3T7LA

Crystal structure of the fyve domain of endofin (zfyve16) at 1.1a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
LVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKEARVCVVCYETISKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Zinc finger FYVE domain-containing protein 16
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t7lA00
3PURA 3O7AA 5H1VA 5B75A 2G6QA 4L7XA 3N9LA 5H1UA 5DINA 4O64A 3LQIA 2VPDA 1DVPA 3SHBA 3SOWA 4I7CA 3KV6A 2L75A 4MVTA 1MM3A 3HTKC 3ZVYA 2LXHC 1WILA 4I7BA 2H0DA 4F52B 4FIPA 2CKLB 4GNFA 3RPGC 2KWOA 2ECWA 5G04B 4BBQA 3N9MA 4A0CD 5KH9A 1LDJB 1G25A 3O70A 3GL6A 4AP4A 1VD4A 3U5PA 5AIUA 3O37A 2ECGA 4R2YA 3O35A 3LQJA 5AITA 2MD7B 2VJFA 2M3HA 5B76A 4A4CA 4S3OB 5TDRA 4CCGX 2MNYA 4YABA 3V43A 1F62A 5D1LB 4UI9B 1VFYA 1U6GB 2VNFA 2ECTA 3M99A 2F6NA 2LXPC 2EA6A 4CA1A 4ZDTA 1WIMA 2D8SA 5DKAA 5J3XA 3MHHA 5TDWA 3RTRB 4MSXA 2KWJA 5D1MB 5KH7A 1V87A 4FO9A 2CSZA 2K17A 2VPGA 2YYRA 3U5OA 1K2FA 2HYED 4QF2A 1X4UA 2K4DA 5LCWB 2M6MA 5D1KB 2L0BA 2MT5A 2YHOA 2F42A 2MA6A 1BORA 4XI1A 3O33A 2L5UA 3C5KA 3C6WA 4YBTA 4A49A 3LQHA 3SOXA 4IC2A 3U5MA 4BHWA 4ZQLA 1WENA 5B78A 3T6RA 1T1HA 4X3GA 4R7EA 4YBSA 2ECVA 4AUQB 2CSYA 5B77A 3L1ZB 2RSDA 2LGVA 3HCSA 5EYAF 2QJ0A 4FJCA 2YT5A 1WEEA 2LRIC 4AYCB 4WZ3B 2C2VS 5FEYA 5LKXA 1N87A 2YQLA 2E6RA 3L1XA 3GV4A 3SOUA 4WA6A 1HYJA 2OXQC 4LLBA 2ECNA 2YSMA 3MHSA 4Q6FA 2YHNA 2EGPA 5TBNA 4C9ZA 5C13A 1WGMA 4PPEA 2YURA 2MA5A 5TRBA 3KNVA 4YAXA 5I3LA 4W4UA 2VJEA 5H1TA 4V3LC 2KU3A 4LADB 4AYCA 3PUQA 4ZUXU 3EB5A 2VPBA 1IYMA 2YQMA 1JOCA 5B8DA 5LKTA 2G43A 2NAAA 1WEUA 4TKPB 3N9PA 4GNDA 3QZVA 4PTBA 1CHCA 2E6SA 4LJNA 2MD8C 3N9NA 3ZYQA 2PUYA 2MNZA 2ZETC 3N9QA 2KIZA 4LK9A 1JM7B 2UZGA 2AN6A 2YSJA 1Z2QA 3O34A 1WEWA 3NG2A 2IDAA 2Y43A 2CKLA 2PNXA 2M85A 4A4BA 4UP5A 4YBMA 2EODA 3DPLR 4UP0A 1FBVA 2BAYA 4GB0A 2LGGA 4YC9A 5JG6A 2LGLA 4WZ2A 2F6JA 2JMDA 4WZ0A 1WE9A 2FUUA 2H0DB 2XB1A 3O36A 1X4IA 1WEPA 4YATA 3I2DA 1RMDA 2RI7A 1LDKC 3VK6A 4N3WA 1Z60A 2M1RA 3M62A 3HCTA 5C11A 2YW8A 1ZBDB 4B86C 4YADA 5LKZA 2LDRA 1X4JA 5G0FA 2C2LA 3KQIA 5LKUA 2FSAA 3ZNIA 2YU4A 1WEOA 1WESA 2L80A 2KYUA 3RPGB 4FK5A 3ZTGA 2LN0A 3PHDA 5KH3A 1E4UA 1JM7A 1WFKA 2QICA 1Z6UA 3IHPA 4P5OB 2KFTA 3EB6A 2LQ6A 3T7LA 2JRJA 2ECJA 4GNEA 2LGKA 2JMIA 5FB1A 2JMJA 4V3KC 4GNGA 2QIZA 3ZPVE 2KGGA 2FUIA 5FB0A 2Y1MA 2YUCA 4R8PK 4L58A 5FERA 2KGIA 4LKAA 2L43A 2VPEA 3LRQA 2KWKA 4AVXA 4N4FA 2DX8A 2VJEB 3ASLA 3FL2A 2LV9A 3M63A 3ZPV1 2YREA 1WEMA 2K1JA 4NN2A 5B79A 2VP7A 2Y1NA 2XEUA 4S3OC 3L11A 3ZVZB 1FP0A 3KV5A 1VYXA 3U5NA 4B7YC 2MIQA 2VJFB 2I50A 1MM2A 2CT2A 2G45A 5TABA 5G05B 3DQVR 5H9MA 4I7DA 4IC3A 2KWNA 2MUMA 1WEVA 2ECIA 2KREA 2KE1A 2HDPA 2K16A 3N9OA 4QF3A 1XWHA 1HYIA 2KR4A 3HCUA 1WEQA
chains in the Genus database with same CATH superfamily
2EXUA 3PURA 3O7AA 5H1VA 5B75A 2G6QA 4L7XA 3N9LA 3H7HA 5H1UA 2JM3A 5DINA 2DSMA 2YVRA 4O64A 3LQIA 4F1PA 3SUBA 3FJUB 2VPDA 1DVPA 3SHBA 4OGCA 1MBMA 3SOWA 4I7CA 3KV6A 2L75A 4MVTA 1MM3A 3HTKC 3ZVYA 2LXHC 1WILA 4I7BA 2H0DA 4F52B 3DWDA 4FIPA 2CKLB 4GNFA 3RPGC 2KWOA 2ECWA 5G04B 4BBQA 1DCQA 3N9MA 4A0CD 2M13A 5KH9A 3PLWA 1LDJB 1G25A 3O70A 3GL6A 4AP4A 1VD4A 3U5PA 5AIUA 3O37A 2ECGA 4R2YA 3O35A 5SVXA 3LQJA 5AITA 2MD7B 2VJFA 2M3HA 5B76A 4OGEA 4A4CA 4S3OB 5TDRA 4CCGX 2MNYA 4Z0OA 4YABA 3V43A 1F62A 5D1LB 2CONA 4UI9B 1VFYA 1U6GB 2VNFA 2ECTA 3M99A 2CSVA 2F6NA 2LXPC 2EA6A 4CA1A 4ZDTA 4O62A 1WIMA 2D8SA 5DKAA 5J3XA 3MHHA 5TDWA 3LVQE 3FEHA 3RTRB 4MSXA 2KWJA 5D1MB 5KH7A 1V87A 4FO9A 2CSZA 2K17A 2VPGA 3DDTA 2YYRA 3U5OA 1K2FA 2HYED 4QF2A 1X4UA 5SVIA 5K3QA 2E61A 2K4DA 5LCWB 2M6MA 5D1KB 2L0BA 2MT5A 5SVIB 2YHOA 2F42A 2MA6A 1BORA 3O47A 2D8UA 4XI1A 3O33A 2L5UA 3C5KA 3MDBC 2IQJA 3C6WA 4YBTA 4A49A 3LQHA 3SOXA 3JUEA 4IC2A 3U5MA 4BHWA 4ZQLA 1WENA 5B78A 3T6RA 1T1HA 4X3GA 4R7EA 4YBSA 4QQ4A 2ECVA 4AUQB 2P57A 2CSYA 5B77A 3L1ZB 2RSDA 2LGVA 3HCSA 5EYAF 2MKEA 2QJ0A 4FJCA 2YT5A 1WEEA 2LRIC 4AYCB 4WZ3B 2C2VS 5FEYA 5LKXA 1N87A 2YQLA 2E6RA 3L1XA 3GV4A 2JUNA 3SOUA 4WA6A 1HYJA 2OXQC 4LLBA 2ECNA 2YSMA 3MHSA 4Q6FA 2YHNA 2XOZA 2EGPA 5TBNA 4Z0RA 4C9ZA 5C13A 1WGMA 4PPEA 2YURA 2MA5A 5TRBA 3KNVA 4YAXA 2OWAA 5I3LA 4W4UA 2VJEA 5H1TA 4V3LC 2KU3A 4LADB 4AYCA 3PUQA 4ZUXU 3EB5A 2VPBA 1IYMA 2YQMA 1JOCA 5B8DA 5LKTA 2G43A 2NAAA 1WEUA 4TKPB 3N9PA 4GNDA 3QZVA 4PTBA 1CHCA 2E6SA 4LJNA 2MD8C 3N9NA 3ZYQA 2PUYA 2MNZA 2EGMA 2ZETC 3LJUX 3N9QA 2KIZA 4LK9A 2CRWA 1JM7B 2UZGA 2AN6A 2YSJA 1Z2QA 3O34A 1WEWA 3NG2A 2IDAA 2Y43A 3FANA 2CKLA 2PNXA 2M85A 4A4BA 4UP5A 4YBMA 2EODA 3DPLR 2FD4A 4UP0A 1FBVA 2BAYA 5SVYA 4GB0A 2LGGA 3FM8C 4YC9A 5JG6A 2B0OE 2LGLA 4WZ2A 2F6JA 2JMDA 4WZ0A 1WE9A 2FUUA 2H0DB 2XB1A 3O36A 3KDEC 1X4IA 1WEPA 4YATA 3I2DA 1RMDA 3FAOA 2RI7A 1LDKC 4N3WA 3VK6A 1Z60A 2M1RA 2CRRA 2DJAA 3M62A 3M7KA 2L7PA 3HCTA 3T9KA 5C11A 2RR4A 2YW8A 2FFWA 1ZBDB 4B86C 4YADA 5LKZA 2LDRA 1X4JA 2XP0A 5G0FA 2C2LA 3KQIA 5LKUA 2FSAA 3ZNIA 2YU4A 1WEOA 1WESA 2L80A 2KYUA 3RPGB 4FK5A 3ZTGA 2LN0A 3PHDA 5KH3A 1E4UA 1JM7A 1WFKA 2QICA 1Z6UA 3IHPA 4P5OB 2KFTA 3EB6A 2LQ6A 3T7LA 2JRJA 2ECJA 4GNEA 2LGKA 2JMIA 5FB1A 2JMJA 3LDYA 4V3KC 4GNGA 2QIZA 3ZPVE 2KGGA 2FUIA 5FB0A 2Y1MA 2YUCA 4R8PK 4L58A 5FERA 2KGIA 4LKAA 2L43A 2VPEA 2XOCA 3LRQA 2KWKA 4AVXA 3Q1DA 4N4FA 2DX8A 2VJEB 3ASLA 3FL2A 2KKXA 2LV9A 3M63A 3ZPV1 2YREA 1WEMA 2K1JA 2KKYA 4NN2A 5B79A 2LAUA 2VP7A 2Y1NA 3LVRE 2XEUA 4S3OC 3L11A 3ZVZB 1FP0A 3KV5A 1VYXA 3U5NA 4B7YC 3E2DA 2MIQA 2VJFB 2I50A 1MM2A 2CT2A 2G45A 5TABA 5G05B 3DQVR 5H9MA 4I7DA 4IC3A 4H9DA 2KWNA 2MUMA 1WEVA 2ECIA 2KREA 2KE1A 2HDPA 2K16A 3N9OA 2XOYA 4QF3A 1XWHA 1HYIA 2KR4A 3HCUA 1WEQA
chains in the Genus database with same CATH topology
3PURA 3O7AA 5H1VA 5B75A 2G6QA 4L7XA 3N9LA 5H1UA 5DINA 4O64A 3LQIA 2VPDA 1DVPA 3SHBA 3SOWA 4I7CA 3KV6A 2L75A 4MVTA 1MM3A 3HTKC 3ZVYA 2LXHC 1WILA 4I7BA 2H0DA 4F52B 4FIPA 2CKLB 4GNFA 3RPGC 2KWOA 2ECWA 5G04B 4BBQA 3N9MA 4A0CD 5KH9A 1LDJB 1G25A 3O70A 3GL6A 4AP4A 1VD4A 3U5PA 5AIUA 3O37A 2ECGA 4R2YA 3O35A 3LQJA 5AITA 2MD7B 2VJFA 2M3HA 5B76A 4A4CA 4S3OB 5TDRA 4CCGX 2MNYA 4YABA 3V43A 1F62A 5D1LB 4UI9B 1VFYA 1U6GB 2VNFA 2ECTA 3M99A 2F6NA 2LXPC 2EA6A 4CA1A 4ZDTA 1WIMA 2D8SA 5DKAA 5J3XA 3MHHA 5TDWA 3RTRB 4MSXA 2KWJA 5D1MB 5KH7A 1V87A 4FO9A 2CSZA 2K17A 2VPGA 2YYRA 3U5OA 1K2FA 2HYED 4QF2A 1X4UA 2K4DA 5LCWB 2M6MA 5D1KB 2L0BA 2MT5A 2YHOA 2F42A 2MA6A 1BORA 4XI1A 3O33A 2L5UA 3C5KA 3C6WA 4YBTA 4A49A 3LQHA 3SOXA 4IC2A 3U5MA 4BHWA 4ZQLA 1WENA 5B78A 3T6RA 1T1HA 4X3GA 4R7EA 4YBSA 2ECVA 4AUQB 2CSYA 5B77A 3L1ZB 2RSDA 2LGVA 3HCSA 5EYAF 2QJ0A 4FJCA 2YT5A 1WEEA 2LRIC 4AYCB 4WZ3B 2C2VS 5FEYA 5LKXA 1N87A 2YQLA 2E6RA 3L1XA 3GV4A 3SOUA 4WA6A 1HYJA 2OXQC 4LLBA 2ECNA 2YSMA 3MHSA 4Q6FA 2YHNA 2EGPA 5TBNA 4C9ZA 5C13A 1WGMA 4PPEA 2YURA 2MA5A 5TRBA 3KNVA 4YAXA 5I3LA 4W4UA 2VJEA 5H1TA 4V3LC 2KU3A 4LADB 4AYCA 3PUQA 4ZUXU 3EB5A 2VPBA 1IYMA 2YQMA 1JOCA 5B8DA 5LKTA 2G43A 2NAAA 1WEUA 4TKPB 3N9PA 4GNDA 3QZVA 4PTBA 1CHCA 2E6SA 4LJNA 2MD8C 3N9NA 3ZYQA 2PUYA 2MNZA 2ZETC 3N9QA 2KIZA 4LK9A 1JM7B 2UZGA 2AN6A 2YSJA 1Z2QA 3O34A 1WEWA 3NG2A 2IDAA 2Y43A 2CKLA 2PNXA 2M85A 4A4BA 4UP5A 4YBMA 2EODA 3DPLR 4UP0A 1FBVA 2BAYA 4GB0A 2LGGA 4YC9A 5JG6A 2LGLA 4WZ2A 2F6JA 2JMDA 4WZ0A 1WE9A 2FUUA 2H0DB 2XB1A 3O36A 1X4IA 1WEPA 4YATA 3I2DA 1RMDA 2RI7A 1LDKC 3VK6A 4N3WA 1Z60A 2M1RA 3M62A 3HCTA 5C11A 2YW8A 1ZBDB 4B86C 4YADA 5LKZA 2LDRA 1X4JA 5G0FA 2C2LA 3KQIA 5LKUA 2FSAA 3ZNIA 2YU4A 1WEOA 1WESA 2L80A 2KYUA 3RPGB 4FK5A 3ZTGA 2LN0A 3PHDA 5KH3A 1E4UA 1JM7A 1WFKA 2QICA 1Z6UA 3IHPA 4P5OB 2KFTA 3EB6A 2LQ6A 3T7LA 2JRJA 2ECJA 4GNEA 2LGKA 2JMIA 5FB1A 2JMJA 4V3KC 4GNGA 2QIZA 3ZPVE 2KGGA 2FUIA 5FB0A 2Y1MA 2YUCA 4R8PK 4L58A 5FERA 2KGIA 4LKAA 2L43A 2VPEA 3LRQA 2KWKA 4AVXA 4N4FA 2DX8A 2VJEB 3ASLA 3FL2A 2LV9A 3M63A 3ZPV1 2YREA 1WEMA 2K1JA 4NN2A 5B79A 2VP7A 2Y1NA 2XEUA 4S3OC 3L11A 3ZVZB 1FP0A 3KV5A 1VYXA 3U5NA 4B7YC 2MIQA 2VJFB 2I50A 1MM2A 2CT2A 2G45A 5TABA 5G05B 3DQVR 5H9MA 4I7DA 4IC3A 2KWNA 2MUMA 1WEVA 2ECIA 2KREA 2KE1A 2HDPA 2K16A 3N9OA 4QF3A 1XWHA 1HYIA 2KR4A 3HCUA 1WEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUR A;  3O7A A;  5H1V A;  5B75 A;  2G6Q A;  4L7X A;  3N9L A;  5H1U A;  5DIN A;  4O64 A;  3LQI A;  2VPD A;  1DVP A;  3SHB A;  3SOW A;  4I7C A;  3KV6 A;  2L75 A;  4MVT A;  1MM3 A;  3HTK C;  3ZVY A;  2LXH C;  1WIL A;  4I7B A;  2H0D A;  4F52 B;  4FIP A;  2CKL B;  4GNF A;  3RPG C;  2KWO A;  2ECW A;  5G04 B;  4BBQ A;  3N9M A;  4A0C D;  5KH9 A;  1LDJ B;  1G25 A;  3O70 A;  3GL6 A;  4AP4 A;  1VD4 A;  3U5P A;  5AIU A;  3O37 A;  2ECG A;  4R2Y A;  3O35 A;  3LQJ A;  5AIT A;  2MD7 B;  2VJF A;  2M3H A;  5B76 A;  4A4C A;  4S3O B;  5TDR A;  4CCG X;  2MNY A;  4YAB A;  3V43 A;  1F62 A;  5D1L B;  4UI9 B;  1VFY A;  1U6G B;  2VNF A;  2ECT A;  3M99 A;  2F6N A;  2LXP C;  2EA6 A;  4CA1 A;  4ZDT A;  1WIM A;  2D8S A;  5DKA A;  5J3X A;  3MHH A;  5TDW A;  3RTR B;  4MSX A;  2KWJ A;  5D1M B;  5KH7 A;  1V87 A;  4FO9 A;  2CSZ A;  2K17 A;  2VPG A;  2YYR A;  3U5O A;  1K2F A;  2HYE D;  4QF2 A;  1X4U A;  2K4D A;  5LCW B;  2M6M A;  5D1K B;  2L0B A;  2MT5 A;  2YHO A;  2F42 A;  2MA6 A;  1BOR A;  4XI1 A;  3O33 A;  2L5U A;  3C5K A;  3C6W A;  4YBT A;  4A49 A;  3LQH A;  3SOX A;  4IC2 A;  3U5M A;  4BHW A;  4ZQL A;  1WEN A;  5B78 A;  3T6R A;  1T1H A;  4X3G A;  4R7E A;  4YBS A;  2ECV A;  4AUQ B;  2CSY A;  5B77 A;  3L1Z B;  2RSD A;  2LGV A;  3HCS A;  5EYA F;  2QJ0 A;  4FJC A;  2YT5 A;  1WEE A;  2LRI C;  4AYC B;  4WZ3 B;  2C2V S;  5FEY A;  5LKX A;  1N87 A;  2YQL A;  2E6R A;  3L1X A;  3GV4 A;  3SOU A;  4WA6 A;  1HYJ A;  2OXQ C;  4LLB A;  2ECN A;  2YSM A;  3MHS A;  4Q6F A;  2YHN A;  2EGP A;  5TBN A;  4C9Z A;  5C13 A;  1WGM A;  4PPE A;  2YUR A;  2MA5 A;  5TRB A;  3KNV A;  4YAX A;  5I3L A;  4W4U A;  2VJE A;  5H1T A;  4V3L C;  2KU3 A;  4LAD B;  4AYC A;  3PUQ A;  4ZUX U;  3EB5 A;  2VPB A;  1IYM A;  2YQM A;  1JOC A;  5B8D A;  5LKT A;  2G43 A;  2NAA A;  1WEU A;  4TKP B;  3N9P A;  4GND A;  3QZV A;  4PTB A;  1CHC A;  2E6S A;  4LJN A;  2MD8 C;  3N9N A;  3ZYQ A;  2PUY A;  2MNZ A;  2ZET C;  3N9Q A;  2KIZ A;  4LK9 A;  1JM7 B;  2UZG A;  2AN6 A;  2YSJ A;  1Z2Q A;  3O34 A;  1WEW A;  3NG2 A;  2IDA A;  2Y43 A;  2CKL A;  2PNX A;  2M85 A;  4A4B A;  4UP5 A;  4YBM A;  2EOD A;  3DPL R;  4UP0 A;  1FBV A;  2BAY A;  4GB0 A;  2LGG A;  4YC9 A;  5JG6 A;  2LGL A;  4WZ2 A;  2F6J A;  2JMD A;  4WZ0 A;  1WE9 A;  2FUU A;  2H0D B;  2XB1 A;  3O36 A;  1X4I A;  1WEP A;  4YAT A;  3I2D A;  1RMD A;  2RI7 A;  1LDK C;  3VK6 A;  4N3W A;  1Z60 A;  2M1R A;  3M62 A;  3HCT A;  5C11 A;  2YW8 A;  1ZBD B;  4B86 C;  4YAD A;  5LKZ A;  2LDR A;  1X4J A;  5G0F A;  2C2L A;  3KQI A;  5LKU A;  2FSA A;  3ZNI A;  2YU4 A;  1WEO A;  1WES A;  2L80 A;  2KYU A;  3RPG B;  4FK5 A;  3ZTG A;  2LN0 A;  3PHD A;  5KH3 A;  1E4U A;  1JM7 A;  1WFK A;  2QIC A;  1Z6U A;  3IHP A;  4P5O B;  2KFT A;  3EB6 A;  2LQ6 A;  3T7L A;  2JRJ A;  2ECJ A;  4GNE A;  2LGK A;  2JMI A;  5FB1 A;  2JMJ A;  4V3K C;  4GNG A;  2QIZ A;  3ZPV E;  2KGG A;  2FUI A;  5FB0 A;  2Y1M A;  2YUC A;  4R8P K;  4L58 A;  5FER A;  2KGI A;  4LKA A;  2L43 A;  2VPE A;  3LRQ A;  2KWK A;  4AVX A;  4N4F A;  2DX8 A;  2VJE B;  3ASL A;  3FL2 A;  2LV9 A;  3M63 A;  3ZPV 1;  2YRE A;  1WEM A;  2K1J A;  4NN2 A;  5B79 A;  2VP7 A;  2Y1N A;  2XEU A;  4S3O C;  3L11 A;  3ZVZ B;  1FP0 A;  3KV5 A;  1VYX A;  3U5N A;  4B7Y C;  2MIQ A;  2VJF B;  2I50 A;  1MM2 A;  2CT2 A;  2G45 A;  5TAB A;  5G05 B;  3DQV R;  5H9M A;  4I7D A;  4IC3 A;  2KWN A;  2MUM A;  1WEV A;  2ECI A;  2KRE A;  2KE1 A;  2HDP A;  2K16 A;  3N9O A;  4QF3 A;  1XWH A;  1HYI A;  2KR4 A;  3HCU A;  1WEQ A; 
#chains in the Genus database with same CATH topology
 2EXU A;  3PUR A;  3O7A A;  5H1V A;  5B75 A;  2G6Q A;  4L7X A;  3N9L A;  3H7H A;  5H1U A;  2JM3 A;  5DIN A;  2DSM A;  2YVR A;  4O64 A;  3LQI A;  4F1P A;  3SUB A;  3FJU B;  2VPD A;  1DVP A;  3SHB A;  4OGC A;  1MBM A;  3SOW A;  4I7C A;  3KV6 A;  2L75 A;  4MVT A;  1MM3 A;  3HTK C;  3ZVY A;  2LXH C;  1WIL A;  4I7B A;  2H0D A;  4F52 B;  3DWD A;  4FIP A;  2CKL B;  4GNF A;  3RPG C;  2KWO A;  2ECW A;  5G04 B;  4BBQ A;  1DCQ A;  3N9M A;  4A0C D;  2M13 A;  5KH9 A;  3PLW A;  1LDJ B;  1G25 A;  3O70 A;  3GL6 A;  4AP4 A;  1VD4 A;  3U5P A;  5AIU A;  3O37 A;  2ECG A;  4R2Y A;  3O35 A;  5SVX A;  3LQJ A;  5AIT A;  2MD7 B;  2VJF A;  2M3H A;  5B76 A;  4OGE A;  4A4C A;  4S3O B;  5TDR A;  4CCG X;  2MNY A;  4Z0O A;  4YAB A;  3V43 A;  1F62 A;  5D1L B;  2CON A;  4UI9 B;  1VFY A;  1U6G B;  2VNF A;  2ECT A;  3M99 A;  2CSV A;  2F6N A;  2LXP C;  2EA6 A;  4CA1 A;  4ZDT A;  4O62 A;  1WIM A;  2D8S A;  5DKA A;  5J3X A;  3MHH A;  5TDW A;  3LVQ E;  3FEH A;  3RTR B;  4MSX A;  2KWJ A;  5D1M B;  5KH7 A;  1V87 A;  4FO9 A;  2CSZ A;  2K17 A;  2VPG A;  3DDT A;  2YYR A;  3U5O A;  1K2F A;  2HYE D;  4QF2 A;  1X4U A;  5SVI A;  5K3Q A;  2E61 A;  2K4D A;  5LCW B;  2M6M A;  5D1K B;  2L0B A;  2MT5 A;  5SVI B;  2YHO A;  2F42 A;  2MA6 A;  1BOR A;  3O47 A;  2D8U A;  4XI1 A;  3O33 A;  2L5U A;  3C5K A;  3MDB C;  2IQJ A;  3C6W A;  4YBT A;  4A49 A;  3LQH A;  3SOX A;  3JUE A;  4IC2 A;  3U5M A;  4BHW A;  4ZQL A;  1WEN A;  5B78 A;  3T6R A;  1T1H A;  4X3G A;  4R7E A;  4YBS A;  4QQ4 A;  2ECV A;  4AUQ B;  2P57 A;  2CSY A;  5B77 A;  3L1Z B;  2RSD A;  2LGV A;  3HCS A;  5EYA F;  2MKE A;  2QJ0 A;  4FJC A;  2YT5 A;  1WEE A;  2LRI C;  4AYC B;  4WZ3 B;  2C2V S;  5FEY A;  5LKX A;  1N87 A;  2YQL A;  2E6R A;  3L1X A;  3GV4 A;  2JUN A;  3SOU A;  4WA6 A;  1HYJ A;  2OXQ C;  4LLB A;  2ECN A;  2YSM A;  3MHS A;  4Q6F A;  2YHN A;  2XOZ A;  2EGP A;  5TBN A;  4Z0R A;  4C9Z A;  5C13 A;  1WGM A;  4PPE A;  2YUR A;  2MA5 A;  5TRB A;  3KNV A;  4YAX A;  2OWA A;  5I3L A;  4W4U A;  2VJE A;  5H1T A;  4V3L C;  2KU3 A;  4LAD B;  4AYC A;  3PUQ A;  4ZUX U;  3EB5 A;  2VPB A;  1IYM A;  2YQM A;  1JOC A;  5B8D A;  5LKT A;  2G43 A;  2NAA A;  1WEU A;  4TKP B;  3N9P A;  4GND A;  3QZV A;  4PTB A;  1CHC A;  2E6S A;  4LJN A;  2MD8 C;  3N9N A;  3ZYQ A;  2PUY A;  2MNZ A;  2EGM A;  2ZET C;  3LJU X;  3N9Q A;  2KIZ A;  4LK9 A;  2CRW A;  1JM7 B;  2UZG A;  2AN6 A;  2YSJ A;  1Z2Q A;  3O34 A;  1WEW A;  3NG2 A;  2IDA A;  2Y43 A;  3FAN A;  2CKL A;  2PNX A;  2M85 A;  4A4B A;  4UP5 A;  4YBM A;  2EOD A;  3DPL R;  2FD4 A;  4UP0 A;  1FBV A;  2BAY A;  5SVY A;  4GB0 A;  2LGG A;  3FM8 C;  4YC9 A;  5JG6 A;  2B0O E;  2LGL A;  4WZ2 A;  2F6J A;  2JMD A;  4WZ0 A;  1WE9 A;  2FUU A;  2H0D B;  2XB1 A;  3O36 A;  3KDE C;  1X4I A;  1WEP A;  4YAT A;  3I2D A;  1RMD A;  3FAO A;  2RI7 A;  1LDK C;  4N3W A;  3VK6 A;  1Z60 A;  2M1R A;  2CRR A;  2DJA A;  3M62 A;  3M7K A;  2L7P A;  3HCT A;  3T9K A;  5C11 A;  2RR4 A;  2YW8 A;  2FFW A;  1ZBD B;  4B86 C;  4YAD A;  5LKZ A;  2LDR A;  1X4J A;  2XP0 A;  5G0F A;  2C2L A;  3KQI A;  5LKU A;  2FSA A;  3ZNI A;  2YU4 A;  1WEO A;  1WES A;  2L80 A;  2KYU A;  3RPG B;  4FK5 A;  3ZTG A;  2LN0 A;  3PHD A;  5KH3 A;  1E4U A;  1JM7 A;  1WFK A;  2QIC A;  1Z6U A;  3IHP A;  4P5O B;  2KFT A;  3EB6 A;  2LQ6 A;  3T7L A;  2JRJ A;  2ECJ A;  4GNE A;  2LGK A;  2JMI A;  5FB1 A;  2JMJ A;  3LDY A;  4V3K C;  4GNG A;  2QIZ A;  3ZPV E;  2KGG A;  2FUI A;  5FB0 A;  2Y1M A;  2YUC A;  4R8P K;  4L58 A;  5FER A;  2KGI A;  4LKA A;  2L43 A;  2VPE A;  2XOC A;  3LRQ A;  2KWK A;  4AVX A;  3Q1D A;  4N4F A;  2DX8 A;  2VJE B;  3ASL A;  3FL2 A;  2KKX A;  2LV9 A;  3M63 A;  3ZPV 1;  2YRE A;  1WEM A;  2K1J A;  2KKY A;  4NN2 A;  5B79 A;  2LAU A;  2VP7 A;  2Y1N A;  3LVR E;  2XEU A;  4S3O C;  3L11 A;  3ZVZ B;  1FP0 A;  3KV5 A;  1VYX A;  3U5N A;  4B7Y C;  3E2D A;  2MIQ A;  2VJF B;  2I50 A;  1MM2 A;  2CT2 A;  2G45 A;  5TAB A;  5G05 B;  3DQV R;  5H9M A;  4I7D A;  4IC3 A;  4H9D A;  2KWN A;  2MUM A;  1WEV A;  2ECI A;  2KRE A;  2KE1 A;  2HDP A;  2K16 A;  3N9O A;  2XOY A;  4QF3 A;  1XWH A;  1HYI A;  2KR4 A;  3HCU A;  1WEQ A; 
#chains in the Genus database with same CATH homology
 3PUR A;  3O7A A;  5H1V A;  5B75 A;  2G6Q A;  4L7X A;  3N9L A;  5H1U A;  5DIN A;  4O64 A;  3LQI A;  2VPD A;  1DVP A;  3SHB A;  3SOW A;  4I7C A;  3KV6 A;  2L75 A;  4MVT A;  1MM3 A;  3HTK C;  3ZVY A;  2LXH C;  1WIL A;  4I7B A;  2H0D A;  4F52 B;  4FIP A;  2CKL B;  4GNF A;  3RPG C;  2KWO A;  2ECW A;  5G04 B;  4BBQ A;  3N9M A;  4A0C D;  5KH9 A;  1LDJ B;  1G25 A;  3O70 A;  3GL6 A;  4AP4 A;  1VD4 A;  3U5P A;  5AIU A;  3O37 A;  2ECG A;  4R2Y A;  3O35 A;  3LQJ A;  5AIT A;  2MD7 B;  2VJF A;  2M3H A;  5B76 A;  4A4C A;  4S3O B;  5TDR A;  4CCG X;  2MNY A;  4YAB A;  3V43 A;  1F62 A;  5D1L B;  4UI9 B;  1VFY A;  1U6G B;  2VNF A;  2ECT A;  3M99 A;  2F6N A;  2LXP C;  2EA6 A;  4CA1 A;  4ZDT A;  1WIM A;  2D8S A;  5DKA A;  5J3X A;  3MHH A;  5TDW A;  3RTR B;  4MSX A;  2KWJ A;  5D1M B;  5KH7 A;  1V87 A;  4FO9 A;  2CSZ A;  2K17 A;  2VPG A;  2YYR A;  3U5O A;  1K2F A;  2HYE D;  4QF2 A;  1X4U A;  2K4D A;  5LCW B;  2M6M A;  5D1K B;  2L0B A;  2MT5 A;  2YHO A;  2F42 A;  2MA6 A;  1BOR A;  4XI1 A;  3O33 A;  2L5U A;  3C5K A;  3C6W A;  4YBT A;  4A49 A;  3LQH A;  3SOX A;  4IC2 A;  3U5M A;  4BHW A;  4ZQL A;  1WEN A;  5B78 A;  3T6R A;  1T1H A;  4X3G A;  4R7E A;  4YBS A;  2ECV A;  4AUQ B;  2CSY A;  5B77 A;  3L1Z B;  2RSD A;  2LGV A;  3HCS A;  5EYA F;  2QJ0 A;  4FJC A;  2YT5 A;  1WEE A;  2LRI C;  4AYC B;  4WZ3 B;  2C2V S;  5FEY A;  5LKX A;  1N87 A;  2YQL A;  2E6R A;  3L1X A;  3GV4 A;  3SOU A;  4WA6 A;  1HYJ A;  2OXQ C;  4LLB A;  2ECN A;  2YSM A;  3MHS A;  4Q6F A;  2YHN A;  2EGP A;  5TBN A;  4C9Z A;  5C13 A;  1WGM A;  4PPE A;  2YUR A;  2MA5 A;  5TRB A;  3KNV A;  4YAX A;  5I3L A;  4W4U A;  2VJE A;  5H1T A;  4V3L C;  2KU3 A;  4LAD B;  4AYC A;  3PUQ A;  4ZUX U;  3EB5 A;  2VPB A;  1IYM A;  2YQM A;  1JOC A;  5B8D A;  5LKT A;  2G43 A;  2NAA A;  1WEU A;  4TKP B;  3N9P A;  4GND A;  3QZV A;  4PTB A;  1CHC A;  2E6S A;  4LJN A;  2MD8 C;  3N9N A;  3ZYQ A;  2PUY A;  2MNZ A;  2ZET C;  3N9Q A;  2KIZ A;  4LK9 A;  1JM7 B;  2UZG A;  2AN6 A;  2YSJ A;  1Z2Q A;  3O34 A;  1WEW A;  3NG2 A;  2IDA A;  2Y43 A;  2CKL A;  2PNX A;  2M85 A;  4A4B A;  4UP5 A;  4YBM A;  2EOD A;  3DPL R;  4UP0 A;  1FBV A;  2BAY A;  4GB0 A;  2LGG A;  4YC9 A;  5JG6 A;  2LGL A;  4WZ2 A;  2F6J A;  2JMD A;  4WZ0 A;  1WE9 A;  2FUU A;  2H0D B;  2XB1 A;  3O36 A;  1X4I A;  1WEP A;  4YAT A;  3I2D A;  1RMD A;  2RI7 A;  1LDK C;  3VK6 A;  4N3W A;  1Z60 A;  2M1R A;  3M62 A;  3HCT A;  5C11 A;  2YW8 A;  1ZBD B;  4B86 C;  4YAD A;  5LKZ A;  2LDR A;  1X4J A;  5G0F A;  2C2L A;  3KQI A;  5LKU A;  2FSA A;  3ZNI A;  2YU4 A;  1WEO A;  1WES A;  2L80 A;  2KYU A;  3RPG B;  4FK5 A;  3ZTG A;  2LN0 A;  3PHD A;  5KH3 A;  1E4U A;  1JM7 A;  1WFK A;  2QIC A;  1Z6U A;  3IHP A;  4P5O B;  2KFT A;  3EB6 A;  2LQ6 A;  3T7L A;  2JRJ A;  2ECJ A;  4GNE A;  2LGK A;  2JMI A;  5FB1 A;  2JMJ A;  4V3K C;  4GNG A;  2QIZ A;  3ZPV E;  2KGG A;  2FUI A;  5FB0 A;  2Y1M A;  2YUC A;  4R8P K;  4L58 A;  5FER A;  2KGI A;  4LKA A;  2L43 A;  2VPE A;  3LRQ A;  2KWK A;  4AVX A;  4N4F A;  2DX8 A;  2VJE B;  3ASL A;  3FL2 A;  2LV9 A;  3M63 A;  3ZPV 1;  2YRE A;  1WEM A;  2K1J A;  4NN2 A;  5B79 A;  2VP7 A;  2Y1N A;  2XEU A;  4S3O C;  3L11 A;  3ZVZ B;  1FP0 A;  3KV5 A;  1VYX A;  3U5N A;  4B7Y C;  2MIQ A;  2VJF B;  2I50 A;  1MM2 A;  2CT2 A;  2G45 A;  5TAB A;  5G05 B;  3DQV R;  5H9M A;  4I7D A;  4IC3 A;  2KWN A;  2MUM A;  1WEV A;  2ECI A;  2KRE A;  2KE1 A;  2HDP A;  2K16 A;  3N9O A;  4QF3 A;  1XWH A;  1HYI A;  2KR4 A;  3HCU A;  1WEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...