA6 A;  3ZNI A;  3L1Z B;  1LDJ B;  2YHO A;  4I7D A;  4YAT A;  3LRQ A; 
#chains in the Genus database with same CATH topology
 1Z6U A;  2EOD A;  4LK9 A;  5G04 B;  2VPE A;  3PHD A;  3T7L A;  2MA6 A;  2LN0 A;  1X4J A;  2K1J A;  1K2F A;  3ZVZ B;  1JOC A;  2H0D B;  3N9M A;  1MBM A;  3EB5 A;  2P57 A;  1WEO A;  2MNY A;  3KDE C;  3FL2 A;  5D1M B;  2E6R A;  2ECN A;  2NAA A;  1WEN A;  4MVT A;  1HYJ A;  1IYM A;  2RI7 A;  5C13 A;  2MA5 A;  1ZBD B;  4Q6F A;  3FAO A;  3SOX A;  4FIP A;  2ECI A;  2YT5 A;  4F1P A;  2FUU A;  2M13 A;  2I50 A;  5B75 A;  2LGG A;  5LCW B;  2M3H A;  2XOY A;  3U5M A;  1HYI A;  1DCQ A;  2CRW A;  2MUM A;  4QF3 A;  4X3G A;  2JM3 A;  2VJF B;  3C6W A;  4C9Z A;  3SHB A;  3FJU B;  2KGI A;  4O62 A;  2ECT A;  4YAX A;  4V3K C;  2G6Q A;  1WFK A;  3M62 A;  3O36 A;  4YAD A;  2ECW A;  2YHN A;  2YQL A;  5H1V A;  2YSM A;  4R8P K;  3O37 A;  1X4I A;  2MT5 A;  2LV9 A;  2LGL A;  3FAN A;  5FER A;  3N9N A;  3U5P A;  2LDR A;  1F62 A;  4AVX A;  3O33 A;  4BHW A;  2F6J A;  2KR4 A;  4PPE A;  4L58 A;  2L75 A;  4LKA A;  2QJ0 A;  2L5U A;  4YBM A;  4AP4 A;  2DJA A;  4A49 A;  3RTR B;  2MD7 B;  4WZ0 A;  3RPG B;  3N9L A;  2KFT A;  1Z60 A;  2KYU A;  3KV6 A;  2OWA A;  1X4U A;  3O7A A;  2RSD A;  2XP0 A;  4V3L C;  2HDP A;  3IHP A;  2EA6 A;  1WE9 A;  2VP7 A;  3JUE A;  5SVI B;  2XOC A;  3LQH A;  2B0O E;  4YBS A;  2ZET C;  2K4D A;  3O34 A;  1VYX A;  3MDB C;  2YVR A;  3ZTG A;  2M6M A;  5LKX A;  2VPG A;  4B7Y C;  3LDY A;  2JMI A;  1CHC A;  1MM2 A;  4S3O B;  2H0D A;  1WES A;  2BAY A;  5TDW A;  4I7C A;  4QQ4 A;  2G45 A;  3O47 A;  3GL6 A;  3KQI A;  3VK6 A;  3L11 A;  3QZV A;  4WZ3 B;  3LQI A;  3N9Q A;  2EGM A;  4NN2 A;  2CSY A;  3HCT A;  3LVQ E;  3N9P A;  3HCS A;  2Y43 A;  4H9D A;  5D1K B;  4ZDT A;  4CA1 A;  2UZG A;  2YW8 A;  3DPL R;  3Q1D A;  5AIU A;  3ZPV 1;  4GB0 A;  1XWH A;  5H1U A;  3O70 A;  2YYR A;  2JRJ A;  2OXQ C;  1FBV A;  5K3Q A;  2G43 A;  5C11 A;  5B77 A;  5KH3 A;  4R2Y A;  5SVY A;  3U5N A;  2IDA A;  2MKE A;  3ZVY A;  2E61 A;  2YUC A;  3RPG C;  5SVX A;  5B79 A;  4GNE A;  2KIZ A;  2KRE A;  3PLW A;  2C2V S;  4IC2 A;  4UI9 B;  2VJF A;  2CKL B;  5EYA F;  4LJN A;  1JM7 B;  2ECJ A;  1Z2Q A;  4OGC A;  5LKZ A;  1DVP A;  2LGV A;  3N9O A;  3PUR A;  2L0B A;  4YAB A;  2CT2 A;  2AN6 A;  3DWD A;  4XI1 A;  3FM8 C;  4F52 B;  2MD8 C;  2Y1N A;  4LLB A;  2DX8 A;  3DQV R;  2KWJ A;  2PNX A;  2F42 A;  4Z0R A;  2DSM A;  2QIC A;  2YSJ A;  2YRE A;  2JUN A;  2JMJ A;  1VD4 A;  4MSX A;  4Z0O A;  4AYC B;  3HTK C;  2KE1 A;  1V87 A;  2LRI C;  2MNZ A;  3U5O A;  3T6R A;  5AIT A;  2EXU A;  3ZYQ A;  2L80 A;  2F6N A;  2VJE B;  2JMD A;  2XOZ A;  5TAB A;  2EGP A;  1WEV A;  2VPD A;  1U6G B;  4UP0 A;  2YUR A;  4BBQ A;  3ZPV E;  4A4C A;  5LKT A;  1MM3 A;  3LQJ A;  4R7E A;  2D8S A;  1WEP A;  2LQ6 A;  2KKX A;  5JG6 A;  2FFW A;  3M99 A;  2E6S A;  4GNF A;  3SOU A;  5SVI A;  1N87 A;  1RMD A;  5FB1 A;  5TRB A;  5B78 A;  5H1T A;  3L1X A;  4A4B A;  5I3L A;  4WZ2 A;  1VFY A;  1WEE A;  2IQJ A;  3LVR E;  3GV4 A;  3SUB A;  2LXH C;  2MIQ A;  2YQM A;  2RR4 A;  3M63 A;  4YC9 A;  3NG2 A;  5H9M A;  2M85 A;  2QIZ A;  2CRR A;  2YU4 A;  4GND A;  3H7H A;  3DDT A;  5KH7 A;  1WEU A;  5KH9 A;  3KV5 A;  4GNG A;  2KWO A;  2FSA A;  2ECG A;  2VNF A;  2L43 A;  1E4U A;  5DIN A;  5B76 A;  2K16 A;  3O35 A;  4IC3 A;  1BOR A;  3MHS A;  5FB0 A;  2CSV A;  3E2D A;  4AUQ B;  2CSZ A;  4A0C D;  2CON A;  5D1L B;  1LDK C;  2FD4 A;  3ASL A;  5TBN A;  5J3X A;  2VPB A;  4QF2 A;  1WEQ A;  4FO9 A;  2PUY A;  2KU3 A;  5FEY A;  2XB1 A;  2LGK A;  2CKL A;  4OGE A;  4B86 C;  1JM7 A;  3PUQ A;  1WEM A;  3I2D A;  5DKA A;  2KGG A;  5G05 B;  2M1R A;  4UP5 A;  3C5K A;  1WIM A;  2D8U A;  3MHH A;  1T1H A;  4S3O C;  4CCG X;  2KWN A;  2Y1M A;  4O64 A;  4FK5 A;  1WGM A;  4TKP B;  1G25 A;  2K17 A;  1WEW A;  4P5O B;  4ZQL A;  2KWK A;  2FUI A;  3KNV A;  3V43 A;  1WIL A;  2HYE D;  4LAD B;  4N4F A;  4ZUX U;  5G0F A;  5TDR A;  2LXP C;  2L7P A;  3FEH A;  4N3W A;  4AYC A;  5B8D A;  3EB6 A;  1FP0 A;  3HCU A;  4L7X A;  3T9K A;  5LKU A;  4PTB A;  4YBT A;  2C2L A;  3LJU X;  2VJE A;  2XEU A;  4FJC A;  3SOW A;  4I7B A;  2ECV A;  4W4U A;  4WA6 A;  3ZNI A;  2KKY A;  3L1Z B;  3M7K A;  1LDJ B;  2LAU A;  2YHO A;  4I7D A;  4YAT A;  3LRQ A; 
#chains in the Genus database with same CATH homology
 1Z6U A;  2EOD A;  4LK9 A;  5G04 B;  2VPE A;  3PHD A;  3T7L A;  2MA6 A;  2LN0 A;  1X4J A;  2K1J A;  1K2F A;  3ZVZ B;  1JOC A;  2H0D B;  3N9M A;  3EB5 A;  1WEO A;  2MNY A;  3FL2 A;  5D1M B;  2E6R A;  2ECN A;  2NAA A;  1WEN A;  4MVT A;  1HYJ A;  1IYM A;  2RI7 A;  5C13 A;  2MA5 A;  1ZBD B;  4Q6F A;  3SOX A;  4FIP A;  2ECI A;  2YT5 A;  2FUU A;  2I50 A;  5B75 A;  2LGG A;  5LCW B;  2M3H A;  3U5M A;  1HYI A;  2MUM A;  4QF3 A;  4X3G A;  2VJF B;  3C6W A;  4C9Z A;  3SHB A;  2KGI A;  2ECT A;  4YAX A;  4V3K C;  2G6Q A;  1WFK A;  3M62 A;  3O36 A;  4YAD A;  2ECW A;  2YHN A;  2YQL A;  5H1V A;  2YSM A;  4R8P K;  3O37 A;  1X4I A;  2MT5 A;  2LV9 A;  2LGL A;  5FER A;  3N9N A;  3U5P A;  2LDR A;  1F62 A;  4AVX A;  3O33 A;  4BHW A;  2F6J A;  2KR4 A;  4PPE A;  4L58 A;  2L75 A;  4LKA A;  2QJ0 A;  2L5U A;  4YBM A;  4AP4 A;  4A49 A;  3RTR B;  2MD7 B;  4WZ0 A;  3RPG B;  3N9L A;  2KFT A;  1Z60 A;  2KYU A;  3KV6 A;  1X4U A;  3O7A A;  2RSD A;  4V3L C;  2HDP A;  3IHP A;  2EA6 A;  1WE9 A;  2VP7 A;  3LQH A;  4YBS A;  2ZET C;  2K4D A;  3O34 A;  1VYX A;  3ZTG A;  2M6M A;  5LKX A;  2VPG A;  4B7Y C;  2JMI A;  1CHC A;  1MM2 A;  4S3O B;  2H0D A;  1WES A;  2BAY A;  5TDW A;  4I7C A;  2G45 A;  3GL6 A;  3KQI A;  3VK6 A;  3L11 A;  3QZV A;  4WZ3 B;  3LQI A;  3N9Q A;  4NN2 A;  2CSY A;  3HCT A;  3N9P A;  3HCS A;  2Y43 A;  5D1K B;  4ZDT A;  4CA1 A;  2UZG A;  2YW8 A;  3DPL R;  5AIU A;  3ZPV 1;  4GB0 A;  1XWH A;  5H1U A;  3O70 A;  2YYR A;  2JRJ A;  2OXQ C;  1FBV A;  5C11 A;  2G43 A;  5B77 A;  5KH3 A;  4R2Y A;  3U5N A;  2IDA A;  3ZVY A;  2YUC A;  3RPG C;  5B79 A;  4GNE A;  2KIZ A;  2KRE A;  2C2V S;  4IC2 A;  4UI9 B;  2VJF A;  2CKL B;  5EYA F;  4LJN A;  1JM7 B;  2ECJ A;  1Z2Q A;  5LKZ A;  1DVP A;  2LGV A;  3N9O A;  3PUR A;  2L0B A;  4YAB A;  2CT2 A;  2AN6 A;  4XI1 A;  4F52 B;  2MD8 C;  2Y1N A;  4LLB A;  2DX8 A;  3DQV R;  2KWJ A;  2PNX A;  2F42 A;  2QIC A;  2YSJ A;  2YRE A;  2JMJ A;  1VD4 A;  4MSX A;  4AYC B;  3HTK C;  2KE1 A;  1V87 A;  2LRI C;  2MNZ A;  3U5O A;  3T6R A;  5AIT A;  3ZYQ A;  2L80 A;  2F6N A;  2VJE B;  2JMD A;  5TAB A;  2EGP A;  1WEV A;  2VPD A;  1U6G B;  4UP0 A;  2YUR A;  4BBQ A;  3ZPV E;  4A4C A;  5LKT A;  1MM3 A;  3LQJ A;  4R7E A;  2D8S A;  1WEP A;  2LQ6 A;  5JG6 A;  3M99 A;  2E6S A;  4GNF A;  3SOU A;  1N87 A;  1RMD A;  5FB1 A;  5TRB A;  5B78 A;  5H1T A;  3L1X A;  4A4B A;  5I3L A;  4WZ2 A;  1VFY A;  1WEE A;  3GV4 A;  2LXH C;  2MIQ A;  2YQM A;  3M63 A;  4YC9 A;  3NG2 A;  5H9M A;  2M85 A;  2QIZ A;  2YU4 A;  4GND A;  5KH7 A;  1WEU A;  5KH9 A;  3KV5 A;  4GNG A;  2KWO A;  2FSA A;  2ECG A;  2VNF A;  2L43 A;  1E4U A;  5DIN A;  5B76 A;  2K16 A;  3O35 A;  4IC3 A;  1BOR A;  3MHS A;  5FB0 A;  4AUQ B;  2CSZ A;  4A0C D;  5D1L B;  1LDK C;  3ASL A;  5TBN A;  5J3X A;  2VPB A;  4QF2 A;  1WEQ A;  4FO9 A;  2PUY A;  2KU3 A;  5FEY A;  2XB1 A;  2LGK A;  2CKL A;  4B86 C;  1JM7 A;  3PUQ A;  1WEM A;  3I2D A;  5DKA A;  5G05 B;  2KGG A;  2M1R A;  4UP5 A;  3C5K A;  1WIM A;  3MHH A;  1T1H A;  4S3O C;  4CCG X;  2KWN A;  2Y1M A;  4O64 A;  4FK5 A;  1WGM A;  4TKP B;  1G25 A;  2K17 A;  1WEW A;  4P5O B;  4ZQL A;  2KWK A;  2FUI A;  3KNV A;  3V43 A;  1WIL A;  2HYE D;  4LAD B;  4N4F A;  4ZUX U;  5G0F A;  5TDR A;  2LXP C;  4AYC A;  4N3W A;  5B8D A;  3EB6 A;  1FP0 A;  3HCU A;  4L7X A;  5LKU A;  4PTB A;  4YBT A;  2C2L A;  2VJE A;  2XEU A;  4FJC A;  3SOW A;  4I7B A;  2ECV A;  4W4U A;  4WA6 A;  3ZNI A;  3L1Z B;  1LDJ B;  2YHO A;  4I7D A;  4YAT A;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...