3T7LA

Crystal structure of the fyve domain of endofin (zfyve16) at 1.1a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
LVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKEARVCVVCYETISKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Zinc finger FYVE domain-containing protein 16
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t7lA00
3M63A 4MVTA 4YATA 4GNEA 5KH9A 4LLBA 2CSZA 1CHCA 2F6JA 2HDPA 5JG6A 3U5MA 2K4DA 5DKAA 3PUQA 2KYUA 2E6SA 2KR4A 2G43A 2K1JA 3LQIA 3O7AA 4ZUXU 2ECWA 2L75A 4C9ZA 4W4UA 3U5OA 3ZVZB 2FUIA 3O37A 4GNGA 4A0CD 2YU4A 2MA5A 3L1XA 3ASLA 2I50A 3U5PA 2MNYA 2FUUA 4WZ3B 4YBTA 5AITA 5KH7A 2PUYA 3SOUA 4YBSA 4MSXA 2YW8A 4UP5A 1WEQA 2K17A 2FSAA 5LCWB 2LXHC 2D8SA 2JMDA 3MHSA 2QJ0A 1LDKC 4L58A 5G05B 1JOCA 1DVPA 3O34A 1WEEA 3HCSA 2DX8A 3N9OA 5C11A 5TDRA 1ZBDB 2LGVA 2L5UA 4I7DA 4O64A 2C2LA 2LGGA 2LGKA 4S3OC 3SOXA 4A4CA 4L7XA 2KREA 1RMDA 5J3XA 2LRIC 3T6RA 3PURA 5H1UA 2MT5A 2JMIA 4V3KC 2XEUA 2L0BA 4WZ0A 2MUMA 5TRBA 3RPGB 3EB5A 1FP0A 2YHOA 1IYMA 4UI9B 2AN6A 1WEOA 2M85A 4LADB 1VD4A 2KGGA 4AP4A 3O35A 3KV5A 4LJNA 4R7EA 2CT2A 2LN0A 2L43A 4YBMA 1LDJB 5LKUA 4AVXA 4NN2A 2KFTA 3V43A 2IDAA 3HTKC 2JRJA 5D1KB 2Y1NA 2LDRA 2KGIA 1JM7A 2EGPA 1WE9A 4FIPA 3ZPVE 1XWHA 1X4UA 4B86C 2CSYA 2XB1A 2ZETC 2ECNA 4BBQA 2YSJA 3L11A 4GNDA 3LQHA 2YUCA 4QF2A 5H9MA 5B77A 4CA1A 1E4UA 5G04B 3ZVYA 4A4BA 4UP0A 1HYIA 2OXQC 4AUQB 2EODA 3IHPA 4P5OB 5B78A 5TBNA 2YT5A 3N9PA 1WEPA 1X4IA 4FJCA 2KWKA 2ECIA 2VPEA 1V87A 5AIUA 2YQMA 4N3WA 4I7BA 5D1LB 3O70A 5B79A 4S3OB 2NAAA 4BHWA 3M99A 4ZQLA 2G45A 4ZDTA 4F52B 2KWNA 2LGLA 2M6MA 4GNFA 1FBVA 4WA6A 2MD8C 2LXPC 2VPBA 3N9NA 3O33A 2VJEB 5G0FA 2RSDA 4TKPB 2L80A 5B8DA 3C6WA 4YADA 2VP7A 5FEYA 3KNVA 2YURA 2KU3A 4FK5A 4QF3A 5EYAF 3KV6A 2H0DA 4R8PK 2RI7A 3VK6A 5LKXA 5DINA 2YSMA 3T7LA 1WILA 1WGMA 4AYCA 2YREA 2VPGA 3RPGC 2H0DB 1JM7B 2VNFA 2HYED 3ZNIA 2VJFB 3EB6A 5TDWA 1VYXA 4Q6FA 3SHBA 1WEMA 2G6QA 4X3GA 1WENA 3SOWA 1WEUA 2YHNA 3M62A 1Z60A 3DQVR 1HYJA 3KQIA 2CKLB 2QICA 3O36A 3U5NA 1MM3A 2MD7B 3MHHA 1X4JA 2CKLA 4B7YC 2Y43A 3N9QA 5H1VA 2QIZA 4N4FA 2YYRA 4WZ2A 2E6RA 4CCGX 3C5KA 1Z2QA 4IC2A 2ECVA 1WEWA 3ZYQA 2VJFA 3LRQA 2LV9A 2YQLA 5FERA 5FB1A 2VJEA 3N9MA 5D1MB 4R2YA 5I3LA 4I7CA 2MNZA 4YC9A 1Z6UA 5H1TA 2JMJA 2VPDA 1G25A 1BORA 2PNXA 3GV4A 3RTRB 4V3LC 5TABA 2MIQA 2KIZA 1N87A 4PPEA 1WIMA 2Y1MA 3FL2A 3QZVA 5C13A 2KE1A 2LQ6A 3HCTA 2MA6A 3HCUA 2ECTA 1WEVA 2BAYA 3NG2A 1U6GB 2KWOA 5LKZA 5KH3A 3I2DA 2ECJA 3DPLR 5LKTA 3PHDA 4YABA 2ECGA 1WFKA 1F62A 1WESA 3LQJA 4LKAA 4YAXA 4GB0A 5B75A 1MM2A 2F6NA 2EA6A 4A49A 3ZTGA 5B76A 4LK9A 2C2VS 2KWJA 2M1RA 4IC3A 2F42A 2M3HA 4PTBA 4XI1A 1VFYA 3L1ZB 1K2FA 3N9LA 1T1HA 3ZPV1 4AYCB 4FO9A 5FB0A 3GL6A 2UZGA 2K16A
chains in the Genus database with same CATH superfamily
2CRRA 3M63A 4MVTA 4YATA 4GNEA 5KH9A 4LLBA 2CSZA 2XOYA 1CHCA 2F6JA 2HDPA 3LVQE 5JG6A 3U5MA 2K4DA 5DKAA 3PUQA 2KYUA 2E6SA 2KR4A 2G43A 2K1JA 3LQIA 3O7AA 4ZUXU 2ECWA 2L75A 4C9ZA 4W4UA 3U5OA 3ZVZB 2FUIA 3FJUB 3O37A 4GNGA 4A0CD 2YU4A 2MA5A 3L1XA 3ASLA 2I50A 3U5PA 2MNYA 2FUUA 4WZ3B 4YBTA 1MBMA 5AITA 5KH7A 2PUYA 3T9KA 3SOUA 4YBSA 3O47A 4MSXA 2YW8A 4UP5A 1WEQA 4Z0OA 2K17A 2FSAA 5LCWB 2LXHC 2D8SA 2JMDA 3MHSA 2QJ0A 1LDKC 4L58A 2DSMA 5G05B 1JOCA 1DVPA 3O34A 3LDYA 1WEEA 3HCSA 2DX8A 2FD4A 3N9OA 3KDEC 5C11A 5TDRA 1ZBDB 2LGVA 2L5UA 4I7DA 4O64A 2EGMA 2C2LA 2LGGA 2LGKA 4S3OC 3SOXA 4A4CA 3FANA 4QQ4A 4L7XA 4Z0RA 2KREA 1RMDA 2E61A 5J3XA 2LRIC 3T6RA 3PURA 5H1UA 2B0OE 2MT5A 3MDBC 2JMIA 2KKXA 4V3KC 2XOCA 2XEUA 4WZ0A 2L0BA 2MUMA 5TRBA 3RPGB 3EB5A 1FP0A 2YHOA 1IYMA 4UI9B 2AN6A 1WEOA 2M85A 4LADB 1VD4A 2KGGA 4AP4A 3O35A 4F1PA 3KV5A 4LJNA 4R7EA 2CT2A 2LN0A 2L43A 2LAUA 4YBMA 1LDJB 5LKUA 4AVXA 4NN2A 2KFTA 3V43A 2IDAA 3HTKC 2JRJA 5D1KB 2Y1NA 2LDRA 2KGIA 1JM7A 2EGPA 1WE9A 4FIPA 3JUEA 3ZPVE 1XWHA 1X4UA 4B86C 2CSYA 2XB1A 2ZETC 2ECNA 4BBQA 2YSJA 3L11A 4GNDA 3LQHA 2P57A 2YUCA 2EXUA 4QF2A 5H9MA 5B77A 4CA1A 1E4UA 5G04B 3M7KA 3ZVYA 4A4BA 4UP0A 1HYIA 2OXQC 4AUQB 2EODA 3IHPA 4P5OB 5B78A 5TBNA 2YT5A 3N9PA 4OGEA 1WEPA 1X4IA 2JUNA 4FJCA 2KWKA 2ECIA 2VPEA 2CONA 1V87A 5AIUA 3PLWA 2YQMA 4N3WA 4I7BA 5D1LB 5SVIB 3O70A 5B79A 4S3OB 2NAAA 4BHWA 3DWDA 3M99A 3FAOA 4ZQLA 2G45A 4ZDTA 4F52B 2KWNA 2LGLA 2M6MA 3FEHA 4GNFA 1FBVA 2MKEA 3LVRE 4WA6A 5K3QA 2XOZA 2MD8C 2LXPC 2VPBA 3N9NA 3O33A 2VJEB 3DDTA 5G0FA 5SVIA 2RSDA 4TKPB 2L80A 5B8DA 3C6WA 4YADA 2VP7A 5FEYA 3KNVA 2YURA 2KU3A 4FK5A 4QF3A 5EYAF 4OGCA 3KV6A 2H0DA 4R8PK 2RI7A 5SVYA 3VK6A 5LKXA 5DINA 2YVRA 2YSMA 3T7LA 1WILA 1WGMA 4AYCA 2YREA 2VPGA 4O62A 3RPGC 2H0DB 1JM7B 2VNFA 2HYED 3ZNIA 2VJFB 3EB6A 5TDWA 1VYXA 2KKYA 2RR4A 4Q6FA 3SHBA 1WEMA 2G6QA 4X3GA 1WENA 3SOWA 1WEUA 2YHNA 3M62A 1Z60A 3DQVR 1HYJA 3KQIA 2CKLB 2D8UA 2QICA 3O36A 3U5NA 1MM3A 2MD7B 3MHHA 1X4JA 2CKLA 2Y43A 4B7YC 3N9QA 5H1VA 2QIZA 4N4FA 2YYRA 5SVXA 4WZ2A 2E6RA 4CCGX 3C5KA 1Z2QA 4IC2A 2ECVA 1WEWA 3ZYQA 2JM3A 2VJFA 3LRQA 2LV9A 2CSVA 2YQLA 5FERA 5FB1A 2VJEA 3N9MA 5D1MB 4R2YA 5I3LA 4I7CA 2MNZA 4YC9A 1Z6UA 2OWAA 5H1TA 2JMJA 2VPDA 1G25A 1BORA 2PNXA 3GV4A 3RTRB 4V3LC 5TABA 2MIQA 2KIZA 1N87A 4PPEA 1WIMA 2Y1MA 3FL2A 3QZVA 2FFWA 5C13A 2KE1A 2LQ6A 3HCTA 2MA6A 3HCUA 2ECTA 1WEVA 2BAYA 3NG2A 1U6GB 2KWOA 2IQJA 5LKZA 5KH3A 3I2DA 2ECJA 4H9DA 3LJUX 3DPLR 3E2DA 5LKTA 3PHDA 4YABA 2ECGA 1WFKA 1F62A 1WESA 3LQJA 4LKAA 4YAXA 4GB0A 5B75A 1MM2A 2CRWA 2F6NA 2EA6A 4A49A 3ZTGA 5B76A 4LK9A 2XP0A 2C2VS 2DJAA 2KWJA 2M1RA 4IC3A 2L7PA 2F42A 2M3HA 3FM8C 4PTBA 4XI1A 3H7HA 1VFYA 3L1ZB 1K2FA 1DCQA 3SUBA 3N9LA 1T1HA 3ZPV1 4AYCB 4FO9A 5FB0A 3GL6A 2UZGA 2M13A 3Q1DA 2K16A
chains in the Genus database with same CATH topology
3M63A 4MVTA 4YATA 4GNEA 5KH9A 4LLBA 2CSZA 1CHCA 2F6JA 2HDPA 5JG6A 3U5MA 2K4DA 5DKAA 3PUQA 2KYUA 2E6SA 2KR4A 2G43A 2K1JA 3LQIA 3O7AA 4ZUXU 2ECWA 2L75A 4C9ZA 4W4UA 3U5OA 3ZVZB 2FUIA 3O37A 4GNGA 4A0CD 2YU4A 2MA5A 3L1XA 3ASLA 2I50A 3U5PA 2MNYA 2FUUA 4WZ3B 4YBTA 5AITA 5KH7A 2PUYA 3SOUA 4YBSA 4MSXA 2YW8A 4UP5A 1WEQA 2K17A 2FSAA 5LCWB 2LXHC 2D8SA 2JMDA 3MHSA 2QJ0A 1LDKC 4L58A 5G05B 1JOCA 1DVPA 3O34A 1WEEA 3HCSA 2DX8A 3N9OA 5C11A 5TDRA 1ZBDB 2LGVA 2L5UA 4I7DA 4O64A 2C2LA 2LGGA 2LGKA 4S3OC 3SOXA 4A4CA 4L7XA 2KREA 1RMDA 5J3XA 2LRIC 3T6RA 3PURA 5H1UA 2MT5A 2JMIA 4V3KC 2XEUA 2L0BA 4WZ0A 2MUMA 5TRBA 3RPGB 3EB5A 1FP0A 2YHOA 1IYMA 4UI9B 2AN6A 1WEOA 2M85A 4LADB 1VD4A 2KGGA 4AP4A 3O35A 3KV5A 4LJNA 4R7EA 2CT2A 2LN0A 2L43A 4YBMA 1LDJB 5LKUA 4AVXA 4NN2A 2KFTA 3V43A 2IDAA 3HTKC 2JRJA 5D1KB 2Y1NA 2LDRA 2KGIA 1JM7A 2EGPA 1WE9A 4FIPA 3ZPVE 1XWHA 1X4UA 4B86C 2CSYA 2XB1A 2ZETC 2ECNA 4BBQA 2YSJA 3L11A 4GNDA 3LQHA 2YUCA 4QF2A 5H9MA 5B77A 4CA1A 1E4UA 5G04B 3ZVYA 4A4BA 4UP0A 1HYIA 2OXQC 4AUQB 2EODA 3IHPA 4P5OB 5B78A 5TBNA 2YT5A 3N9PA 1WEPA 1X4IA 4FJCA 2KWKA 2ECIA 2VPEA 1V87A 5AIUA 2YQMA 4N3WA 4I7BA 5D1LB 3O70A 5B79A 4S3OB 2NAAA 4BHWA 3M99A 4ZQLA 2G45A 4ZDTA 4F52B 2KWNA 2LGLA 2M6MA 4GNFA 1FBVA 4WA6A 2MD8C 2LXPC 2VPBA 3N9NA 3O33A 2VJEB 5G0FA 2RSDA 4TKPB 2L80A 5B8DA 3C6WA 4YADA 2VP7A 5FEYA 3KNVA 2YURA 2KU3A 4FK5A 4QF3A 5EYAF 3KV6A 2H0DA 4R8PK 2RI7A 3VK6A 5LKXA 5DINA 2YSMA 3T7LA 1WILA 1WGMA 4AYCA 2YREA 2VPGA 3RPGC 2H0DB 1JM7B 2VNFA 2HYED 3ZNIA 2VJFB 3EB6A 5TDWA 1VYXA 4Q6FA 3SHBA 1WEMA 2G6QA 4X3GA 1WENA 3SOWA 1WEUA 2YHNA 3M62A 1Z60A 3DQVR 1HYJA 3KQIA 2CKLB 2QICA 3O36A 3U5NA 1MM3A 2MD7B 3MHHA 1X4JA 2CKLA 4B7YC 2Y43A 3N9QA 5H1VA 2QIZA 4N4FA 2YYRA 4WZ2A 2E6RA 4CCGX 3C5KA 1Z2QA 4IC2A 2ECVA 1WEWA 3ZYQA 2VJFA 3LRQA 2LV9A 2YQLA 5FERA 5FB1A 2VJEA 3N9MA 5D1MB 4R2YA 5I3LA 4I7CA 2MNZA 4YC9A 1Z6UA 5H1TA 2JMJA 2VPDA 1G25A 1BORA 2PNXA 3GV4A 3RTRB 4V3LC 5TABA 2MIQA 2KIZA 1N87A 4PPEA 1WIMA 2Y1MA 3FL2A 3QZVA 5C13A 2KE1A 2LQ6A 3HCTA 2MA6A 3HCUA 2ECTA 1WEVA 2BAYA 3NG2A 1U6GB 2KWOA 5LKZA 5KH3A 3I2DA 2ECJA 3DPLR 5LKTA 3PHDA 4YABA 2ECGA 1WFKA 1F62A 1WESA 3LQJA 4LKAA 4YAXA 4GB0A 5B75A 1MM2A 2F6NA 2EA6A 4A49A 3ZTGA 5B76A 4LK9A 2C2VS 2KWJA 2M1RA 4IC3A 2F42A 2M3HA 4PTBA 4XI1A 1VFYA 3L1ZB 1K2FA 3N9LA 1T1HA 3ZPV1 4AYCB 4FO9A 5FB0A 3GL6A 2UZGA 2K16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  4MVT A;  4YAT A;  4GNE A;  5KH9 A;  4LLB A;  2CSZ A;  1CHC A;  2F6J A;  2HDP A;  5JG6 A;  3U5M A;  2K4D A;  5DKA A;  3PUQ A;  2KYU A;  2E6S A;  2KR4 A;  2G43 A;  2K1J A;  3LQI A;  3O7A A;  4ZUX U;  2ECW A;  2L75 A;  4C9Z A;  4W4U A;  3U5O A;  3ZVZ B;  2FUI A;  3O37 A;  4GNG A;  4A0C D;  2YU4 A;  2MA5 A;  3L1X A;  3ASL A;  2I50 A;  3U5P A;  2MNY A;  2FUU A;  4WZ3 B;  4YBT A;  5AIT A;  5KH7 A;  2PUY A;  3SOU A;  4YBS A;  4MSX A;  2YW8 A;  4UP5 A;  1WEQ A;  2K17 A;  2FSA A;  5LCW B;  2LXH C;  2D8S A;  2JMD A;  3MHS A;  2QJ0 A;  1LDK C;  4L58 A;  5G05 B;  1JOC A;  1DVP A;  3O34 A;  1WEE A;  3HCS A;  2DX8 A;  3N9O A;  5C11 A;  5TDR A;  1ZBD B;  2LGV A;  2L5U A;  4I7D A;  4O64 A;  2C2L A;  2LGG A;  2LGK A;  4S3O C;  3SOX A;  4A4C A;  4L7X A;  2KRE A;  1RMD A;  5J3X A;  2LRI C;  3T6R A;  3PUR A;  5H1U A;  2MT5 A;  2JMI A;  4V3K C;  2XEU A;  2L0B A;  4WZ0 A;  2MUM A;  5TRB A;  3RPG B;  3EB5 A;  1FP0 A;  2YHO A;  1IYM A;  4UI9 B;  2AN6 A;  1WEO A;  2M85 A;  4LAD B;  1VD4 A;  2KGG A;  4AP4 A;  3O35 A;  3KV5 A;  4LJN A;  4R7E A;  2CT2 A;  2LN0 A;  2L43 A;  4YBM A;  1LDJ B;  5LKU A;  4AVX A;  4NN2 A;  2KFT A;  3V43 A;  2IDA A;  3HTK C;  2JRJ A;  5D1K B;  2Y1N A;  2LDR A;  2KGI A;  1JM7 A;  2EGP A;  1WE9 A;  4FIP A;  3ZPV E;  1XWH A;  1X4U A;  4B86 C;  2CSY A;  2XB1 A;  2ZET C;  2ECN A;  4BBQ A;  2YSJ A;  3L11 A;  4GND A;  3LQH A;  2YUC A;  4QF2 A;  5H9M A;  5B77 A;  4CA1 A;  1E4U A;  5G04 B;  3ZVY A;  4A4B A;  4UP0 A;  1HYI A;  2OXQ C;  4AUQ B;  2EOD A;  3IHP A;  4P5O B;  5B78 A;  5TBN A;  2YT5 A;  3N9P A;  1WEP A;  1X4I A;  4FJC A;  2KWK A;  2ECI A;  2VPE A;  1V87 A;  5AIU A;  2YQM A;  4N3W A;  4I7B A;  5D1L B;  3O70 A;  5B79 A;  4S3O B;  2NAA A;  4BHW A;  3M99 A;  4ZQL A;  2G45 A;  4ZDT A;  4F52 B;  2KWN A;  2LGL A;  2M6M A;  4GNF A;  1FBV A;  4WA6 A;  2MD8 C;  2LXP C;  2VPB A;  3N9N A;  3O33 A;  2VJE B;  5G0F A;  2RSD A;  4TKP B;  2L80 A;  5B8D A;  3C6W A;  4YAD A;  2VP7 A;  5FEY A;  3KNV A;  2YUR A;  2KU3 A;  4FK5 A;  4QF3 A;  5EYA F;  3KV6 A;  2H0D A;  4R8P K;  2RI7 A;  3VK6 A;  5LKX A;  5DIN A;  2YSM A;  3T7L A;  1WIL A;  1WGM A;  4AYC A;  2YRE A;  2VPG A;  3RPG C;  2H0D B;  1JM7 B;  2VNF A;  2HYE D;  3ZNI A;  2VJF B;  3EB6 A;  5TDW A;  1VYX A;  4Q6F A;  3SHB A;  1WEM A;  2G6Q A;  4X3G A;  1WEN A;  3SOW A;  1WEU A;  2YHN A;  3M62 A;  1Z60 A;  3DQV R;  1HYJ A;  3KQI A;  2CKL B;  2QIC A;  3O36 A;  3U5N A;  1MM3 A;  2MD7 B;  3MHH A;  1X4J A;  2CKL A;  4B7Y C;  2Y43 A;  3N9Q A;  5H1V A;  2QIZ A;  4N4F A;  2YYR A;  4WZ2 A;  2E6R A;  4CCG X;  3C5K A;  1Z2Q A;  4IC2 A;  2ECV A;  1WEW A;  3ZYQ A;  2VJF A;  3LRQ A;  2LV9 A;  2YQL A;  5FER A;  5FB1 A;  2VJE A;  3N9M A;  5D1M B;  4R2Y A;  5I3L A;  4I7C A;  2MNZ A;  4YC9 A;  1Z6U A;  5H1T A;  2JMJ A;  2VPD A;  1G25 A;  1BOR A;  2PNX A;  3GV4 A;  3RTR B;  4V3L C;  5TAB A;  2MIQ A;  2KIZ A;  1N87 A;  4PPE A;  1WIM A;  2Y1M A;  3FL2 A;  3QZV A;  5C13 A;  2KE1 A;  2LQ6 A;  3HCT A;  2MA6 A;  3HCU A;  2ECT A;  1WEV A;  2BAY A;  3NG2 A;  1U6G B;  2KWO A;  5LKZ A;  5KH3 A;  3I2D A;  2ECJ A;  3DPL R;  5LKT A;  3PHD A;  4YAB A;  2ECG A;  1WFK A;  1F62 A;  1WES A;  3LQJ A;  4LKA A;  4YAX A;  4GB0 A;  5B75 A;  1MM2 A;  2F6N A;  2EA6 A;  4A49 A;  3ZTG A;  5B76 A;  4LK9 A;  2C2V S;  2KWJ A;  2M1R A;  4IC3 A;  2F42 A;  2M3H A;  4PTB A;  4XI1 A;  1VFY A;  3L1Z B;  1K2F A;  3N9L A;  1T1H A;  3ZPV 1;  4AYC B;  4FO9 A;  5FB0 A;  3GL6 A;  2UZG A;  2K16 A; 
#chains in the Genus database with same CATH topology
 2CRR A;  3M63 A;  4MVT A;  4YAT A;  4GNE A;  5KH9 A;  4LLB A;  2CSZ A;  2XOY A;  1CHC A;  2F6J A;  2HDP A;  3LVQ E;  5JG6 A;  3U5M A;  2K4D A;  5DKA A;  3PUQ A;  2KYU A;  2E6S A;  2KR4 A;  2G43 A;  2K1J A;  3LQI A;  3O7A A;  4ZUX U;  2ECW A;  2L75 A;  4C9Z A;  4W4U A;  3U5O A;  3ZVZ B;  2FUI A;  3FJU B;  3O37 A;  4GNG A;  4A0C D;  2YU4 A;  2MA5 A;  3L1X A;  3ASL A;  2I50 A;  3U5P A;  2MNY A;  2FUU A;  4WZ3 B;  4YBT A;  1MBM A;  5AIT A;  5KH7 A;  2PUY A;  3T9K A;  3SOU A;  4YBS A;  3O47 A;  4MSX A;  2YW8 A;  4UP5 A;  1WEQ A;  4Z0O A;  2K17 A;  2FSA A;  5LCW B;  2LXH C;  2D8S A;  2JMD A;  3MHS A;  2QJ0 A;  1LDK C;  4L58 A;  2DSM A;  5G05 B;  1JOC A;  1DVP A;  3O34 A;  3LDY A;  1WEE A;  3HCS A;  2DX8 A;  2FD4 A;  3N9O A;  3KDE C;  5C11 A;  5TDR A;  1ZBD B;  2LGV A;  2L5U A;  4I7D A;  4O64 A;  2EGM A;  2C2L A;  2LGG A;  2LGK A;  4S3O C;  3SOX A;  4A4C A;  3FAN A;  4QQ4 A;  4L7X A;  4Z0R A;  2KRE A;  1RMD A;  2E61 A;  5J3X A;  2LRI C;  3T6R A;  3PUR A;  5H1U A;  2B0O E;  2MT5 A;  3MDB C;  2JMI A;  2KKX A;  4V3K C;  2XOC A;  2XEU A;  4WZ0 A;  2L0B A;  2MUM A;  5TRB A;  3RPG B;  3EB5 A;  1FP0 A;  2YHO A;  1IYM A;  4UI9 B;  2AN6 A;  1WEO A;  2M85 A;  4LAD B;  1VD4 A;  2KGG A;  4AP4 A;  3O35 A;  4F1P A;  3KV5 A;  4LJN A;  4R7E A;  2CT2 A;  2LN0 A;  2L43 A;  2LAU A;  4YBM A;  1LDJ B;  5LKU A;  4AVX A;  4NN2 A;  2KFT A;  3V43 A;  2IDA A;  3HTK C;  2JRJ A;  5D1K B;  2Y1N A;  2LDR A;  2KGI A;  1JM7 A;  2EGP A;  1WE9 A;  4FIP A;  3JUE A;  3ZPV E;  1XWH A;  1X4U A;  4B86 C;  2CSY A;  2XB1 A;  2ZET C;  2ECN A;  4BBQ A;  2YSJ A;  3L11 A;  4GND A;  3LQH A;  2P57 A;  2YUC A;  2EXU A;  4QF2 A;  5H9M A;  5B77 A;  4CA1 A;  1E4U A;  5G04 B;  3M7K A;  3ZVY A;  4A4B A;  4UP0 A;  1HYI A;  2OXQ C;  4AUQ B;  2EOD A;  3IHP A;  4P5O B;  5B78 A;  5TBN A;  2YT5 A;  3N9P A;  4OGE A;  1WEP A;  1X4I A;  2JUN A;  4FJC A;  2KWK A;  2ECI A;  2VPE A;  2CON A;  1V87 A;  5AIU A;  3PLW A;  2YQM A;  4N3W A;  4I7B A;  5D1L B;  5SVI B;  3O70 A;  5B79 A;  4S3O B;  2NAA A;  4BHW A;  3DWD A;  3M99 A;  3FAO A;  4ZQL A;  2G45 A;  4ZDT A;  4F52 B;  2KWN A;  2LGL A;  2M6M A;  3FEH A;  4GNF A;  1FBV A;  2MKE A;  3LVR E;  4WA6 A;  5K3Q A;  2XOZ A;  2MD8 C;  2LXP C;  2VPB A;  3N9N A;  3O33 A;  2VJE B;  3DDT A;  5G0F A;  5SVI A;  2RSD A;  4TKP B;  2L80 A;  5B8D A;  3C6W A;  4YAD A;  2VP7 A;  5FEY A;  3KNV A;  2YUR A;  2KU3 A;  4FK5 A;  4QF3 A;  5EYA F;  4OGC A;  3KV6 A;  2H0D A;  4R8P K;  2RI7 A;  5SVY A;  3VK6 A;  5LKX A;  5DIN A;  2YVR A;  2YSM A;  3T7L A;  1WIL A;  1WGM A;  4AYC A;  2YRE A;  2VPG A;  4O62 A;  3RPG C;  2H0D B;  1JM7 B;  2VNF A;  2HYE D;  3ZNI A;  2VJF B;  3EB6 A;  5TDW A;  1VYX A;  2KKY A;  2RR4 A;  4Q6F A;  3SHB A;  1WEM A;  2G6Q A;  4X3G A;  1WEN A;  3SOW A;  1WEU A;  2YHN A;  3M62 A;  1Z60 A;  3DQV R;  1HYJ A;  3KQI A;  2CKL B;  2D8U A;  2QIC A;  3O36 A;  3U5N A;  1MM3 A;  2MD7 B;  3MHH A;  1X4J A;  2CKL A;  2Y43 A;  4B7Y C;  3N9Q A;  5H1V A;  2QIZ A;  4N4F A;  2YYR A;  5SVX A;  4WZ2 A;  2E6R A;  4CCG X;  3C5K A;  1Z2Q A;  4IC2 A;  2ECV A;  1WEW A;  3ZYQ A;  2JM3 A;  2VJF A;  3LRQ A;  2LV9 A;  2CSV A;  2YQL A;  5FER A;  5FB1 A;  2VJE A;  3N9M A;  5D1M B;  4R2Y A;  5I3L A;  4I7C A;  2MNZ A;  4YC9 A;  1Z6U A;  2OWA A;  5H1T A;  2JMJ A;  2VPD A;  1G25 A;  1BOR A;  2PNX A;  3GV4 A;  3RTR B;  4V3L C;  5TAB A;  2MIQ A;  2KIZ A;  1N87 A;  4PPE A;  1WIM A;  2Y1M A;  3FL2 A;  3QZV A;  2FFW A;  5C13 A;  2KE1 A;  2LQ6 A;  3HCT A;  2MA6 A;  3HCU A;  2ECT A;  1WEV A;  2BAY A;  3NG2 A;  1U6G B;  2KWO A;  2IQJ A;  5LKZ A;  5KH3 A;  3I2D A;  2ECJ A;  4H9D A;  3LJU X;  3DPL R;  3E2D A;  5LKT A;  3PHD A;  4YAB A;  2ECG A;  1WFK A;  1F62 A;  1WES A;  3LQJ A;  4LKA A;  4YAX A;  4GB0 A;  5B75 A;  1MM2 A;  2CRW A;  2F6N A;  2EA6 A;  4A49 A;  3ZTG A;  5B76 A;  4LK9 A;  2XP0 A;  2C2V S;  2DJA A;  2KWJ A;  2M1R A;  4IC3 A;  2L7P A;  2F42 A;  2M3H A;  3FM8 C;  4PTB A;  4XI1 A;  3H7H A;  1VFY A;  3L1Z B;  1K2F A;  1DCQ A;  3SUB A;  3N9L A;  1T1H A;  3ZPV 1;  4AYC B;  4FO9 A;  5FB0 A;  3GL6 A;  2UZG A;  2M13 A;  3Q1D A;  2K16 A; 
#chains in the Genus database with same CATH homology
 3M63 A;  4MVT A;  4YAT A;  4GNE A;  5KH9 A;  4LLB A;  2CSZ A;  1CHC A;  2F6J A;  2HDP A;  5JG6 A;  3U5M A;  2K4D A;  5DKA A;  3PUQ A;  2KYU A;  2E6S A;  2KR4 A;  2G43 A;  2K1J A;  3LQI A;  3O7A A;  4ZUX U;  2ECW A;  2L75 A;  4C9Z A;  4W4U A;  3U5O A;  3ZVZ B;  2FUI A;  3O37 A;  4GNG A;  4A0C D;  2YU4 A;  2MA5 A;  3L1X A;  3ASL A;  2I50 A;  3U5P A;  2MNY A;  2FUU A;  4WZ3 B;  4YBT A;  5AIT A;  5KH7 A;  2PUY A;  3SOU A;  4YBS A;  4MSX A;  2YW8 A;  4UP5 A;  1WEQ A;  2K17 A;  2FSA A;  5LCW B;  2LXH C;  2D8S A;  2JMD A;  3MHS A;  2QJ0 A;  1LDK C;  4L58 A;  5G05 B;  1JOC A;  1DVP A;  3O34 A;  1WEE A;  3HCS A;  2DX8 A;  3N9O A;  5C11 A;  5TDR A;  1ZBD B;  2LGV A;  2L5U A;  4I7D A;  4O64 A;  2C2L A;  2LGG A;  2LGK A;  4S3O C;  3SOX A;  4A4C A;  4L7X A;  2KRE A;  1RMD A;  5J3X A;  2LRI C;  3T6R A;  3PUR A;  5H1U A;  2MT5 A;  2JMI A;  4V3K C;  2XEU A;  2L0B A;  4WZ0 A;  2MUM A;  5TRB A;  3RPG B;  3EB5 A;  1FP0 A;  2YHO A;  1IYM A;  4UI9 B;  2AN6 A;  1WEO A;  2M85 A;  4LAD B;  1VD4 A;  2KGG A;  4AP4 A;  3O35 A;  3KV5 A;  4LJN A;  4R7E A;  2CT2 A;  2LN0 A;  2L43 A;  4YBM A;  1LDJ B;  5LKU A;  4AVX A;  4NN2 A;  2KFT A;  3V43 A;  2IDA A;  3HTK C;  2JRJ A;  5D1K B;  2Y1N A;  2LDR A;  2KGI A;  1JM7 A;  2EGP A;  1WE9 A;  4FIP A;  3ZPV E;  1XWH A;  1X4U A;  4B86 C;  2CSY A;  2XB1 A;  2ZET C;  2ECN A;  4BBQ A;  2YSJ A;  3L11 A;  4GND A;  3LQH A;  2YUC A;  4QF2 A;  5H9M A;  5B77 A;  4CA1 A;  1E4U A;  5G04 B;  3ZVY A;  4A4B A;  4UP0 A;  1HYI A;  2OXQ C;  4AUQ B;  2EOD A;  3IHP A;  4P5O B;  5B78 A;  5TBN A;  2YT5 A;  3N9P A;  1WEP A;  1X4I A;  4FJC A;  2KWK A;  2ECI A;  2VPE A;  1V87 A;  5AIU A;  2YQM A;  4N3W A;  4I7B A;  5D1L B;  3O70 A;  5B79 A;  4S3O B;  2NAA A;  4BHW A;  3M99 A;  4ZQL A;  2G45 A;  4ZDT A;  4F52 B;  2KWN A;  2LGL A;  2M6M A;  4GNF A;  1FBV A;  4WA6 A;  2MD8 C;  2LXP C;  2VPB A;  3N9N A;  3O33 A;  2VJE B;  5G0F A;  2RSD A;  4TKP B;  2L80 A;  5B8D A;  3C6W A;  4YAD A;  2VP7 A;  5FEY A;  3KNV A;  2YUR A;  2KU3 A;  4FK5 A;  4QF3 A;  5EYA F;  3KV6 A;  2H0D A;  4R8P K;  2RI7 A;  3VK6 A;  5LKX A;  5DIN A;  2YSM A;  3T7L A;  1WIL A;  1WGM A;  4AYC A;  2YRE A;  2VPG A;  3RPG C;  2H0D B;  1JM7 B;  2VNF A;  2HYE D;  3ZNI A;  2VJF B;  3EB6 A;  5TDW A;  1VYX A;  4Q6F A;  3SHB A;  1WEM A;  2G6Q A;  4X3G A;  1WEN A;  3SOW A;  1WEU A;  2YHN A;  3M62 A;  1Z60 A;  3DQV R;  1HYJ A;  3KQI A;  2CKL B;  2QIC A;  3O36 A;  3U5N A;  1MM3 A;  2MD7 B;  3MHH A;  1X4J A;  2CKL A;  4B7Y C;  2Y43 A;  3N9Q A;  5H1V A;  2QIZ A;  4N4F A;  2YYR A;  4WZ2 A;  2E6R A;  4CCG X;  3C5K A;  1Z2Q A;  4IC2 A;  2ECV A;  1WEW A;  3ZYQ A;  2VJF A;  3LRQ A;  2LV9 A;  2YQL A;  5FER A;  5FB1 A;  2VJE A;  3N9M A;  5D1M B;  4R2Y A;  5I3L A;  4I7C A;  2MNZ A;  4YC9 A;  1Z6U A;  5H1T A;  2JMJ A;  2VPD A;  1G25 A;  1BOR A;  2PNX A;  3GV4 A;  3RTR B;  4V3L C;  5TAB A;  2MIQ A;  2KIZ A;  1N87 A;  4PPE A;  1WIM A;  2Y1M A;  3FL2 A;  3QZV A;  5C13 A;  2KE1 A;  2LQ6 A;  3HCT A;  2MA6 A;  3HCU A;  2ECT A;  1WEV A;  2BAY A;  3NG2 A;  1U6G B;  2KWO A;  5LKZ A;  5KH3 A;  3I2D A;  2ECJ A;  3DPL R;  5LKT A;  3PHD A;  4YAB A;  2ECG A;  1WFK A;  1F62 A;  1WES A;  3LQJ A;  4LKA A;  4YAX A;  4GB0 A;  5B75 A;  1MM2 A;  2F6N A;  2EA6 A;  4A49 A;  3ZTG A;  5B76 A;  4LK9 A;  2C2V S;  2KWJ A;  2M1R A;  4IC3 A;  2F42 A;  2M3H A;  4PTB A;  4XI1 A;  1VFY A;  3L1Z B;  1K2F A;  3N9L A;  1T1H A;  3ZPV 1;  4AYC B;  4FO9 A;  5FB0 A;  3GL6 A;  2UZG A;  2K16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...