3T7LA

Crystal structure of the fyve domain of endofin (zfyve16) at 1.1a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
LVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKEARVCVVCYETISKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Zinc finger FYVE domain-containing protein 16
publication title Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution
rcsb
source organism Homo sapiens
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t7lA00
1WE9A 4I7BA 1Z6UA 2H0DA 1HYIA 3PURA 2LXPC 3O36A 2VJEA 2YHNA 2M3HA 5LKUA 4MSXA 2MA5A 1U6GB 1WEWA 4YBMA 3V43A 1WEVA 3HCTA 4YADA 4LJNA 3M63A 2LXHC 3ZVYA 4AYCA 3L1XA 2KWNA 1BORA 2L0BA 2AN6A 2QJ0A 2LRIC 2Y1NA 1WEOA 2EGPA 2FUUA 4GNDA 4A4CA 5EYAF 3PUQA 3RPGB 1G25A 5KH3A 2ECNA 2VNFA 4I7CA 2ECVA 3IHPA 4N4FA 3SOXA 5TABA 3O33A 3LQHA 4GNGA 4QF2A 4YABA 4O64A 1WEEA 3O34A 5LKXA 4UI9B 2ZETC 1JM7B 4FJCA 3SHBA 4B7YC 5G04B 4LADB 4IC2A 4R7EA 4L7XA 2K17A 5B78A 3GL6A 3O35A 2G45A 3ZYQA 4L58A 2ECJA 2EODA 3MHHA 2YSJA 2DX8A 2CKLB 2UZGA 4Q6FA 2XB1A 2JRJA 2LGLA 2K1JA 3O70A 1WEQA 3C5KA 4UP5A 2JMDA 3DPLR 3I2DA 3M99A 1WGMA 1LDKC 2KYUA 2VPDA 4P5OB 3HCSA 3KNVA 4LK9A 4V3LC 2QICA 2KWOA 4AVXA 5FERA 1HYJA 4ZDTA 2VP7A 2YW8A 2KIZA 3L1ZB 2HYED 2VJFA 2ECWA 4S3OB 4F52B 2KU3A 2VPEA 4C9ZA 2YT5A 3M62A 2MT5A 4TKPB 2OXQC 3RTRB 2MIQA 5FB1A 3DQVR 2E6SA 1FP0A 1DVPA 4A0CD 2M1RA 1MM2A 4WZ2A 1WIMA 2D8SA 1V87A 1XWHA 3T6RA 1T1HA 3KV5A 3LQIA 2LGVA 4GNFA 2IDAA 3T7LA 2F42A 4GB0A 4UP0A 3N9OA 4A4BA 5H1TA 5D1LB 4A49A 2I50A 2C2VS 3N9QA 5D1MB 5B76A 1ZBDB 3LQJA 1K2FA 2LGGA 4WZ3B 3QZVA 4YATA 1JOCA 4PPEA 4GNEA 5DKAA 1FBVA 2RI7A 3N9LA 2H0DB 2KREA 2CT2A 2VJEB 2XEUA 5G0FA 1WESA 3SOUA 4R8PK 3C6WA 5KH7A 5JG6A 3EB6A 3HCUA 5LKTA 1MM3A 2YSMA 4AP4A 4AYCB 2MD7B 2YU4A 2NAAA 1X4JA 2M85A 5FB0A 2RSDA 2F6JA 2G6QA 2KGIA 2LQ6A 4CCGX 2ECIA 3RPGC 2LGKA 2HDPA 5H1UA 1Z60A 3GV4A 2ECTA 3N9PA 4ZQLA 2YHOA 4X3GA 5C13A 3LRQA 5B75A 2LV9A 3ASLA 5TRBA 1VD4A 2EA6A 3KQIA 2MA6A 5TDWA 5B8DA 4FK5A 4QF3A 1JM7A 5KH9A 3U5NA 4YBSA 5AIUA 2G43A 1VFYA 2JMIA 1IYMA 1LDJB 2MD8C 5H9MA 4WA6A 1N87A 3EB5A 5LKZA 2KFTA 4V3KC 4XI1A 2CKLA 4LLBA 4NN2A 3MHSA 2Y43A 5H1VA 1WEMA 4YAXA 2VPGA 3ZTGA 5FEYA 2YUCA 5TBNA 2KGGA 2YURA 1X4IA 4N3WA 2KWJA 1CHCA 2QIZA 4B86C 2VPBA 3ZPVE 5B79A 2CSYA 2FUIA 4FIPA 2YQMA 2C2LA 2KWKA 5TDRA 3KV6A 4WZ0A 2VJFB 2Y1MA 4YBTA 2YQLA 4CA1A 5B77A 1RMDA 1WEPA 4LKAA 4S3OC 2KR4A 2KE1A 4I7DA 4AUQB 2F6NA 2ECGA 2MNZA 3N9MA 2PNXA 5G05B 5J3XA 2LDRA 3VK6A 1WFKA 2FSAA 1F62A 3ZNIA 3FL2A 2CSZA 3HTKC 2L5UA 4BHWA 4IC3A 1WENA 1X4UA 2M6MA 2L43A 5DINA 1VYXA 3U5MA 3O7AA 2L75A 2JMJA 5AITA 4ZUXU 5I3LA 2K4DA 3ZVZB 3U5OA 1Z2QA 3L11A 1WEUA 3O37A 3N9NA 2E6RA 5D1KB 2PUYA 3PHDA 2LN0A 2MUMA 4FO9A 4PTBA 3ZPV1 2YREA 2BAYA 4MVTA 4R2YA 2K16A 3U5PA 5LCWB 3NG2A 3SOWA 2MNYA 4BBQA 2L80A 1E4UA 1WILA 4W4UA 5C11A 2YYRA 4YC9A
chains in the Genus database with same CATH superfamily
3H7HA 1WE9A 4I7BA 1Z6UA 5SVIA 2H0DA 1HYIA 3PURA 2LXPC 3O36A 2VJEA 2YHNA 2M3HA 5LKUA 4MSXA 2MA5A 3DWDA 1U6GB 1WEWA 4YBMA 3V43A 1WEVA 3HCTA 4YADA 4LJNA 5K3QA 3M63A 2XP0A 2LXHC 3ZVYA 4AYCA 3L1XA 2KWNA 1BORA 2L0BA 2AN6A 2QJ0A 2LRIC 2RR4A 2Y1NA 3PLWA 1WEOA 2EGPA 2FUUA 4GNDA 4A4CA 4OGEA 5EYAF 3PUQA 3RPGB 1G25A 2DSMA 5KH3A 2ECNA 2VNFA 4I7CA 2ECVA 2L7PA 3IHPA 4N4FA 3SOXA 3KDEC 5TABA 3O33A 3LQHA 4GNGA 1DCQA 4QF2A 4YABA 5SVXA 4O64A 1WEEA 3O34A 5LKXA 4UI9B 4Z0OA 2ZETC 1JM7B 4FJCA 3SHBA 2OWAA 3Q1DA 4B7YC 5G04B 4LADB 4IC2A 4R7EA 4L7XA 2K17A 5B78A 3GL6A 5SVIB 3LJUX 3O35A 2G45A 3ZYQA 4L58A 2ECJA 2EODA 3MHHA 2YSJA 2M13A 2DX8A 4H9DA 2CKLB 3M7KA 2UZGA 4Q6FA 2FD4A 2XB1A 2JRJA 2LGLA 2K1JA 3O70A 1WEQA 3C5KA 4UP5A 2JMDA 3FJUB 3LVQE 3DPLR 3I2DA 3M99A 1WGMA 1LDKC 2KYUA 2CONA 3SUBA 2VPDA 4P5OB 3HCSA 3KNVA 4LK9A 4V3LC 2QICA 2KWOA 4AVXA 5FERA 3LVRE 1HYJA 4ZDTA 2VP7A 2DJAA 2YW8A 2KIZA 3L1ZB 2HYED 2VJFA 2ECWA 4S3OB 4F52B 2KU3A 2VPEA 4C9ZA 2FFWA 2YT5A 3M62A 2MT5A 4TKPB 2OXQC 3RTRB 2MIQA 4Z0RA 2CRRA 5FB1A 3T9KA 3DQVR 2E6SA 1FP0A 1DVPA 4A0CD 2M1RA 1MM2A 4WZ2A 1WIMA 2D8SA 1V87A 1XWHA 3T6RA 1T1HA 3KV5A 3LQIA 2LGVA 4GNFA 2IDAA 3T7LA 2F42A 4GB0A 4UP0A 3N9OA 4A4BA 5H1TA 5D1LB 2CSVA 4A49A 2I50A 2C2VS 3N9QA 5D1MB 5B76A 1ZBDB 3LQJA 1K2FA 2LGGA 4WZ3B 3QZVA 4YATA 1JOCA 3JUEA 3LDYA 4PPEA 4GNEA 2CRWA 5DKAA 1FBVA 2RI7A 3N9LA 2H0DB 2KREA 2CT2A 2VJEB 2XEUA 5G0FA 2LAUA 1WESA 3SOUA 4R8PK 3C6WA 2E61A 5KH7A 5JG6A 3EB6A 3HCUA 5LKTA 1MM3A 2YSMA 4AP4A 4AYCB 2MD7B 5SVYA 2YU4A 2NAAA 1X4JA 2M85A 5FB0A 2RSDA 2F6JA 2G6QA 2KGIA 2LQ6A 2P57A 4CCGX 2YVRA 2ECIA 3RPGC 2LGKA 2HDPA 5H1UA 4QQ4A 2JUNA 1Z60A 3GV4A 2ECTA 3N9PA 4ZQLA 2YHOA 3FEHA 4X3GA 5C13A 3LRQA 5B75A 2EXUA 2KKXA 2LV9A 3ASLA 5TRBA 1VD4A 2EA6A 3KQIA 2MA6A 5TDWA 5B8DA 4FK5A 4QF3A 1JM7A 5KH9A 3U5NA 4YBSA 5AIUA 2G43A 3DDTA 1VFYA 2JMIA 1IYMA 1LDJB 3FANA 2MD8C 5H9MA 2XOZA 4WA6A 2XOCA 1N87A 3EB5A 5LKZA 2KFTA 4V3KC 4XI1A 2B0OE 2CKLA 4LLBA 4NN2A 3MHSA 2Y43A 2EGMA 5H1VA 1WEMA 4YAXA 2VPGA 3ZTGA 5FEYA 2YUCA 5TBNA 2KGGA 2YURA 1X4IA 4N3WA 2KWJA 1CHCA 2QIZA 4B86C 2VPBA 3ZPVE 5B79A 2JM3A 2CSYA 2FUIA 4FIPA 2YQMA 4O62A 2C2LA 2KWKA 1MBMA 5TDRA 3KV6A 4WZ0A 2VJFB 2Y1MA 4YBTA 2YQLA 4CA1A 2D8UA 5B77A 1RMDA 1WEPA 4LKAA 4S3OC 2KR4A 2IQJA 2KE1A 4I7DA 4AUQB 2F6NA 3MDBC 2ECGA 2MNZA 3N9MA 4OGCA 2PNXA 5G05B 5J3XA 2LDRA 3VK6A 1WFKA 2FSAA 1F62A 3ZNIA 2MKEA 3FL2A 2CSZA 3HTKC 2L5UA 4BHWA 4IC3A 2XOYA 1WENA 2KKYA 3FAOA 1X4UA 3E2DA 2M6MA 2L43A 5DINA 1VYXA 4F1PA 3U5MA 3O7AA 2L75A 2JMJA 5AITA 4ZUXU 3O47A 5I3LA 2K4DA 3ZVZB 3U5OA 1Z2QA 3L11A 1WEUA 3O37A 3N9NA 2E6RA 5D1KB 2PUYA 3PHDA 2LN0A 2MUMA 4FO9A 4PTBA 3ZPV1 2YREA 2BAYA 4MVTA 4R2YA 2K16A 3U5PA 5LCWB 3NG2A 3SOWA 3FM8C 2MNYA 4BBQA 2L80A 1E4UA 1WILA 4W4UA 5C11A 2YYRA 4YC9A
chains in the Genus database with same CATH topology
1WE9A 4I7BA 1Z6UA 2H0DA 1HYIA 3PURA 2LXPC 3O36A 2VJEA 2YHNA 2M3HA 5LKUA 4MSXA 2MA5A 1U6GB 1WEWA 4YBMA 3V43A 1WEVA 3HCTA 4YADA 4LJNA 3M63A 2LXHC 3ZVYA 4AYCA 3L1XA 2KWNA 1BORA 2L0BA 2AN6A 2QJ0A 2LRIC 2Y1NA 1WEOA 2EGPA 2FUUA 4GNDA 4A4CA 5EYAF 3PUQA 3RPGB 1G25A 5KH3A 2ECNA 2VNFA 4I7CA 2ECVA 3IHPA 4N4FA 3SOXA 5TABA 3O33A 3LQHA 4GNGA 4QF2A 4YABA 4O64A 1WEEA 3O34A 5LKXA 4UI9B 2ZETC 1JM7B 4FJCA 3SHBA 4B7YC 5G04B 4LADB 4IC2A 4R7EA 4L7XA 2K17A 5B78A 3GL6A 3O35A 2G45A 3ZYQA 4L58A 2ECJA 2EODA 3MHHA 2YSJA 2DX8A 2CKLB 2UZGA 4Q6FA 2XB1A 2JRJA 2LGLA 2K1JA 3O70A 1WEQA 3C5KA 4UP5A 2JMDA 3DPLR 3I2DA 3M99A 1WGMA 1LDKC 2KYUA 2VPDA 4P5OB 3HCSA 3KNVA 4LK9A 4V3LC 2QICA 2KWOA 4AVXA 5FERA 1HYJA 4ZDTA 2VP7A 2YW8A 2KIZA 3L1ZB 2HYED 2VJFA 2ECWA 4S3OB 4F52B 2KU3A 2VPEA 4C9ZA 2YT5A 3M62A 2MT5A 4TKPB 2OXQC 3RTRB 2MIQA 5FB1A 3DQVR 2E6SA 1FP0A 1DVPA 4A0CD 2M1RA 1MM2A 4WZ2A 1WIMA 2D8SA 1V87A 1XWHA 3T6RA 1T1HA 3KV5A 3LQIA 2LGVA 4GNFA 2IDAA 3T7LA 2F42A 4GB0A 4UP0A 3N9OA 4A4BA 5H1TA 5D1LB 4A49A 2I50A 2C2VS 3N9QA 5D1MB 5B76A 1ZBDB 3LQJA 1K2FA 2LGGA 4WZ3B 3QZVA 4YATA 1JOCA 4PPEA 4GNEA 5DKAA 1FBVA 2RI7A 3N9LA 2H0DB 2KREA 2CT2A 2VJEB 2XEUA 5G0FA 1WESA 3SOUA 4R8PK 3C6WA 5KH7A 5JG6A 3EB6A 3HCUA 5LKTA 1MM3A 2YSMA 4AP4A 4AYCB 2MD7B 2YU4A 2NAAA 1X4JA 2M85A 5FB0A 2RSDA 2F6JA 2G6QA 2KGIA 2LQ6A 4CCGX 2ECIA 3RPGC 2LGKA 2HDPA 5H1UA 1Z60A 3GV4A 2ECTA 3N9PA 4ZQLA 2YHOA 4X3GA 5C13A 3LRQA 5B75A 2LV9A 3ASLA 5TRBA 1VD4A 2EA6A 3KQIA 2MA6A 5TDWA 5B8DA 4FK5A 4QF3A 1JM7A 5KH9A 3U5NA 4YBSA 5AIUA 2G43A 1VFYA 2JMIA 1IYMA 1LDJB 2MD8C 5H9MA 4WA6A 1N87A 3EB5A 5LKZA 2KFTA 4V3KC 4XI1A 2CKLA 4LLBA 4NN2A 3MHSA 2Y43A 5H1VA 1WEMA 4YAXA 2VPGA 3ZTGA 5FEYA 2YUCA 5TBNA 2KGGA 2YURA 1X4IA 4N3WA 2KWJA 1CHCA 2QIZA 4B86C 2VPBA 3ZPVE 5B79A 2CSYA 2FUIA 4FIPA 2YQMA 2C2LA 2KWKA 5TDRA 3KV6A 4WZ0A 2VJFB 2Y1MA 4YBTA 2YQLA 4CA1A 5B77A 1RMDA 1WEPA 4LKAA 4S3OC 2KR4A 2KE1A 4I7DA 4AUQB 2F6NA 2ECGA 2MNZA 3N9MA 2PNXA 5G05B 5J3XA 2LDRA 3VK6A 1WFKA 2FSAA 1F62A 3ZNIA 3FL2A 2CSZA 3HTKC 2L5UA 4BHWA 4IC3A 1WENA 1X4UA 2M6MA 2L43A 5DINA 1VYXA 3U5MA 3O7AA 2L75A 2JMJA 5AITA 4ZUXU 5I3LA 2K4DA 3ZVZB 3U5OA 1Z2QA 3L11A 1WEUA 3O37A 3N9NA 2E6RA 5D1KB 2PUYA 3PHDA 2LN0A 2MUMA 4FO9A 4PTBA 3ZPV1 2YREA 2BAYA 4MVTA 4R2YA 2K16A 3U5PA 5LCWB 3NG2A 3SOWA 2MNYA 4BBQA 2L80A 1E4UA 1WILA 4W4UA 5C11A 2YYRA 4YC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE9 A;  4I7B A;  1Z6U A;  2H0D A;  1HYI A;  3PUR A;  2LXP C;  3O36 A;  2VJE A;  2YHN A;  2M3H A;  5LKU A;  4MSX A;  2MA5 A;  1U6G B;  1WEW A;  4YBM A;  3V43 A;  1WEV A;  3HCT A;  4YAD A;  4LJN A;  3M63 A;  2LXH C;  3ZVY A;  4AYC A;  3L1X A;  2KWN A;  1BOR A;  2L0B A;  2AN6 A;  2QJ0 A;  2LRI C;  2Y1N A;  1WEO A;  2EGP A;  2FUU A;  4GND A;  4A4C A;  5EYA F;  3PUQ A;  3RPG B;  1G25 A;  5KH3 A;  2ECN A;  2VNF A;  4I7C A;  2ECV A;  3IHP A;  4N4F A;  3SOX A;  5TAB A;  3O33 A;  3LQH A;  4GNG A;  4QF2 A;  4YAB A;  4O64 A;  1WEE A;  3O34 A;  5LKX A;  4UI9 B;  2ZET C;  1JM7 B;  4FJC A;  3SHB A;  4B7Y C;  5G04 B;  4LAD B;  4IC2 A;  4R7E A;  4L7X A;  2K17 A;  5B78 A;  3GL6 A;  3O35 A;  2G45 A;  3ZYQ A;  4L58 A;  2ECJ A;  2EOD A;  3MHH A;  2YSJ A;  2DX8 A;  2CKL B;  2UZG A;  4Q6F A;  2XB1 A;  2JRJ A;  2LGL A;  2K1J A;  3O70 A;  1WEQ A;  3C5K A;  4UP5 A;  2JMD A;  3DPL R;  3I2D A;  3M99 A;  1WGM A;  1LDK C;  2KYU A;  2VPD A;  4P5O B;  3HCS A;  3KNV A;  4LK9 A;  4V3L C;  2QIC A;  2KWO A;  4AVX A;  5FER A;  1HYJ A;  4ZDT A;  2VP7 A;  2YW8 A;  2KIZ A;  3L1Z B;  2HYE D;  2VJF A;  2ECW A;  4S3O B;  4F52 B;  2KU3 A;  2VPE A;  4C9Z A;  2YT5 A;  3M62 A;  2MT5 A;  4TKP B;  2OXQ C;  3RTR B;  2MIQ A;  5FB1 A;  3DQV R;  2E6S A;  1FP0 A;  1DVP A;  4A0C D;  2M1R A;  1MM2 A;  4WZ2 A;  1WIM A;  2D8S A;  1V87 A;  1XWH A;  3T6R A;  1T1H A;  3KV5 A;  3LQI A;  2LGV A;  4GNF A;  2IDA A;  3T7L A;  2F42 A;  4GB0 A;  4UP0 A;  3N9O A;  4A4B A;  5H1T A;  5D1L B;  4A49 A;  2I50 A;  2C2V S;  3N9Q A;  5D1M B;  5B76 A;  1ZBD B;  3LQJ A;  1K2F A;  2LGG A;  4WZ3 B;  3QZV A;  4YAT A;  1JOC A;  4PPE A;  4GNE A;  5DKA A;  1FBV A;  2RI7 A;  3N9L A;  2H0D B;  2KRE A;  2CT2 A;  2VJE B;  2XEU A;  5G0F A;  1WES A;  3SOU A;  4R8P K;  3C6W A;  5KH7 A;  5JG6 A;  3EB6 A;  3HCU A;  5LKT A;  1MM3 A;  2YSM A;  4AP4 A;  4AYC B;  2MD7 B;  2YU4 A;  2NAA A;  1X4J A;  2M85 A;  5FB0 A;  2RSD A;  2F6J A;  2G6Q A;  2KGI A;  2LQ6 A;  4CCG X;  2ECI A;  3RPG C;  2LGK A;  2HDP A;  5H1U A;  1Z60 A;  3GV4 A;  2ECT A;  3N9P A;  4ZQL A;  2YHO A;  4X3G A;  5C13 A;  3LRQ A;  5B75 A;  2LV9 A;  3ASL A;  5TRB A;  1VD4 A;  2EA6 A;  3KQI A;  2MA6 A;  5TDW A;  5B8D A;  4FK5 A;  4QF3 A;  1JM7 A;  5KH9 A;  3U5N A;  4YBS A;  5AIU A;  2G43 A;  1VFY A;  2JMI A;  1IYM A;  1LDJ B;  2MD8 C;  5H9M A;  4WA6 A;  1N87 A;  3EB5 A;  5LKZ A;  2KFT A;  4V3K C;  4XI1 A;  2CKL A;  4LLB A;  4NN2 A;  3MHS A;  2Y43 A;  5H1V A;  1WEM A;  4YAX A;  2VPG A;  3ZTG A;  5FEY A;  2YUC A;  5TBN A;  2KGG A;  2YUR A;  1X4I A;  4N3W A;  2KWJ A;  1CHC A;  2QIZ A;  4B86 C;  2VPB A;  3ZPV E;  5B79 A;  2CSY A;  2FUI A;  4FIP A;  2YQM A;  2C2L A;  2KWK A;  5TDR A;  3KV6 A;  4WZ0 A;  2VJF B;  2Y1M A;  4YBT A;  2YQL A;  4CA1 A;  5B77 A;  1RMD A;  1WEP A;  4LKA A;  4S3O C;  2KR4 A;  2KE1 A;  4I7D A;  4AUQ B;  2F6N A;  2ECG A;  2MNZ A;  3N9M A;  2PNX A;  5G05 B;  5J3X A;  2LDR A;  3VK6 A;  1WFK A;  2FSA A;  1F62 A;  3ZNI A;  3FL2 A;  2CSZ A;  3HTK C;  2L5U A;  4BHW A;  4IC3 A;  1WEN A;  1X4U A;  2M6M A;  2L43 A;  5DIN A;  1VYX A;  3U5M A;  3O7A A;  2L75 A;  2JMJ A;  5AIT A;  4ZUX U;  5I3L A;  2K4D A;  3ZVZ B;  3U5O A;  1Z2Q A;  3L11 A;  1WEU A;  3O37 A;  3N9N A;  2E6R A;  5D1K B;  2PUY A;  3PHD A;  2LN0 A;  2MUM A;  4FO9 A;  4PTB A;  3ZPV 1;  2YRE A;  2BAY A;  4MVT A;  4R2Y A;  2K16 A;  3U5P A;  5LCW B;  3NG2 A;  3SOW A;  2MNY A;  4BBQ A;  2L80 A;  1E4U A;  1WIL A;  4W4U A;  5C11 A;  2YYR A;  4YC9 A; 
#chains in the Genus database with same CATH topology
 3H7H A;  1WE9 A;  4I7B A;  1Z6U A;  5SVI A;  2H0D A;  1HYI A;  3PUR A;  2LXP C;  3O36 A;  2VJE A;  2YHN A;  2M3H A;  5LKU A;  4MSX A;  2MA5 A;  3DWD A;  1U6G B;  1WEW A;  4YBM A;  3V43 A;  1WEV A;  3HCT A;  4YAD A;  4LJN A;  5K3Q A;  3M63 A;  2XP0 A;  2LXH C;  3ZVY A;  4AYC A;  3L1X A;  2KWN A;  1BOR A;  2L0B A;  2AN6 A;  2QJ0 A;  2LRI C;  2RR4 A;  2Y1N A;  3PLW A;  1WEO A;  2EGP A;  2FUU A;  4GND A;  4A4C A;  4OGE A;  5EYA F;  3PUQ A;  3RPG B;  1G25 A;  2DSM A;  5KH3 A;  2ECN A;  2VNF A;  4I7C A;  2ECV A;  2L7P A;  3IHP A;  4N4F A;  3SOX A;  3KDE C;  5TAB A;  3O33 A;  3LQH A;  4GNG A;  1DCQ A;  4QF2 A;  4YAB A;  5SVX A;  4O64 A;  1WEE A;  3O34 A;  5LKX A;  4UI9 B;  4Z0O A;  2ZET C;  1JM7 B;  4FJC A;  3SHB A;  2OWA A;  3Q1D A;  4B7Y C;  5G04 B;  4LAD B;  4IC2 A;  4R7E A;  4L7X A;  2K17 A;  5B78 A;  3GL6 A;  5SVI B;  3LJU X;  3O35 A;  2G45 A;  3ZYQ A;  4L58 A;  2ECJ A;  2EOD A;  3MHH A;  2YSJ A;  2M13 A;  2DX8 A;  4H9D A;  2CKL B;  3M7K A;  2UZG A;  4Q6F A;  2FD4 A;  2XB1 A;  2JRJ A;  2LGL A;  2K1J A;  3O70 A;  1WEQ A;  3C5K A;  4UP5 A;  2JMD A;  3FJU B;  3LVQ E;  3DPL R;  3I2D A;  3M99 A;  1WGM A;  1LDK C;  2KYU A;  2CON A;  3SUB A;  2VPD A;  4P5O B;  3HCS A;  3KNV A;  4LK9 A;  4V3L C;  2QIC A;  2KWO A;  4AVX A;  5FER A;  3LVR E;  1HYJ A;  4ZDT A;  2VP7 A;  2DJA A;  2YW8 A;  2KIZ A;  3L1Z B;  2HYE D;  2VJF A;  2ECW A;  4S3O B;  4F52 B;  2KU3 A;  2VPE A;  4C9Z A;  2FFW A;  2YT5 A;  3M62 A;  2MT5 A;  4TKP B;  2OXQ C;  3RTR B;  2MIQ A;  4Z0R A;  2CRR A;  5FB1 A;  3T9K A;  3DQV R;  2E6S A;  1FP0 A;  1DVP A;  4A0C D;  2M1R A;  1MM2 A;  4WZ2 A;  1WIM A;  2D8S A;  1V87 A;  1XWH A;  3T6R A;  1T1H A;  3KV5 A;  3LQI A;  2LGV A;  4GNF A;  2IDA A;  3T7L A;  2F42 A;  4GB0 A;  4UP0 A;  3N9O A;  4A4B A;  5H1T A;  5D1L B;  2CSV A;  4A49 A;  2I50 A;  2C2V S;  3N9Q A;  5D1M B;  5B76 A;  1ZBD B;  3LQJ A;  1K2F A;  2LGG A;  4WZ3 B;  3QZV A;  4YAT A;  1JOC A;  3JUE A;  3LDY A;  4PPE A;  4GNE A;  2CRW A;  5DKA A;  1FBV A;  2RI7 A;  3N9L A;  2H0D B;  2KRE A;  2CT2 A;  2VJE B;  2XEU A;  5G0F A;  2LAU A;  1WES A;  3SOU A;  4R8P K;  3C6W A;  2E61 A;  5KH7 A;  5JG6 A;  3EB6 A;  3HCU A;  5LKT A;  1MM3 A;  2YSM A;  4AP4 A;  4AYC B;  2MD7 B;  5SVY A;  2YU4 A;  2NAA A;  1X4J A;  2M85 A;  5FB0 A;  2RSD A;  2F6J A;  2G6Q A;  2KGI A;  2LQ6 A;  2P57 A;  4CCG X;  2YVR A;  2ECI A;  3RPG C;  2LGK A;  2HDP A;  5H1U A;  4QQ4 A;  2JUN A;  1Z60 A;  3GV4 A;  2ECT A;  3N9P A;  4ZQL A;  2YHO A;  3FEH A;  4X3G A;  5C13 A;  3LRQ A;  5B75 A;  2EXU A;  2KKX A;  2LV9 A;  3ASL A;  5TRB A;  1VD4 A;  2EA6 A;  3KQI A;  2MA6 A;  5TDW A;  5B8D A;  4FK5 A;  4QF3 A;  1JM7 A;  5KH9 A;  3U5N A;  4YBS A;  5AIU A;  2G43 A;  3DDT A;  1VFY A;  2JMI A;  1IYM A;  1LDJ B;  3FAN A;  2MD8 C;  5H9M A;  2XOZ A;  4WA6 A;  2XOC A;  1N87 A;  3EB5 A;  5LKZ A;  2KFT A;  4V3K C;  4XI1 A;  2B0O E;  2CKL A;  4LLB A;  4NN2 A;  3MHS A;  2Y43 A;  2EGM A;  5H1V A;  1WEM A;  4YAX A;  2VPG A;  3ZTG A;  5FEY A;  2YUC A;  5TBN A;  2KGG A;  2YUR A;  1X4I A;  4N3W A;  2KWJ A;  1CHC A;  2QIZ A;  4B86 C;  2VPB A;  3ZPV E;  5B79 A;  2JM3 A;  2CSY A;  2FUI A;  4FIP A;  2YQM A;  4O62 A;  2C2L A;  2KWK A;  1MBM A;  5TDR A;  3KV6 A;  4WZ0 A;  2VJF B;  2Y1M A;  4YBT A;  2YQL A;  4CA1 A;  2D8U A;  5B77 A;  1RMD A;  1WEP A;  4LKA A;  4S3O C;  2KR4 A;  2IQJ A;  2KE1 A;  4I7D A;  4AUQ B;  2F6N A;  3MDB C;  2ECG A;  2MNZ A;  3N9M A;  4OGC A;  2PNX A;  5G05 B;  5J3X A;  2LDR A;  3VK6 A;  1WFK A;  2FSA A;  1F62 A;  3ZNI A;  2MKE A;  3FL2 A;  2CSZ A;  3HTK C;  2L5U A;  4BHW A;  4IC3 A;  2XOY A;  1WEN A;  2KKY A;  3FAO A;  1X4U A;  3E2D A;  2M6M A;  2L43 A;  5DIN A;  1VYX A;  4F1P A;  3U5M A;  3O7A A;  2L75 A;  2JMJ A;  5AIT A;  4ZUX U;  3O47 A;  5I3L A;  2K4D A;  3ZVZ B;  3U5O A;  1Z2Q A;  3L11 A;  1WEU A;  3O37 A;  3N9N A;  2E6R A;  5D1K B;  2PUY A;  3PHD A;  2LN0 A;  2MUM A;  4FO9 A;  4PTB A;  3ZPV 1;  2YRE A;  2BAY A;  4MVT A;  4R2Y A;  2K16 A;  3U5P A;  5LCW B;  3NG2 A;  3SOW A;  3FM8 C;  2MNY A;  4BBQ A;  2L80 A;  1E4U A;  1WIL A;  4W4U A;  5C11 A;  2YYR A;  4YC9 A; 
#chains in the Genus database with same CATH homology
 1WE9 A;  4I7B A;  1Z6U A;  2H0D A;  1HYI A;  3PUR A;  2LXP C;  3O36 A;  2VJE A;  2YHN A;  2M3H A;  5LKU A;  4MSX A;  2MA5 A;  1U6G B;  1WEW A;  4YBM A;  3V43 A;  1WEV A;  3HCT A;  4YAD A;  4LJN A;  3M63 A;  2LXH C;  3ZVY A;  4AYC A;  3L1X A;  2KWN A;  1BOR A;  2L0B A;  2AN6 A;  2QJ0 A;  2LRI C;  2Y1N A;  1WEO A;  2EGP A;  2FUU A;  4GND A;  4A4C A;  5EYA F;  3PUQ A;  3RPG B;  1G25 A;  5KH3 A;  2ECN A;  2VNF A;  4I7C A;  2ECV A;  3IHP A;  4N4F A;  3SOX A;  5TAB A;  3O33 A;  3LQH A;  4GNG A;  4QF2 A;  4YAB A;  4O64 A;  1WEE A;  3O34 A;  5LKX A;  4UI9 B;  2ZET C;  1JM7 B;  4FJC A;  3SHB A;  4B7Y C;  5G04 B;  4LAD B;  4IC2 A;  4R7E A;  4L7X A;  2K17 A;  5B78 A;  3GL6 A;  3O35 A;  2G45 A;  3ZYQ A;  4L58 A;  2ECJ A;  2EOD A;  3MHH A;  2YSJ A;  2DX8 A;  2CKL B;  2UZG A;  4Q6F A;  2XB1 A;  2JRJ A;  2LGL A;  2K1J A;  3O70 A;  1WEQ A;  3C5K A;  4UP5 A;  2JMD A;  3DPL R;  3I2D A;  3M99 A;  1WGM A;  1LDK C;  2KYU A;  2VPD A;  4P5O B;  3HCS A;  3KNV A;  4LK9 A;  4V3L C;  2QIC A;  2KWO A;  4AVX A;  5FER A;  1HYJ A;  4ZDT A;  2VP7 A;  2YW8 A;  2KIZ A;  3L1Z B;  2HYE D;  2VJF A;  2ECW A;  4S3O B;  4F52 B;  2KU3 A;  2VPE A;  4C9Z A;  2YT5 A;  3M62 A;  2MT5 A;  4TKP B;  2OXQ C;  3RTR B;  2MIQ A;  5FB1 A;  3DQV R;  2E6S A;  1FP0 A;  1DVP A;  4A0C D;  2M1R A;  1MM2 A;  4WZ2 A;  1WIM A;  2D8S A;  1V87 A;  1XWH A;  3T6R A;  1T1H A;  3KV5 A;  3LQI A;  2LGV A;  4GNF A;  2IDA A;  3T7L A;  2F42 A;  4GB0 A;  4UP0 A;  3N9O A;  4A4B A;  5H1T A;  5D1L B;  4A49 A;  2I50 A;  2C2V S;  3N9Q A;  5D1M B;  5B76 A;  1ZBD B;  3LQJ A;  1K2F A;  2LGG A;  4WZ3 B;  3QZV A;  4YAT A;  1JOC A;  4PPE A;  4GNE A;  5DKA A;  1FBV A;  2RI7 A;  3N9L A;  2H0D B;  2KRE A;  2CT2 A;  2VJE B;  2XEU A;  5G0F A;  1WES A;  3SOU A;  4R8P K;  3C6W A;  5KH7 A;  5JG6 A;  3EB6 A;  3HCU A;  5LKT A;  1MM3 A;  2YSM A;  4AP4 A;  4AYC B;  2MD7 B;  2YU4 A;  2NAA A;  1X4J A;  2M85 A;  5FB0 A;  2RSD A;  2F6J A;  2G6Q A;  2KGI A;  2LQ6 A;  4CCG X;  2ECI A;  3RPG C;  2LGK A;  2HDP A;  5H1U A;  1Z60 A;  3GV4 A;  2ECT A;  3N9P A;  4ZQL A;  2YHO A;  4X3G A;  5C13 A;  3LRQ A;  5B75 A;  2LV9 A;  3ASL A;  5TRB A;  1VD4 A;  2EA6 A;  3KQI A;  2MA6 A;  5TDW A;  5B8D A;  4FK5 A;  4QF3 A;  1JM7 A;  5KH9 A;  3U5N A;  4YBS A;  5AIU A;  2G43 A;  1VFY A;  2JMI A;  1IYM A;  1LDJ B;  2MD8 C;  5H9M A;  4WA6 A;  1N87 A;  3EB5 A;  5LKZ A;  2KFT A;  4V3K C;  4XI1 A;  2CKL A;  4LLB A;  4NN2 A;  3MHS A;  2Y43 A;  5H1V A;  1WEM A;  4YAX A;  2VPG A;  3ZTG A;  5FEY A;  2YUC A;  5TBN A;  2KGG A;  2YUR A;  1X4I A;  4N3W A;  2KWJ A;  1CHC A;  2QIZ A;  4B86 C;  2VPB A;  3ZPV E;  5B79 A;  2CSY A;  2FUI A;  4FIP A;  2YQM A;  2C2L A;  2KWK A;  5TDR A;  3KV6 A;  4WZ0 A;  2VJF B;  2Y1M A;  4YBT A;  2YQL A;  4CA1 A;  5B77 A;  1RMD A;  1WEP A;  4LKA A;  4S3O C;  2KR4 A;  2KE1 A;  4I7D A;  4AUQ B;  2F6N A;  2ECG A;  2MNZ A;  3N9M A;  2PNX A;  5G05 B;  5J3X A;  2LDR A;  3VK6 A;  1WFK A;  2FSA A;  1F62 A;  3ZNI A;  3FL2 A;  2CSZ A;  3HTK C;  2L5U A;  4BHW A;  4IC3 A;  1WEN A;  1X4U A;  2M6M A;  2L43 A;  5DIN A;  1VYX A;  3U5M A;  3O7A A;  2L75 A;  2JMJ A;  5AIT A;  4ZUX U;  5I3L A;  2K4D A;  3ZVZ B;  3U5O A;  1Z2Q A;  3L11 A;  1WEU A;  3O37 A;  3N9N A;  2E6R A;  5D1K B;  2PUY A;  3PHD A;  2LN0 A;  2MUM A;  4FO9 A;  4PTB A;  3ZPV 1;  2YRE A;  2BAY A;  4MVT A;  4R2Y A;  2K16 A;  3U5P A;  5LCW B;  3NG2 A;  3SOW A;  2MNY A;  4BBQ A;  2L80 A;  1E4U A;  1WIL A;  4W4U A;  5C11 A;  2YYR A;  4YC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...