4TKPB

Complex of ubc13 with the ring domain of the trim5alpha retroviral restriction factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
63
Chain Sequence
ILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACISCPVCRISYQPENIQPNRHVANIVEKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 N
publication title Activation of the Ubc13-Ub adduct by the RING domain of the TRIM5alpha retroviral restriction factor offers insight into the mechanism of molecular pattern recognition by TRIM proteins
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 18
structure length 63
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4tkpB00
2YSJA 4A4CA 2VJEA 2YQLA 2MUMA 4LJNA 3DQVR 2M3HA 3M63A 3EB6A 3N9MA 3U5OA 2KYUA 2Y1MA 1WEQA 3O33A 4LKAA 4L7XA 4O64A 2M85A 2MA5A 2BAYA 4R2YA 3KV5A 2ECTA 1WENA 3HTKC 3O35A 2YREA 5AIUA 2L0BA 5KH3A 2KGIA 4B86C 2C2VS 4LADB 4PPEA 2EODA 2L80A 2VJFB 5LKTA 3LQJA 1LDJB 4WA6A 4LLBA 3HCTA 4ZQLA 2EA6A 2ECIA 5G04B 4FIPA 3ZVYA 2E6RA 2QICA 4YBMA 3MHHA 2Y1NA 4N4FA 4AVXA 5B75A 4P5OB 4YATA 2FUUA 1LDKC 3N9PA 4YBSA 2LXHC 5TABA 1X4JA 3PUQA 4WZ3B 3L1ZB 3U5PA 4YC9A 4I7CA 5FB0A 1DVPA 3GV4A 1RMDA 4X3GA 4W4UA 5LKZA 1JOCA 2MT5A 4YADA 2L5UA 4ZUXU 4FK5A 4S3OC 5C11A 3N9LA 2E6SA 4WZ0A 3GL6A 2DX8A 4Q6FA 3DPLR 2KWNA 2KR4A 2FUIA 3RTRB 5H1TA 1JM7B 4FO9A 1CHCA 4IC3A 5TRBA 2LRIC 2H0DB 1MM3A 4CA1A 2F42A 2KWOA 2JMJA 2LGLA 1V87A 5G05B 4TKPB 2G6QA 2ECNA 2ECGA 2YSMA 3LQHA 2YQMA 2MIQA 1WE9A 2YW8A 2Y43A 3IHPA 2VPDA 3O34A 5C13A 4YAXA 2KE1A 5KH7A 2KWJA 1X4UA 1JM7A 1WGMA 4S3OB 1ZBDB 5DKAA 2H0DA 4R8PK 2MNZA 2F6NA 2LQ6A 2YUCA 3N9NA 4MSXA 1X4IA 1WEPA 2YURA 2G43A 4BBQA 1WEVA 4MVTA 2UZGA 1BORA 2FSAA 3NG2A 2RI7A 1WFKA 4QF3A 1T1HA 4A0CD 2YYRA 4ZDTA 3KNVA 3ZPVE 4R7EA 1F62A 2QIZA 4NN2A 1Z60A 4AP4A 2LXPC 3ASLA 2CKLB 2VPBA 1WEWA 4GNFA 5B79A 3PHDA 3SOXA 1FBVA 2ECVA 1IYMA 2VJFA 2VPEA 5TDWA 5B78A 4GNDA 4AYCB 3KV6A 4PTBA 2K16A 3QZVA 4FJCA 1G25A 2C2LA 2I50A 5H1UA 2LN0A 3FL2A 4IC2A 1HYIA 3KQIA 3LQIA 2KREA 3ZTGA 3U5NA 4GB0A 5B8DA 4V3LC 1K2FA 5B77A 1WEEA 3L11A 2HDPA 4XI1A 1FP0A 2VJEB 4UP0A 1WEMA 3ZNIA 4V3KC 3T6RA 3O70A 5LKXA 4B7YC 1E4UA 3RPGC 2K4DA 4I7DA 1N87A 3HCSA 3O37A 5LCWB 3MHSA 2IDAA 4LK9A 4QF2A 2QJ0A 5D1MB 3N9QA 2JMDA 3L1XA 5JG6A 4CCGX 2ECJA 2HYED 4N3WA 2L43A 1VYXA 5B76A 5D1KB 1MM2A 3T7LA 4A49A 3SHBA 3U5MA 1XWHA 4C9ZA 3V43A 4YBTA 2NAAA 1VFYA 2LV9A 2KIZA 3C5KA 2KFTA 1Z2QA 2LGVA 3N9OA 5FEYA 3RPGB 5FERA 5H1VA 1U6GB 2F6JA 2M1RA 1WESA 2KWKA 2PNXA 2VNFA 3ZVZB 2K17A 5AITA 2KGGA 2MD7B 4GNEA 2AN6A 3SOUA 5DINA 2KU3A 3SOWA 2MNYA 3M62A 2ECWA 2LGKA 5FB1A 2K1JA 4L58A 2RSDA 2MD8C 2CT2A 1WIMA 4UP5A 2MA6A 5I3LA 2CSYA 4F52B 3C6WA 5LKUA 2YHNA 1VD4A 4GNGA 5H9MA 5J3XA 3PURA 2YT5A 4BHWA 3M99A 2CKLA 2LGGA 2XEUA 2ZETC 4A4BA 2YHOA 3EB5A 2CSZA 4UI9B 1Z6UA 2M6MA 3I2DA 1WEOA 2VP7A 2YU4A 5TDRA 3O7AA 4AYCA 2LDRA 1WILA 2VPGA 2D8SA 3VK6A 2OXQC 3ZYQA 1WEUA 4YABA 2L75A 2JRJA 5EYAF 3LRQA 2PUYA 3O36A 3HCUA 1HYJA 2EGPA 5G0FA 5KH9A 4AUQB 2G45A 3ZPV1 5D1LB 4I7BA 2JMIA 2XB1A 4WZ2A 5TBNA
chains in the Genus database with same CATH superfamily
2YSJA 4A4CA 2VJEA 2YQLA 2MUMA 4LJNA 3DQVR 2EXUA 2M3HA 3M63A 3EB6A 5SVIA 5SVXA 3N9MA 3U5OA 2KYUA 2Y1MA 1WEQA 3FANA 3O33A 3KDEC 4LKAA 2JUNA 4L7XA 2CSVA 4O64A 2M85A 2MA5A 2B0OE 2BAYA 4R2YA 4F1PA 3KV5A 2ECTA 1WENA 3LVQE 3HTKC 3O35A 3M7KA 2YREA 3FAOA 5AIUA 2L0BA 2E61A 2XOCA 5KH3A 2KGIA 4B86C 2C2VS 4LADB 4PPEA 2EODA 2L80A 2VJFB 5LKTA 3LQJA 1LDJB 4WA6A 4LLBA 3HCTA 5SVYA 4ZQLA 2EA6A 2ECIA 5G04B 4FIPA 3ZVYA 2E6RA 2QICA 4YBMA 3MHHA 2Y1NA 4N4FA 4AVXA 5B75A 2XP0A 4P5OB 4YATA 2FUUA 1LDKC 3N9PA 4YBSA 2LXHC 5TABA 1X4JA 4Z0OA 3PUQA 4WZ3B 3L1ZB 2M13A 3U5PA 2XOZA 2L7PA 4YC9A 4I7CA 5FB0A 1DVPA 2D8UA 3GV4A 1RMDA 4X3GA 4W4UA 5LKZA 1JOCA 2MT5A 4YADA 2L5UA 4ZUXU 4FK5A 4S3OC 5C11A 2EGMA 3N9LA 2E6SA 4WZ0A 3GL6A 2DX8A 4Q6FA 3DPLR 2KWNA 2KR4A 2FUIA 3RTRB 5H1TA 1JM7B 4FO9A 1CHCA 4IC3A 5TRBA 2LRIC 2H0DB 2CONA 1MM3A 4CA1A 2F42A 2KWOA 2JMJA 2LGLA 1V87A 1MBMA 5G05B 4TKPB 2G6QA 2ECNA 2ECGA 2YSMA 3LQHA 2YQMA 2MIQA 1WE9A 2YW8A 3DDTA 3SUBA 2Y43A 3IHPA 2VPDA 3O34A 5C13A 4YAXA 2KE1A 5KH7A 2KWJA 1X4UA 3LDYA 2CRRA 3FEHA 1JM7A 1WGMA 4S3OB 1ZBDB 5DKAA 2H0DA 3DWDA 4R8PK 2MNZA 2F6NA 2LQ6A 2YUCA 3N9NA 4MSXA 1X4IA 1WEPA 2YURA 2G43A 4BBQA 1WEVA 4MVTA 2UZGA 1BORA 2FSAA 3NG2A 2RI7A 1DCQA 1WFKA 4QF3A 2P57A 1T1HA 4A0CD 2YYRA 4ZDTA 3KNVA 3ZPVE 4R7EA 1F62A 2QIZA 4NN2A 1Z60A 4AP4A 2LXPC 3ASLA 4H9DA 2CKLB 2VPBA 1WEWA 4GNFA 4OGCA 5B79A 2DJAA 3PHDA 3SOXA 1FBVA 2ECVA 3MDBC 1IYMA 2VJFA 2VPEA 5TDWA 5B78A 4GNDA 2KKYA 4AYCB 3KV6A 4PTBA 2K16A 3QZVA 4FJCA 1G25A 2C2LA 2I50A 5H1UA 2LN0A 3FL2A 4IC2A 1HYIA 3KQIA 3LQIA 2KREA 3ZTGA 3U5NA 3H7HA 4GB0A 5B8DA 4V3LC 1K2FA 2MKEA 5B77A 1WEEA 3L11A 2HDPA 2IQJA 4XI1A 1FP0A 2VJEB 4UP0A 1WEMA 3ZNIA 4V3KC 3T6RA 2CRWA 3O70A 2KKXA 5LKXA 4B7YC 1E4UA 3RPGC 3O47A 2K4DA 4I7DA 1N87A 3HCSA 3O37A 5LCWB 3MHSA 2IDAA 4Z0RA 4LK9A 2FFWA 4QF2A 5K3QA 2QJ0A 3Q1DA 5D1MB 3N9QA 2JMDA 3L1XA 5JG6A 4CCGX 2ECJA 2HYED 4QQ4A 2OWAA 4N3WA 2L43A 1VYXA 5B76A 5D1KB 1MM2A 3T7LA 4A49A 2DSMA 3SHBA 3U5MA 1XWHA 4C9ZA 3V43A 4YBTA 2NAAA 1VFYA 4OGEA 2LV9A 2KIZA 3JUEA 3FM8C 3C5KA 2KFTA 1Z2QA 2LGVA 3N9OA 5FEYA 3RPGB 3LJUX 5FERA 5H1VA 1U6GB 2F6JA 2M1RA 1WESA 2KWKA 2PNXA 2VNFA 3ZVZB 2K17A 5AITA 2KGGA 2MD7B 4GNEA 2AN6A 3SOUA 5DINA 2KU3A 3SOWA 2MNYA 3M62A 2ECWA 2LGKA 5FB1A 2K1JA 4L58A 2RSDA 2MD8C 2CT2A 1WIMA 4UP5A 2MA6A 5I3LA 2CSYA 4F52B 2RR4A 3C6WA 5LKUA 2YHNA 1VD4A 4GNGA 5H9MA 5J3XA 3PURA 2YT5A 4BHWA 3M99A 3PLWA 2CKLA 2LGGA 2XOYA 2XEUA 2ZETC 4A4BA 2YHOA 3EB5A 3FJUB 2JM3A 2CSZA 4UI9B 1Z6UA 2M6MA 3I2DA 1WEOA 2YVRA 5SVIB 2VP7A 2YU4A 5TDRA 3O7AA 4AYCA 2LDRA 1WILA 3T9KA 2VPGA 2D8SA 2LAUA 3VK6A 2OXQC 3ZYQA 1WEUA 4YABA 3E2DA 2L75A 2JRJA 5EYAF 3LRQA 2PUYA 3O36A 3HCUA 1HYJA 2EGPA 5G0FA 5KH9A 4AUQB 2G45A 3ZPV1 2FD4A 3LVRE 5D1LB 4I7BA 2JMIA 2XB1A 4O62A 4WZ2A 5TBNA
chains in the Genus database with same CATH topology
2YSJA 4A4CA 2VJEA 2YQLA 2MUMA 4LJNA 3DQVR 2M3HA 3M63A 3EB6A 3N9MA 3U5OA 2KYUA 2Y1MA 1WEQA 3O33A 4LKAA 4L7XA 4O64A 2M85A 2MA5A 2BAYA 4R2YA 3KV5A 2ECTA 1WENA 3HTKC 3O35A 2YREA 5AIUA 2L0BA 5KH3A 2KGIA 4B86C 2C2VS 4LADB 4PPEA 2EODA 2L80A 2VJFB 5LKTA 3LQJA 1LDJB 4WA6A 4LLBA 3HCTA 4ZQLA 2EA6A 2ECIA 5G04B 4FIPA 3ZVYA 2E6RA 2QICA 4YBMA 3MHHA 2Y1NA 4N4FA 4AVXA 5B75A 4P5OB 4YATA 2FUUA 1LDKC 3N9PA 4YBSA 2LXHC 5TABA 1X4JA 3PUQA 4WZ3B 3L1ZB 3U5PA 4YC9A 4I7CA 5FB0A 1DVPA 3GV4A 1RMDA 4X3GA 4W4UA 5LKZA 1JOCA 2MT5A 4YADA 2L5UA 4ZUXU 4FK5A 4S3OC 5C11A 3N9LA 2E6SA 4WZ0A 3GL6A 2DX8A 4Q6FA 3DPLR 2KWNA 2KR4A 2FUIA 3RTRB 5H1TA 1JM7B 4FO9A 1CHCA 4IC3A 5TRBA 2LRIC 2H0DB 1MM3A 4CA1A 2F42A 2KWOA 2JMJA 2LGLA 1V87A 5G05B 4TKPB 2G6QA 2ECNA 2ECGA 2YSMA 3LQHA 2YQMA 2MIQA 1WE9A 2YW8A 2Y43A 3IHPA 2VPDA 3O34A 5C13A 4YAXA 2KE1A 5KH7A 2KWJA 1X4UA 1JM7A 1WGMA 4S3OB 1ZBDB 5DKAA 2H0DA 4R8PK 2MNZA 2F6NA 2LQ6A 2YUCA 3N9NA 4MSXA 1X4IA 1WEPA 2YURA 2G43A 4BBQA 1WEVA 4MVTA 2UZGA 1BORA 2FSAA 3NG2A 2RI7A 1WFKA 4QF3A 1T1HA 4A0CD 2YYRA 4ZDTA 3KNVA 3ZPVE 4R7EA 1F62A 2QIZA 4NN2A 1Z60A 4AP4A 2LXPC 3ASLA 2CKLB 2VPBA 1WEWA 4GNFA 5B79A 3PHDA 3SOXA 1FBVA 2ECVA 1IYMA 2VJFA 2VPEA 5TDWA 5B78A 4GNDA 4AYCB 3KV6A 4PTBA 2K16A 3QZVA 4FJCA 1G25A 2C2LA 2I50A 5H1UA 2LN0A 3FL2A 4IC2A 1HYIA 3KQIA 3LQIA 2KREA 3ZTGA 3U5NA 4GB0A 5B8DA 4V3LC 1K2FA 5B77A 1WEEA 3L11A 2HDPA 4XI1A 1FP0A 2VJEB 4UP0A 1WEMA 3ZNIA 4V3KC 3T6RA 3O70A 5LKXA 4B7YC 1E4UA 3RPGC 2K4DA 4I7DA 1N87A 3HCSA 3O37A 5LCWB 3MHSA 2IDAA 4LK9A 4QF2A 2QJ0A 5D1MB 3N9QA 2JMDA 3L1XA 5JG6A 4CCGX 2ECJA 2HYED 4N3WA 2L43A 1VYXA 5B76A 5D1KB 1MM2A 3T7LA 4A49A 3SHBA 3U5MA 1XWHA 4C9ZA 3V43A 4YBTA 2NAAA 1VFYA 2LV9A 2KIZA 3C5KA 2KFTA 1Z2QA 2LGVA 3N9OA 5FEYA 3RPGB 5FERA 5H1VA 1U6GB 2F6JA 2M1RA 1WESA 2KWKA 2PNXA 2VNFA 3ZVZB 2K17A 5AITA 2KGGA 2MD7B 4GNEA 2AN6A 3SOUA 5DINA 2KU3A 3SOWA 2MNYA 3M62A 2ECWA 2LGKA 5FB1A 2K1JA 4L58A 2RSDA 2MD8C 2CT2A 1WIMA 4UP5A 2MA6A 5I3LA 2CSYA 4F52B 3C6WA 5LKUA 2YHNA 1VD4A 4GNGA 5H9MA 5J3XA 3PURA 2YT5A 4BHWA 3M99A 2CKLA 2LGGA 2XEUA 2ZETC 4A4BA 2YHOA 3EB5A 2CSZA 4UI9B 1Z6UA 2M6MA 3I2DA 1WEOA 2VP7A 2YU4A 5TDRA 3O7AA 4AYCA 2LDRA 1WILA 2VPGA 2D8SA 3VK6A 2OXQC 3ZYQA 1WEUA 4YABA 2L75A 2JRJA 5EYAF 3LRQA 2PUYA 3O36A 3HCUA 1HYJA 2EGPA 5G0FA 5KH9A 4AUQB 2G45A 3ZPV1 5D1LB 4I7BA 2JMIA 2XB1A 4WZ2A 5TBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSJ A;  4A4C A;  2VJE A;  2YQL A;  2MUM A;  4LJN A;  3DQV R;  2M3H A;  3M63 A;  3EB6 A;  3N9M A;  3U5O A;  2KYU A;  2Y1M A;  1WEQ A;  3O33 A;  4LKA A;  4L7X A;  4O64 A;  2M85 A;  2MA5 A;  2BAY A;  4R2Y A;  3KV5 A;  2ECT A;  1WEN A;  3HTK C;  3O35 A;  2YRE A;  5AIU A;  2L0B A;  5KH3 A;  2KGI A;  4B86 C;  2C2V S;  4LAD B;  4PPE A;  2EOD A;  2L80 A;  2VJF B;  5LKT A;  3LQJ A;  1LDJ B;  4WA6 A;  4LLB A;  3HCT A;  4ZQL A;  2EA6 A;  2ECI A;  5G04 B;  4FIP A;  3ZVY A;  2E6R A;  2QIC A;  4YBM A;  3MHH A;  2Y1N A;  4N4F A;  4AVX A;  5B75 A;  4P5O B;  4YAT A;  2FUU A;  1LDK C;  3N9P A;  4YBS A;  2LXH C;  5TAB A;  1X4J A;  3PUQ A;  4WZ3 B;  3L1Z B;  3U5P A;  4YC9 A;  4I7C A;  5FB0 A;  1DVP A;  3GV4 A;  1RMD A;  4X3G A;  4W4U A;  5LKZ A;  1JOC A;  2MT5 A;  4YAD A;  2L5U A;  4ZUX U;  4FK5 A;  4S3O C;  5C11 A;  3N9L A;  2E6S A;  4WZ0 A;  3GL6 A;  2DX8 A;  4Q6F A;  3DPL R;  2KWN A;  2KR4 A;  2FUI A;  3RTR B;  5H1T A;  1JM7 B;  4FO9 A;  1CHC A;  4IC3 A;  5TRB A;  2LRI C;  2H0D B;  1MM3 A;  4CA1 A;  2F42 A;  2KWO A;  2JMJ A;  2LGL A;  1V87 A;  5G05 B;  4TKP B;  2G6Q A;  2ECN A;  2ECG A;  2YSM A;  3LQH A;  2YQM A;  2MIQ A;  1WE9 A;  2YW8 A;  2Y43 A;  3IHP A;  2VPD A;  3O34 A;  5C13 A;  4YAX A;  2KE1 A;  5KH7 A;  2KWJ A;  1X4U A;  1JM7 A;  1WGM A;  4S3O B;  1ZBD B;  5DKA A;  2H0D A;  4R8P K;  2MNZ A;  2F6N A;  2LQ6 A;  2YUC A;  3N9N A;  4MSX A;  1X4I A;  1WEP A;  2YUR A;  2G43 A;  4BBQ A;  1WEV A;  4MVT A;  2UZG A;  1BOR A;  2FSA A;  3NG2 A;  2RI7 A;  1WFK A;  4QF3 A;  1T1H A;  4A0C D;  2YYR A;  4ZDT A;  3KNV A;  3ZPV E;  4R7E A;  1F62 A;  2QIZ A;  4NN2 A;  1Z60 A;  4AP4 A;  2LXP C;  3ASL A;  2CKL B;  2VPB A;  1WEW A;  4GNF A;  5B79 A;  3PHD A;  3SOX A;  1FBV A;  2ECV A;  1IYM A;  2VJF A;  2VPE A;  5TDW A;  5B78 A;  4GND A;  4AYC B;  3KV6 A;  4PTB A;  2K16 A;  3QZV A;  4FJC A;  1G25 A;  2C2L A;  2I50 A;  5H1U A;  2LN0 A;  3FL2 A;  4IC2 A;  1HYI A;  3KQI A;  3LQI A;  2KRE A;  3ZTG A;  3U5N A;  4GB0 A;  5B8D A;  4V3L C;  1K2F A;  5B77 A;  1WEE A;  3L11 A;  2HDP A;  4XI1 A;  1FP0 A;  2VJE B;  4UP0 A;  1WEM A;  3ZNI A;  4V3K C;  3T6R A;  3O70 A;  5LKX A;  4B7Y C;  1E4U A;  3RPG C;  2K4D A;  4I7D A;  1N87 A;  3HCS A;  3O37 A;  5LCW B;  3MHS A;  2IDA A;  4LK9 A;  4QF2 A;  2QJ0 A;  5D1M B;  3N9Q A;  2JMD A;  3L1X A;  5JG6 A;  4CCG X;  2ECJ A;  2HYE D;  4N3W A;  2L43 A;  1VYX A;  5B76 A;  5D1K B;  1MM2 A;  3T7L A;  4A49 A;  3SHB A;  3U5M A;  1XWH A;  4C9Z A;  3V43 A;  4YBT A;  2NAA A;  1VFY A;  2LV9 A;  2KIZ A;  3C5K A;  2KFT A;  1Z2Q A;  2LGV A;  3N9O A;  5FEY A;  3RPG B;  5FER A;  5H1V A;  1U6G B;  2F6J A;  2M1R A;  1WES A;  2KWK A;  2PNX A;  2VNF A;  3ZVZ B;  2K17 A;  5AIT A;  2KGG A;  2MD7 B;  4GNE A;  2AN6 A;  3SOU A;  5DIN A;  2KU3 A;  3SOW A;  2MNY A;  3M62 A;  2ECW A;  2LGK A;  5FB1 A;  2K1J A;  4L58 A;  2RSD A;  2MD8 C;  2CT2 A;  1WIM A;  4UP5 A;  2MA6 A;  5I3L A;  2CSY A;  4F52 B;  3C6W A;  5LKU A;  2YHN A;  1VD4 A;  4GNG A;  5H9M A;  5J3X A;  3PUR A;  2YT5 A;  4BHW A;  3M99 A;  2CKL A;  2LGG A;  2XEU A;  2ZET C;  4A4B A;  2YHO A;  3EB5 A;  2CSZ A;  4UI9 B;  1Z6U A;  2M6M A;  3I2D A;  1WEO A;  2VP7 A;  2YU4 A;  5TDR A;  3O7A A;  4AYC A;  2LDR A;  1WIL A;  2VPG A;  2D8S A;  3VK6 A;  2OXQ C;  3ZYQ A;  1WEU A;  4YAB A;  2L75 A;  2JRJ A;  5EYA F;  3LRQ A;  2PUY A;  3O36 A;  3HCU A;  1HYJ A;  2EGP A;  5G0F A;  5KH9 A;  4AUQ B;  2G45 A;  3ZPV 1;  5D1L B;  4I7B A;  2JMI A;  2XB1 A;  4WZ2 A;  5TBN A; 
#chains in the Genus database with same CATH topology
 2YSJ A;  4A4C A;  2VJE A;  2YQL A;  2MUM A;  4LJN A;  3DQV R;  2EXU A;  2M3H A;  3M63 A;  3EB6 A;  5SVI A;  5SVX A;  3N9M A;  3U5O A;  2KYU A;  2Y1M A;  1WEQ A;  3FAN A;  3O33 A;  3KDE C;  4LKA A;  2JUN A;  4L7X A;  2CSV A;  4O64 A;  2M85 A;  2MA5 A;  2B0O E;  2BAY A;  4R2Y A;  4F1P A;  3KV5 A;  2ECT A;  1WEN A;  3LVQ E;  3HTK C;  3O35 A;  3M7K A;  2YRE A;  3FAO A;  5AIU A;  2L0B A;  2E61 A;  2XOC A;  5KH3 A;  2KGI A;  4B86 C;  2C2V S;  4LAD B;  4PPE A;  2EOD A;  2L80 A;  2VJF B;  5LKT A;  3LQJ A;  1LDJ B;  4WA6 A;  4LLB A;  3HCT A;  5SVY A;  4ZQL A;  2EA6 A;  2ECI A;  5G04 B;  4FIP A;  3ZVY A;  2E6R A;  2QIC A;  4YBM A;  3MHH A;  2Y1N A;  4N4F A;  4AVX A;  5B75 A;  2XP0 A;  4P5O B;  4YAT A;  2FUU A;  1LDK C;  3N9P A;  4YBS A;  2LXH C;  5TAB A;  1X4J A;  4Z0O A;  3PUQ A;  4WZ3 B;  3L1Z B;  2M13 A;  3U5P A;  2XOZ A;  2L7P A;  4YC9 A;  4I7C A;  5FB0 A;  1DVP A;  2D8U A;  3GV4 A;  1RMD A;  4X3G A;  4W4U A;  5LKZ A;  1JOC A;  2MT5 A;  4YAD A;  2L5U A;  4ZUX U;  4FK5 A;  4S3O C;  5C11 A;  2EGM A;  3N9L A;  2E6S A;  4WZ0 A;  3GL6 A;  2DX8 A;  4Q6F A;  3DPL R;  2KWN A;  2KR4 A;  2FUI A;  3RTR B;  5H1T A;  1JM7 B;  4FO9 A;  1CHC A;  4IC3 A;  5TRB A;  2LRI C;  2H0D B;  2CON A;  1MM3 A;  4CA1 A;  2F42 A;  2KWO A;  2JMJ A;  2LGL A;  1V87 A;  1MBM A;  5G05 B;  4TKP B;  2G6Q A;  2ECN A;  2ECG A;  2YSM A;  3LQH A;  2YQM A;  2MIQ A;  1WE9 A;  2YW8 A;  3DDT A;  3SUB A;  2Y43 A;  3IHP A;  2VPD A;  3O34 A;  5C13 A;  4YAX A;  2KE1 A;  5KH7 A;  2KWJ A;  1X4U A;  3LDY A;  2CRR A;  3FEH A;  1JM7 A;  1WGM A;  4S3O B;  1ZBD B;  5DKA A;  2H0D A;  3DWD A;  4R8P K;  2MNZ A;  2F6N A;  2LQ6 A;  2YUC A;  3N9N A;  4MSX A;  1X4I A;  1WEP A;  2YUR A;  2G43 A;  4BBQ A;  1WEV A;  4MVT A;  2UZG A;  1BOR A;  2FSA A;  3NG2 A;  2RI7 A;  1DCQ A;  1WFK A;  4QF3 A;  2P57 A;  1T1H A;  4A0C D;  2YYR A;  4ZDT A;  3KNV A;  3ZPV E;  4R7E A;  1F62 A;  2QIZ A;  4NN2 A;  1Z60 A;  4AP4 A;  2LXP C;  3ASL A;  4H9D A;  2CKL B;  2VPB A;  1WEW A;  4GNF A;  4OGC A;  5B79 A;  2DJA A;  3PHD A;  3SOX A;  1FBV A;  2ECV A;  3MDB C;  1IYM A;  2VJF A;  2VPE A;  5TDW A;  5B78 A;  4GND A;  2KKY A;  4AYC B;  3KV6 A;  4PTB A;  2K16 A;  3QZV A;  4FJC A;  1G25 A;  2C2L A;  2I50 A;  5H1U A;  2LN0 A;  3FL2 A;  4IC2 A;  1HYI A;  3KQI A;  3LQI A;  2KRE A;  3ZTG A;  3U5N A;  3H7H A;  4GB0 A;  5B8D A;  4V3L C;  1K2F A;  2MKE A;  5B77 A;  1WEE A;  3L11 A;  2HDP A;  2IQJ A;  4XI1 A;  1FP0 A;  2VJE B;  4UP0 A;  1WEM A;  3ZNI A;  4V3K C;  3T6R A;  2CRW A;  3O70 A;  2KKX A;  5LKX A;  4B7Y C;  1E4U A;  3RPG C;  3O47 A;  2K4D A;  4I7D A;  1N87 A;  3HCS A;  3O37 A;  5LCW B;  3MHS A;  2IDA A;  4Z0R A;  4LK9 A;  2FFW A;  4QF2 A;  5K3Q A;  2QJ0 A;  3Q1D A;  5D1M B;  3N9Q A;  2JMD A;  3L1X A;  5JG6 A;  4CCG X;  2ECJ A;  2HYE D;  4QQ4 A;  2OWA A;  4N3W A;  2L43 A;  1VYX A;  5B76 A;  5D1K B;  1MM2 A;  3T7L A;  4A49 A;  2DSM A;  3SHB A;  3U5M A;  1XWH A;  4C9Z A;  3V43 A;  4YBT A;  2NAA A;  1VFY A;  4OGE A;  2LV9 A;  2KIZ A;  3JUE A;  3FM8 C;  3C5K A;  2KFT A;  1Z2Q A;  2LGV A;  3N9O A;  5FEY A;  3RPG B;  3LJU X;  5FER A;  5H1V A;  1U6G B;  2F6J A;  2M1R A;  1WES A;  2KWK A;  2PNX A;  2VNF A;  3ZVZ B;  2K17 A;  5AIT A;  2KGG A;  2MD7 B;  4GNE A;  2AN6 A;  3SOU A;  5DIN A;  2KU3 A;  3SOW A;  2MNY A;  3M62 A;  2ECW A;  2LGK A;  5FB1 A;  2K1J A;  4L58 A;  2RSD A;  2MD8 C;  2CT2 A;  1WIM A;  4UP5 A;  2MA6 A;  5I3L A;  2CSY A;  4F52 B;  2RR4 A;  3C6W A;  5LKU A;  2YHN A;  1VD4 A;  4GNG A;  5H9M A;  5J3X A;  3PUR A;  2YT5 A;  4BHW A;  3M99 A;  3PLW A;  2CKL A;  2LGG A;  2XOY A;  2XEU A;  2ZET C;  4A4B A;  2YHO A;  3EB5 A;  3FJU B;  2JM3 A;  2CSZ A;  4UI9 B;  1Z6U A;  2M6M A;  3I2D A;  1WEO A;  2YVR A;  5SVI B;  2VP7 A;  2YU4 A;  5TDR A;  3O7A A;  4AYC A;  2LDR A;  1WIL A;  3T9K A;  2VPG A;  2D8S A;  2LAU A;  3VK6 A;  2OXQ C;  3ZYQ A;  1WEU A;  4YAB A;  3E2D A;  2L75 A;  2JRJ A;  5EYA F;  3LRQ A;  2PUY A;  3O36 A;  3HCU A;  1HYJ A;  2EGP A;  5G0F A;  5KH9 A;  4AUQ B;  2G45 A;  3ZPV 1;  2FD4 A;  3LVR E;  5D1L B;  4I7B A;  2JMI A;  2XB1 A;  4O62 A;  4WZ2 A;  5TBN A; 
#chains in the Genus database with same CATH homology
 2YSJ A;  4A4C A;  2VJE A;  2YQL A;  2MUM A;  4LJN A;  3DQV R;  2M3H A;  3M63 A;  3EB6 A;  3N9M A;  3U5O A;  2KYU A;  2Y1M A;  1WEQ A;  3O33 A;  4LKA A;  4L7X A;  4O64 A;  2M85 A;  2MA5 A;  2BAY A;  4R2Y A;  3KV5 A;  2ECT A;  1WEN A;  3HTK C;  3O35 A;  2YRE A;  5AIU A;  2L0B A;  5KH3 A;  2KGI A;  4B86 C;  2C2V S;  4LAD B;  4PPE A;  2EOD A;  2L80 A;  2VJF B;  5LKT A;  3LQJ A;  1LDJ B;  4WA6 A;  4LLB A;  3HCT A;  4ZQL A;  2EA6 A;  2ECI A;  5G04 B;  4FIP A;  3ZVY A;  2E6R A;  2QIC A;  4YBM A;  3MHH A;  2Y1N A;  4N4F A;  4AVX A;  5B75 A;  4P5O B;  4YAT A;  2FUU A;  1LDK C;  3N9P A;  4YBS A;  2LXH C;  5TAB A;  1X4J A;  3PUQ A;  4WZ3 B;  3L1Z B;  3U5P A;  4YC9 A;  4I7C A;  5FB0 A;  1DVP A;  3GV4 A;  1RMD A;  4X3G A;  4W4U A;  5LKZ A;  1JOC A;  2MT5 A;  4YAD A;  2L5U A;  4ZUX U;  4FK5 A;  4S3O C;  5C11 A;  3N9L A;  2E6S A;  4WZ0 A;  3GL6 A;  2DX8 A;  4Q6F A;  3DPL R;  2KWN A;  2KR4 A;  2FUI A;  3RTR B;  5H1T A;  1JM7 B;  4FO9 A;  1CHC A;  4IC3 A;  5TRB A;  2LRI C;  2H0D B;  1MM3 A;  4CA1 A;  2F42 A;  2KWO A;  2JMJ A;  2LGL A;  1V87 A;  5G05 B;  4TKP B;  2G6Q A;  2ECN A;  2ECG A;  2YSM A;  3LQH A;  2YQM A;  2MIQ A;  1WE9 A;  2YW8 A;  2Y43 A;  3IHP A;  2VPD A;  3O34 A;  5C13 A;  4YAX A;  2KE1 A;  5KH7 A;  2KWJ A;  1X4U A;  1JM7 A;  1WGM A;  4S3O B;  1ZBD B;  5DKA A;  2H0D A;  4R8P K;  2MNZ A;  2F6N A;  2LQ6 A;  2YUC A;  3N9N A;  4MSX A;  1X4I A;  1WEP A;  2YUR A;  2G43 A;  4BBQ A;  1WEV A;  4MVT A;  2UZG A;  1BOR A;  2FSA A;  3NG2 A;  2RI7 A;  1WFK A;  4QF3 A;  1T1H A;  4A0C D;  2YYR A;  4ZDT A;  3KNV A;  3ZPV E;  4R7E A;  1F62 A;  2QIZ A;  4NN2 A;  1Z60 A;  4AP4 A;  2LXP C;  3ASL A;  2CKL B;  2VPB A;  1WEW A;  4GNF A;  5B79 A;  3PHD A;  3SOX A;  1FBV A;  2ECV A;  1IYM A;  2VJF A;  2VPE A;  5TDW A;  5B78 A;  4GND A;  4AYC B;  3KV6 A;  4PTB A;  2K16 A;  3QZV A;  4FJC A;  1G25 A;  2C2L A;  2I50 A;  5H1U A;  2LN0 A;  3FL2 A;  4IC2 A;  1HYI A;  3KQI A;  3LQI A;  2KRE A;  3ZTG A;  3U5N A;  4GB0 A;  5B8D A;  4V3L C;  1K2F A;  5B77 A;  1WEE A;  3L11 A;  2HDP A;  4XI1 A;  1FP0 A;  2VJE B;  4UP0 A;  1WEM A;  3ZNI A;  4V3K C;  3T6R A;  3O70 A;  5LKX A;  4B7Y C;  1E4U A;  3RPG C;  2K4D A;  4I7D A;  1N87 A;  3HCS A;  3O37 A;  5LCW B;  3MHS A;  2IDA A;  4LK9 A;  4QF2 A;  2QJ0 A;  5D1M B;  3N9Q A;  2JMD A;  3L1X A;  5JG6 A;  4CCG X;  2ECJ A;  2HYE D;  4N3W A;  2L43 A;  1VYX A;  5B76 A;  5D1K B;  1MM2 A;  3T7L A;  4A49 A;  3SHB A;  3U5M A;  1XWH A;  4C9Z A;  3V43 A;  4YBT A;  2NAA A;  1VFY A;  2LV9 A;  2KIZ A;  3C5K A;  2KFT A;  1Z2Q A;  2LGV A;  3N9O A;  5FEY A;  3RPG B;  5FER A;  5H1V A;  1U6G B;  2F6J A;  2M1R A;  1WES A;  2KWK A;  2PNX A;  2VNF A;  3ZVZ B;  2K17 A;  5AIT A;  2KGG A;  2MD7 B;  4GNE A;  2AN6 A;  3SOU A;  5DIN A;  2KU3 A;  3SOW A;  2MNY A;  3M62 A;  2ECW A;  2LGK A;  5FB1 A;  2K1J A;  4L58 A;  2RSD A;  2MD8 C;  2CT2 A;  1WIM A;  4UP5 A;  2MA6 A;  5I3L A;  2CSY A;  4F52 B;  3C6W A;  5LKU A;  2YHN A;  1VD4 A;  4GNG A;  5H9M A;  5J3X A;  3PUR A;  2YT5 A;  4BHW A;  3M99 A;  2CKL A;  2LGG A;  2XEU A;  2ZET C;  4A4B A;  2YHO A;  3EB5 A;  2CSZ A;  4UI9 B;  1Z6U A;  2M6M A;  3I2D A;  1WEO A;  2VP7 A;  2YU4 A;  5TDR A;  3O7A A;  4AYC A;  2LDR A;  1WIL A;  2VPG A;  2D8S A;  3VK6 A;  2OXQ C;  3ZYQ A;  1WEU A;  4YAB A;  2L75 A;  2JRJ A;  5EYA F;  3LRQ A;  2PUY A;  3O36 A;  3HCU A;  1HYJ A;  2EGP A;  5G0F A;  5KH9 A;  4AUQ B;  2G45 A;  3ZPV 1;  5D1L B;  4I7B A;  2JMI A;  2XB1 A;  4WZ2 A;  5TBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...