3T7LA

Crystal structure of the fyve domain of endofin (zfyve16) at 1.1a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
LVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKEARVCVVCYETISKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger FYVE domain-containing protein 16
publication title Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t7lA00
5DINA 3IHPA 4FO9A 2JRJA 2D8SA 2YUCA 4WA6A 5B78A 2G45A 1XWHA 3ZPV1 3N9PA 2C2VS 1WIMA 1WEVA 2AN6A 2Y43A 2KIZA 1JOCA 2Y1MA 3O7AA 2L5UA 4FK5A 4Q6FA 3U5OA 4ZUXU 1G25A 2K17A 4AYCA 5B8DA 3DQVR 4GNFA 2KGGA 3U5MA 1WEPA 1DVPA 4A4CA 2Y1NA 4YADA 2KE1A 2JMDA 2L75A 2MA5A 2MNZA 4V3LC 4I7DA 2LGLA 1WESA 2MIQA 1BORA 3FL2A 4AP4A 5B77A 5TDWA 2BAYA 4AVXA 2JMJA 5G05B 2VPDA 5TDRA 4LJNA 2MT5A 1LDJB 1WEQA 4CA1A 1LDKC 4X3GA 1WEOA 4I7CA 2G6QA 5TABA 1X4IA 3LQHA 1WEMA 4UP5A 4IC3A 2K4DA 2EODA 4LKAA 2CSYA 4F52B 4WZ3B 4GNEA 4QF2A 4W4UA 1Z60A 2L0BA 3NG2A 1WGMA 1U6GB 3M63A 2L43A 2LXPC 3C5KA 5KH3A 2ZETC 4V3KC 3SOUA 5FEYA 5C13A 5LKTA 4UP0A 4TKPB 2KWKA 2YW8A 1VFYA 3ZYQA 3O70A 4LK9A 2VJEA 2MA6A 4PPEA 3PUQA 4R2YA 5H9MA 5KH9A 2YSMA 4A4BA 2M3HA 5D1MB 2L80A 2H0DA 2EA6A 2LXHC 3N9MA 4CCGX 2ECVA 4UI9B 3N9OA 5LKUA 3M62A 2CKLB 2YSJA 3LQIA 3V43A 4B86C 4YABA 4AYCB 4B7YC 1F62A 3C6WA 4XI1A 3KV6A 2CKLA 2KR4A 1IYMA 2LGVA 4N4FA 4O64A 3PURA 2LGGA 2F6NA 2XEUA 3SOXA 5LKZA 3LQJA 1MM3A 3T6RA 1JM7A 2VNFA 2ECNA 4NN2A 1HYIA 3RPGC 4YBMA 2YU4A 2YQLA 3VK6A 3SOWA 4YC9A 1MM2A 4L7XA 4YAXA 2C2LA 3PHDA 4AUQB 1K2FA 2KFTA 4FJCA 5FB0A 3U5NA 4IC2A 2KYUA 4R7EA 2OXQC 3N9LA 2MD7B 3O33A 2UZGA 2ECWA 2G43A 4YBTA 3DPLR 1X4UA 4S3OC 1WENA 2MD8C 3ZVZB 3HCSA 2ECIA 2E6RA 2HDPA 2F6JA 2NAAA 2YT5A 1WEEA 2LGKA 3O37A 5TBNA 4ZDTA 2YHNA 2E6SA 1E4UA 4MVTA 4YBSA 1VD4A 3SHBA 3T7LA 1T1HA 4BHWA 2VPEA 5H1VA 4GB0A 2VP7A 1FP0A 1V87A 2I50A 2VJEB 2CSZA 3L1ZB 3N9NA 2M85A 4R8PK 4WZ0A 2H0DB 2EGPA 2RI7A 2M1RA 2VPBA 2QJ0A 2DX8A 2VPGA 2KREA 3KNVA 1ZBDB 2KGIA 3MHHA 2PNXA 5KH7A 2YQMA 2CT2A 5H1TA 3ASLA 3ZVYA 2KWNA 2QICA 2ECJA 5D1KB 5I3LA 5LKXA 5FB1A 3I2DA 4YATA 4C9ZA 5AITA 3U5PA 5C11A 2FUIA 5JG6A 3EB6A 3ZTGA 2YHOA 5TRBA 4PTBA 1JM7B 1WILA 5FERA 3HCTA 3KQIA 2MNYA 1VYXA 2KWOA 2KWJA 2PUYA 2MUMA 4GNGA 5AIUA 5H1UA 4N3WA 4QF3A 5G0FA 4BBQA 3HCUA 5DKAA 4A0CD 3KV5A 2YREA 5LCWB 3L11A 3QZVA 3O34A 4L58A 2HYED 4LLBA 4ZQLA 2K1JA 2VJFB 3O35A 3ZNIA 3O36A 2K16A 2LV9A 2XB1A 2VJFA 3RPGB 4I7BA 1N87A 2M6MA 4MSXA 5D1LB 5EYAF 1HYJA 5J3XA 5B79A 2LDRA 5B75A 2QIZA 3GL6A 2RSDA 4LADB 2ECTA 2LQ6A 2YYRA 1FBVA 3RTRB 3GV4A 2FSAA 1X4JA 4FIPA 5B76A 3ZPVE 2FUUA 3M99A 4GNDA 1WFKA 2JMIA 2LRIC 1WEWA 3HTKC 2F42A 2KU3A 1WE9A 1Z2QA 3MHSA 4S3OB 4WZ2A 1WEUA 4A49A 2LN0A 1CHCA 1Z6UA 2YURA 1RMDA 3EB5A 3N9QA 3L1XA 3LRQA 5G04B 2IDAA 2ECGA 4P5OB
chains in the Genus database with same CATH superfamily
5DINA 3IHPA 4FO9A 2JRJA 2D8SA 2YUCA 3JUEA 4WA6A 2FFWA 5B78A 2G45A 1XWHA 3ZPV1 3N9PA 2C2VS 1WIMA 1WEVA 2AN6A 2Y43A 2KIZA 1JOCA 2KKXA 2JM3A 2Y1MA 3O7AA 2L5UA 4FK5A 4Q6FA 3U5OA 4ZUXU 1G25A 2K17A 4OGCA 4AYCA 5B8DA 3DQVR 4GNFA 2KGGA 3U5MA 1WEPA 1DVPA 4A4CA 2Y1NA 4YADA 2EXUA 2KE1A 2JMDA 2L75A 2MA5A 2MNZA 4V3LC 4I7DA 2LGLA 1WESA 2MIQA 1BORA 3FL2A 4AP4A 5B77A 2YVRA 5TDWA 2BAYA 4AVXA 2JMJA 5G05B 2VPDA 5TDRA 3DWDA 4LJNA 2MT5A 1LDJB 1WEQA 4CA1A 1LDKC 5K3QA 4X3GA 1WEOA 1DCQA 4I7CA 2G6QA 5TABA 1X4IA 3LQHA 1WEMA 2M13A 4UP5A 4IC3A 2K4DA 3Q1DA 2EODA 4LKAA 2CSYA 4F52B 4WZ3B 4GNEA 4QF2A 4W4UA 3FJUB 1Z60A 2L0BA 3NG2A 3FANA 1WGMA 1U6GB 3LVQE 3M63A 2L43A 2LXPC 3C5KA 5KH3A 2ZETC 4V3KC 3SOUA 4H9DA 5FEYA 5C13A 5LKTA 4UP0A 4TKPB 3LJUX 2KWKA 2YW8A 1VFYA 3ZYQA 3O70A 2L7PA 4LK9A 3MDBC 2VJEA 2MA6A 4PPEA 3PUQA 4R2YA 5H9MA 5KH9A 2YSMA 2CONA 4A4BA 2M3HA 5D1MB 2L80A 2H0DA 2EA6A 2LXHC 3N9MA 4CCGX 2ECVA 4UI9B 3N9OA 5LKUA 3M62A 3FM8C 2CKLB 2YSJA 3LQIA 3V43A 4B86C 4YABA 4AYCB 4B7YC 1F62A 3C6WA 4XI1A 3KV6A 2CKLA 2KR4A 1IYMA 2LGVA 5SVXA 4N4FA 2E61A 4O64A 3PURA 2LGGA 2F6NA 2XEUA 3SOXA 5LKZA 3LQJA 2FD4A 1MM3A 3T6RA 1JM7A 2VNFA 2ECNA 4NN2A 1HYIA 3RPGC 4YBMA 3KDEC 2YU4A 2YQLA 3VK6A 3SOWA 4YC9A 1MM2A 4L7XA 4YAXA 2C2LA 2B0OE 3PHDA 4AUQB 1K2FA 3E2DA 3SUBA 2KFTA 4FJCA 5FB0A 3U5NA 4IC2A 2KYUA 4R7EA 2XP0A 2OXQC 3N9LA 2MD7B 3O33A 5SVYA 2UZGA 2ECWA 2G43A 4YBTA 3DPLR 3M7KA 1X4UA 2DSMA 4S3OC 1WENA 2MD8C 3ZVZB 3HCSA 5SVIA 2ECIA 3T9KA 2E6RA 2HDPA 2F6JA 2NAAA 2YT5A 3O47A 1WEEA 3PLWA 2LGKA 3O37A 5TBNA 4ZDTA 2D8UA 2E6SA 2YHNA 1E4UA 4QQ4A 2EGMA 4MVTA 4YBSA 2P57A 1VD4A 3SHBA 3T7LA 1T1HA 4BHWA 2VPEA 5H1VA 4GB0A 2VP7A 2JUNA 1FP0A 1V87A 2I50A 2VJEB 2CSZA 3L1ZB 2LAUA 3N9NA 2M85A 4R8PK 3FAOA 4WZ0A 2H0DB 2EGPA 2RI7A 2M1RA 2VPBA 2QJ0A 2DX8A 2VPGA 2KREA 3KNVA 1ZBDB 2KGIA 1MBMA 3MHHA 2PNXA 5KH7A 2YQMA 2CT2A 5H1TA 3ASLA 3ZVYA 2KWNA 2QICA 2ECJA 5D1KB 5I3LA 2RR4A 5LKXA 5FB1A 3I2DA 4YATA 4C9ZA 5AITA 3U5PA 5C11A 2FUIA 5JG6A 3EB6A 3ZTGA 2YHOA 3LVRE 2IQJA 5TRBA 4PTBA 1JM7B 2MKEA 1WILA 5FERA 4OGEA 3HCTA 3KQIA 2MNYA 1VYXA 2XOCA 2KWOA 2KWJA 2PUYA 2CRRA 2MUMA 4GNGA 5AIUA 5H1UA 4N3WA 4QF3A 5G0FA 2XOZA 2OWAA 3DDTA 4BBQA 3HCUA 5DKAA 4A0CD 3KV5A 3H7HA 2YREA 3LDYA 5LCWB 3L11A 2CSVA 3QZVA 3O34A 4L58A 2HYED 4LLBA 4ZQLA 2K1JA 2VJFB 3O35A 5SVIB 3ZNIA 3O36A 2K16A 2LV9A 2XB1A 2XOYA 2VJFA 3RPGB 4I7BA 1N87A 2M6MA 4MSXA 5D1LB 5EYAF 2DJAA 1HYJA 5J3XA 5B79A 2LDRA 4Z0OA 5B75A 2QIZA 3GL6A 2RSDA 4LADB 2ECTA 2LQ6A 2YYRA 1FBVA 3RTRB 3GV4A 2FSAA 1X4JA 4FIPA 5B76A 3ZPVE 2FUUA 3M99A 4GNDA 2CRWA 1WFKA 2JMIA 2LRIC 1WEWA 3HTKC 2F42A 2KU3A 1WE9A 1Z2QA 3MHSA 4S3OB 4Z0RA 4WZ2A 1WEUA 4A49A 2LN0A 1CHCA 1Z6UA 2YURA 1RMDA 3EB5A 3N9QA 2KKYA 3L1XA 3LRQA 5G04B 2IDAA 2ECGA 3FEHA 4O62A 4F1PA 4P5OB
chains in the Genus database with same CATH topology
5DINA 3IHPA 4FO9A 2JRJA 2D8SA 2YUCA 4WA6A 5B78A 2G45A 1XWHA 3ZPV1 3N9PA 2C2VS 1WIMA 1WEVA 2AN6A 2Y43A 2KIZA 1JOCA 2Y1MA 3O7AA 2L5UA 4FK5A 4Q6FA 3U5OA 4ZUXU 1G25A 2K17A 4AYCA 5B8DA 3DQVR 4GNFA 2KGGA 3U5MA 1WEPA 1DVPA 4A4CA 2Y1NA 4YADA 2KE1A 2JMDA 2L75A 2MA5A 2MNZA 4V3LC 4I7DA 2LGLA 1WESA 2MIQA 1BORA 3FL2A 4AP4A 5B77A 5TDWA 2BAYA 4AVXA 2JMJA 5G05B 2VPDA 5TDRA 4LJNA 2MT5A 1LDJB 1WEQA 4CA1A 1LDKC 4X3GA 1WEOA 4I7CA 2G6QA 5TABA 1X4IA 3LQHA 1WEMA 4UP5A 4IC3A 2K4DA 2EODA 4LKAA 2CSYA 4F52B 4WZ3B 4GNEA 4QF2A 4W4UA 1Z60A 2L0BA 3NG2A 1WGMA 1U6GB 3M63A 2L43A 2LXPC 3C5KA 5KH3A 2ZETC 4V3KC 3SOUA 5FEYA 5C13A 5LKTA 4UP0A 4TKPB 2KWKA 2YW8A 1VFYA 3ZYQA 3O70A 4LK9A 2VJEA 2MA6A 4PPEA 3PUQA 4R2YA 5H9MA 5KH9A 2YSMA 4A4BA 2M3HA 5D1MB 2L80A 2H0DA 2EA6A 2LXHC 3N9MA 4CCGX 2ECVA 4UI9B 3N9OA 5LKUA 3M62A 2CKLB 2YSJA 3LQIA 3V43A 4B86C 4YABA 4AYCB 4B7YC 1F62A 3C6WA 4XI1A 3KV6A 2CKLA 2KR4A 1IYMA 2LGVA 4N4FA 4O64A 3PURA 2LGGA 2F6NA 2XEUA 3SOXA 5LKZA 3LQJA 1MM3A 3T6RA 1JM7A 2VNFA 2ECNA 4NN2A 1HYIA 3RPGC 4YBMA 2YU4A 2YQLA 3VK6A 3SOWA 4YC9A 1MM2A 4L7XA 4YAXA 2C2LA 3PHDA 4AUQB 1K2FA 2KFTA 4FJCA 5FB0A 3U5NA 4IC2A 2KYUA 4R7EA 2OXQC 3N9LA 2MD7B 3O33A 2UZGA 2ECWA 2G43A 4YBTA 3DPLR 1X4UA 4S3OC 1WENA 2MD8C 3ZVZB 3HCSA 2ECIA 2E6RA 2HDPA 2F6JA 2NAAA 2YT5A 1WEEA 2LGKA 3O37A 5TBNA 4ZDTA 2YHNA 2E6SA 1E4UA 4MVTA 4YBSA 1VD4A 3SHBA 3T7LA 1T1HA 4BHWA 2VPEA 5H1VA 4GB0A 2VP7A 1FP0A 1V87A 2I50A 2VJEB 2CSZA 3L1ZB 3N9NA 2M85A 4R8PK 4WZ0A 2H0DB 2EGPA 2RI7A 2M1RA 2VPBA 2QJ0A 2DX8A 2VPGA 2KREA 3KNVA 1ZBDB 2KGIA 3MHHA 2PNXA 5KH7A 2YQMA 2CT2A 5H1TA 3ASLA 3ZVYA 2KWNA 2QICA 2ECJA 5D1KB 5I3LA 5LKXA 5FB1A 3I2DA 4YATA 4C9ZA 5AITA 3U5PA 5C11A 2FUIA 5JG6A 3EB6A 3ZTGA 2YHOA 5TRBA 4PTBA 1JM7B 1WILA 5FERA 3HCTA 3KQIA 2MNYA 1VYXA 2KWOA 2KWJA 2PUYA 2MUMA 4GNGA 5AIUA 5H1UA 4N3WA 4QF3A 5G0FA 4BBQA 3HCUA 5DKAA 4A0CD 3KV5A 2YREA 5LCWB 3L11A 3QZVA 3O34A 4L58A 2HYED 4LLBA 4ZQLA 2K1JA 2VJFB 3O35A 3ZNIA 3O36A 2K16A 2LV9A 2XB1A 2VJFA 3RPGB 4I7BA 1N87A 2M6MA 4MSXA 5D1LB 5EYAF 1HYJA 5J3XA 5B79A 2LDRA 5B75A 2QIZA 3GL6A 2RSDA 4LADB 2ECTA 2LQ6A 2YYRA 1FBVA 3RTRB 3GV4A 2FSAA 1X4JA 4FIPA 5B76A 3ZPVE 2FUUA 3M99A 4GNDA 1WFKA 2JMIA 2LRIC 1WEWA 3HTKC 2F42A 2KU3A 1WE9A 1Z2QA 3MHSA 4S3OB 4WZ2A 1WEUA 4A49A 2LN0A 1CHCA 1Z6UA 2YURA 1RMDA 3EB5A 3N9QA 3L1XA 3LRQA 5G04B 2IDAA 2ECGA 4P5OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIN A;  3IHP A;  4FO9 A;  2JRJ A;  2D8S A;  2YUC A;  4WA6 A;  5B78 A;  2G45 A;  1XWH A;  3ZPV 1;  3N9P A;  2C2V S;  1WIM A;  1WEV A;  2AN6 A;  2Y43 A;  2KIZ A;  1JOC A;  2Y1M A;  3O7A A;  2L5U A;  4FK5 A;  4Q6F A;  3U5O A;  4ZUX U;  1G25 A;  2K17 A;  4AYC A;  5B8D A;  3DQV R;  4GNF A;  2KGG A;  3U5M A;  1WEP A;  1DVP A;  4A4C A;  2Y1N A;  4YAD A;  2KE1 A;  2JMD A;  2L75 A;  2MA5 A;  2MNZ A;  4V3L C;  4I7D A;  2LGL A;  1WES A;  2MIQ A;  1BOR A;  3FL2 A;  4AP4 A;  5B77 A;  5TDW A;  2BAY A;  4AVX A;  2JMJ A;  5G05 B;  2VPD A;  5TDR A;  4LJN A;  2MT5 A;  1LDJ B;  1WEQ A;  4CA1 A;  1LDK C;  4X3G A;  1WEO A;  4I7C A;  2G6Q A;  5TAB A;  1X4I A;  3LQH A;  1WEM A;  4UP5 A;  4IC3 A;  2K4D A;  2EOD A;  4LKA A;  2CSY A;  4F52 B;  4WZ3 B;  4GNE A;  4QF2 A;  4W4U A;  1Z60 A;  2L0B A;  3NG2 A;  1WGM A;  1U6G B;  3M63 A;  2L43 A;  2LXP C;  3C5K A;  5KH3 A;  2ZET C;  4V3K C;  3SOU A;  5FEY A;  5C13 A;  5LKT A;  4UP0 A;  4TKP B;  2KWK A;  2YW8 A;  1VFY A;  3ZYQ A;  3O70 A;  4LK9 A;  2VJE A;  2MA6 A;  4PPE A;  3PUQ A;  4R2Y A;  5H9M A;  5KH9 A;  2YSM A;  4A4B A;  2M3H A;  5D1M B;  2L80 A;  2H0D A;  2EA6 A;  2LXH C;  3N9M A;  4CCG X;  2ECV A;  4UI9 B;  3N9O A;  5LKU A;  3M62 A;  2CKL B;  2YSJ A;  3LQI A;  3V43 A;  4B86 C;  4YAB A;  4AYC B;  4B7Y C;  1F62 A;  3C6W A;  4XI1 A;  3KV6 A;  2CKL A;  2KR4 A;  1IYM A;  2LGV A;  4N4F A;  4O64 A;  3PUR A;  2LGG A;  2F6N A;  2XEU A;  3SOX A;  5LKZ A;  3LQJ A;  1MM3 A;  3T6R A;  1JM7 A;  2VNF A;  2ECN A;  4NN2 A;  1HYI A;  3RPG C;  4YBM A;  2YU4 A;  2YQL A;  3VK6 A;  3SOW A;  4YC9 A;  1MM2 A;  4L7X A;  4YAX A;  2C2L A;  3PHD A;  4AUQ B;  1K2F A;  2KFT A;  4FJC A;  5FB0 A;  3U5N A;  4IC2 A;  2KYU A;  4R7E A;  2OXQ C;  3N9L A;  2MD7 B;  3O33 A;  2UZG A;  2ECW A;  2G43 A;  4YBT A;  3DPL R;  1X4U A;  4S3O C;  1WEN A;  2MD8 C;  3ZVZ B;  3HCS A;  2ECI A;  2E6R A;  2HDP A;  2F6J A;  2NAA A;  2YT5 A;  1WEE A;  2LGK A;  3O37 A;  5TBN A;  4ZDT A;  2YHN A;  2E6S A;  1E4U A;  4MVT A;  4YBS A;  1VD4 A;  3SHB A;  3T7L A;  1T1H A;  4BHW A;  2VPE A;  5H1V A;  4GB0 A;  2VP7 A;  1FP0 A;  1V87 A;  2I50 A;  2VJE B;  2CSZ A;  3L1Z B;  3N9N A;  2M85 A;  4R8P K;  4WZ0 A;  2H0D B;  2EGP A;  2RI7 A;  2M1R A;  2VPB A;  2QJ0 A;  2DX8 A;  2VPG A;  2KRE A;  3KNV A;  1ZBD B;  2KGI A;  3MHH A;  2PNX A;  5KH7 A;  2YQM A;  2CT2 A;  5H1T A;  3ASL A;  3ZVY A;  2KWN A;  2QIC A;  2ECJ A;  5D1K B;  5I3L A;  5LKX A;  5FB1 A;  3I2D A;  4YAT A;  4C9Z A;  5AIT A;  3U5P A;  5C11 A;  2FUI A;  5JG6 A;  3EB6 A;  3ZTG A;  2YHO A;  5TRB A;  4PTB A;  1JM7 B;  1WIL A;  5FER A;  3HCT A;  3KQI A;  2MNY A;  1VYX A;  2KWO A;  2KWJ A;  2PUY A;  2MUM A;  4GNG A;  5AIU A;  5H1U A;  4N3W A;  4QF3 A;  5G0F A;  4BBQ A;  3HCU A;  5DKA A;  4A0C D;  3KV5 A;  2YRE A;  5LCW B;  3L11 A;  3QZV A;  3O34 A;  4L58 A;  2HYE D;  4LLB A;  4ZQL A;  2K1J A;  2VJF B;  3O35 A;  3ZNI A;  3O36 A;  2K16 A;  2LV9 A;  2XB1 A;  2VJF A;  3RPG B;  4I7B A;  1N87 A;  2M6M A;  4MSX A;  5D1L B;  5EYA F;  1HYJ A;  5J3X A;  5B79 A;  2LDR A;  5B75 A;  2QIZ A;  3GL6 A;  2RSD A;  4LAD B;  2ECT A;  2LQ6 A;  2YYR A;  1FBV A;  3RTR B;  3GV4 A;  2FSA A;  1X4J A;  4FIP A;  5B76 A;  3ZPV E;  2FUU A;  3M99 A;  4GND A;  1WFK A;  2JMI A;  2LRI C;  1WEW A;  3HTK C;  2F42 A;  2KU3 A;  1WE9 A;  1Z2Q A;  3MHS A;  4S3O B;  4WZ2 A;  1WEU A;  4A49 A;  2LN0 A;  1CHC A;  1Z6U A;  2YUR A;  1RMD A;  3EB5 A;  3N9Q A;  3L1X A;  3LRQ A;  5G04 B;  2IDA A;  2ECG A;  4P5O B; 
#chains in the Genus database with same CATH topology
 5DIN A;  3IHP A;  4FO9 A;  2JRJ A;  2D8S A;  2YUC A;  3JUE A;  4WA6 A;  2FFW A;  5B78 A;  2G45 A;  1XWH A;  3ZPV 1;  3N9P A;  2C2V S;  1WIM A;  1WEV A;  2AN6 A;  2Y43 A;  2KIZ A;  1JOC A;  2KKX A;  2JM3 A;  2Y1M A;  3O7A A;  2L5U A;  4FK5 A;  4Q6F A;  3U5O A;  4ZUX U;  1G25 A;  2K17 A;  4OGC A;  4AYC A;  5B8D A;  3DQV R;  4GNF A;  2KGG A;  3U5M A;  1WEP A;  1DVP A;  4A4C A;  2Y1N A;  4YAD A;  2EXU A;  2KE1 A;  2JMD A;  2L75 A;  2MA5 A;  2MNZ A;  4V3L C;  4I7D A;  2LGL A;  1WES A;  2MIQ A;  1BOR A;  3FL2 A;  4AP4 A;  5B77 A;  2YVR A;  5TDW A;  2BAY A;  4AVX A;  2JMJ A;  5G05 B;  2VPD A;  5TDR A;  3DWD A;  4LJN A;  2MT5 A;  1LDJ B;  1WEQ A;  4CA1 A;  1LDK C;  5K3Q A;  4X3G A;  1WEO A;  1DCQ A;  4I7C A;  2G6Q A;  5TAB A;  1X4I A;  3LQH A;  1WEM A;  2M13 A;  4UP5 A;  4IC3 A;  2K4D A;  3Q1D A;  2EOD A;  4LKA A;  2CSY A;  4F52 B;  4WZ3 B;  4GNE A;  4QF2 A;  4W4U A;  3FJU B;  1Z60 A;  2L0B A;  3NG2 A;  3FAN A;  1WGM A;  1U6G B;  3LVQ E;  3M63 A;  2L43 A;  2LXP C;  3C5K A;  5KH3 A;  2ZET C;  4V3K C;  3SOU A;  4H9D A;  5FEY A;  5C13 A;  5LKT A;  4UP0 A;  4TKP B;  3LJU X;  2KWK A;  2YW8 A;  1VFY A;  3ZYQ A;  3O70 A;  2L7P A;  4LK9 A;  3MDB C;  2VJE A;  2MA6 A;  4PPE A;  3PUQ A;  4R2Y A;  5H9M A;  5KH9 A;  2YSM A;  2CON A;  4A4B A;  2M3H A;  5D1M B;  2L80 A;  2H0D A;  2EA6 A;  2LXH C;  3N9M A;  4CCG X;  2ECV A;  4UI9 B;  3N9O A;  5LKU A;  3M62 A;  3FM8 C;  2CKL B;  2YSJ A;  3LQI A;  3V43 A;  4B86 C;  4YAB A;  4AYC B;  4B7Y C;  1F62 A;  3C6W A;  4XI1 A;  3KV6 A;  2CKL A;  2KR4 A;  1IYM A;  2LGV A;  5SVX A;  4N4F A;  2E61 A;  4O64 A;  3PUR A;  2LGG A;  2F6N A;  2XEU A;  3SOX A;  5LKZ A;  3LQJ A;  2FD4 A;  1MM3 A;  3T6R A;  1JM7 A;  2VNF A;  2ECN A;  4NN2 A;  1HYI A;  3RPG C;  4YBM A;  3KDE C;  2YU4 A;  2YQL A;  3VK6 A;  3SOW A;  4YC9 A;  1MM2 A;  4L7X A;  4YAX A;  2C2L A;  2B0O E;  3PHD A;  4AUQ B;  1K2F A;  3E2D A;  3SUB A;  2KFT A;  4FJC A;  5FB0 A;  3U5N A;  4IC2 A;  2KYU A;  4R7E A;  2XP0 A;  2OXQ C;  3N9L A;  2MD7 B;  3O33 A;  5SVY A;  2UZG A;  2ECW A;  2G43 A;  4YBT A;  3DPL R;  3M7K A;  1X4U A;  2DSM A;  4S3O C;  1WEN A;  2MD8 C;  3ZVZ B;  3HCS A;  5SVI A;  2ECI A;  3T9K A;  2E6R A;  2HDP A;  2F6J A;  2NAA A;  2YT5 A;  3O47 A;  1WEE A;  3PLW A;  2LGK A;  3O37 A;  5TBN A;  4ZDT A;  2D8U A;  2E6S A;  2YHN A;  1E4U A;  4QQ4 A;  2EGM A;  4MVT A;  4YBS A;  2P57 A;  1VD4 A;  3SHB A;  3T7L A;  1T1H A;  4BHW A;  2VPE A;  5H1V A;  4GB0 A;  2VP7 A;  2JUN A;  1FP0 A;  1V87 A;  2I50 A;  2VJE B;  2CSZ A;  3L1Z B;  2LAU A;  3N9N A;  2M85 A;  4R8P K;  3FAO A;  4WZ0 A;  2H0D B;  2EGP A;  2RI7 A;  2M1R A;  2VPB A;  2QJ0 A;  2DX8 A;  2VPG A;  2KRE A;  3KNV A;  1ZBD B;  2KGI A;  1MBM A;  3MHH A;  2PNX A;  5KH7 A;  2YQM A;  2CT2 A;  5H1T A;  3ASL A;  3ZVY A;  2KWN A;  2QIC A;  2ECJ A;  5D1K B;  5I3L A;  2RR4 A;  5LKX A;  5FB1 A;  3I2D A;  4YAT A;  4C9Z A;  5AIT A;  3U5P A;  5C11 A;  2FUI A;  5JG6 A;  3EB6 A;  3ZTG A;  2YHO A;  3LVR E;  2IQJ A;  5TRB A;  4PTB A;  1JM7 B;  2MKE A;  1WIL A;  5FER A;  4OGE A;  3HCT A;  3KQI A;  2MNY A;  1VYX A;  2XOC A;  2KWO A;  2KWJ A;  2PUY A;  2CRR A;  2MUM A;  4GNG A;  5AIU A;  5H1U A;  4N3W A;  4QF3 A;  5G0F A;  2XOZ A;  2OWA A;  3DDT A;  4BBQ A;  3HCU A;  5DKA A;  4A0C D;  3KV5 A;  3H7H A;  2YRE A;  3LDY A;  5LCW B;  3L11 A;  2CSV A;  3QZV A;  3O34 A;  4L58 A;  2HYE D;  4LLB A;  4ZQL A;  2K1J A;  2VJF B;  3O35 A;  5SVI B;  3ZNI A;  3O36 A;  2K16 A;  2LV9 A;  2XB1 A;  2XOY A;  2VJF A;  3RPG B;  4I7B A;  1N87 A;  2M6M A;  4MSX A;  5D1L B;  5EYA F;  2DJA A;  1HYJ A;  5J3X A;  5B79 A;  2LDR A;  4Z0O A;  5B75 A;  2QIZ A;  3GL6 A;  2RSD A;  4LAD B;  2ECT A;  2LQ6 A;  2YYR A;  1FBV A;  3RTR B;  3GV4 A;  2FSA A;  1X4J A;  4FIP A;  5B76 A;  3ZPV E;  2FUU A;  3M99 A;  4GND A;  2CRW A;  1WFK A;  2JMI A;  2LRI C;  1WEW A;  3HTK C;  2F42 A;  2KU3 A;  1WE9 A;  1Z2Q A;  3MHS A;  4S3O B;  4Z0R A;  4WZ2 A;  1WEU A;  4A49 A;  2LN0 A;  1CHC A;  1Z6U A;  2YUR A;  1RMD A;  3EB5 A;  3N9Q A;  2KKY A;  3L1X A;  3LRQ A;  5G04 B;  2IDA A;  2ECG A;  3FEH A;  4O62 A;  4F1P A;  4P5O B; 
#chains in the Genus database with same CATH homology
 5DIN A;  3IHP A;  4FO9 A;  2JRJ A;  2D8S A;  2YUC A;  4WA6 A;  5B78 A;  2G45 A;  1XWH A;  3ZPV 1;  3N9P A;  2C2V S;  1WIM A;  1WEV A;  2AN6 A;  2Y43 A;  2KIZ A;  1JOC A;  2Y1M A;  3O7A A;  2L5U A;  4FK5 A;  4Q6F A;  3U5O A;  4ZUX U;  1G25 A;  2K17 A;  4AYC A;  5B8D A;  3DQV R;  4GNF A;  2KGG A;  3U5M A;  1WEP A;  1DVP A;  4A4C A;  2Y1N A;  4YAD A;  2KE1 A;  2JMD A;  2L75 A;  2MA5 A;  2MNZ A;  4V3L C;  4I7D A;  2LGL A;  1WES A;  2MIQ A;  1BOR A;  3FL2 A;  4AP4 A;  5B77 A;  5TDW A;  2BAY A;  4AVX A;  2JMJ A;  5G05 B;  2VPD A;  5TDR A;  4LJN A;  2MT5 A;  1LDJ B;  1WEQ A;  4CA1 A;  1LDK C;  4X3G A;  1WEO A;  4I7C A;  2G6Q A;  5TAB A;  1X4I A;  3LQH A;  1WEM A;  4UP5 A;  4IC3 A;  2K4D A;  2EOD A;  4LKA A;  2CSY A;  4F52 B;  4WZ3 B;  4GNE A;  4QF2 A;  4W4U A;  1Z60 A;  2L0B A;  3NG2 A;  1WGM A;  1U6G B;  3M63 A;  2L43 A;  2LXP C;  3C5K A;  5KH3 A;  2ZET C;  4V3K C;  3SOU A;  5FEY A;  5C13 A;  5LKT A;  4UP0 A;  4TKP B;  2KWK A;  2YW8 A;  1VFY A;  3ZYQ A;  3O70 A;  4LK9 A;  2VJE A;  2MA6 A;  4PPE A;  3PUQ A;  4R2Y A;  5H9M A;  5KH9 A;  2YSM A;  4A4B A;  2M3H A;  5D1M B;  2L80 A;  2H0D A;  2EA6 A;  2LXH C;  3N9M A;  4CCG X;  2ECV A;  4UI9 B;  3N9O A;  5LKU A;  3M62 A;  2CKL B;  2YSJ A;  3LQI A;  3V43 A;  4B86 C;  4YAB A;  4AYC B;  4B7Y C;  1F62 A;  3C6W A;  4XI1 A;  3KV6 A;  2CKL A;  2KR4 A;  1IYM A;  2LGV A;  4N4F A;  4O64 A;  3PUR A;  2LGG A;  2F6N A;  2XEU A;  3SOX A;  5LKZ A;  3LQJ A;  1MM3 A;  3T6R A;  1JM7 A;  2VNF A;  2ECN A;  4NN2 A;  1HYI A;  3RPG C;  4YBM A;  2YU4 A;  2YQL A;  3VK6 A;  3SOW A;  4YC9 A;  1MM2 A;  4L7X A;  4YAX A;  2C2L A;  3PHD A;  4AUQ B;  1K2F A;  2KFT A;  4FJC A;  5FB0 A;  3U5N A;  4IC2 A;  2KYU A;  4R7E A;  2OXQ C;  3N9L A;  2MD7 B;  3O33 A;  2UZG A;  2ECW A;  2G43 A;  4YBT A;  3DPL R;  1X4U A;  4S3O C;  1WEN A;  2MD8 C;  3ZVZ B;  3HCS A;  2ECI A;  2E6R A;  2HDP A;  2F6J A;  2NAA A;  2YT5 A;  1WEE A;  2LGK A;  3O37 A;  5TBN A;  4ZDT A;  2YHN A;  2E6S A;  1E4U A;  4MVT A;  4YBS A;  1VD4 A;  3SHB A;  3T7L A;  1T1H A;  4BHW A;  2VPE A;  5H1V A;  4GB0 A;  2VP7 A;  1FP0 A;  1V87 A;  2I50 A;  2VJE B;  2CSZ A;  3L1Z B;  3N9N A;  2M85 A;  4R8P K;  4WZ0 A;  2H0D B;  2EGP A;  2RI7 A;  2M1R A;  2VPB A;  2QJ0 A;  2DX8 A;  2VPG A;  2KRE A;  3KNV A;  1ZBD B;  2KGI A;  3MHH A;  2PNX A;  5KH7 A;  2YQM A;  2CT2 A;  5H1T A;  3ASL A;  3ZVY A;  2KWN A;  2QIC A;  2ECJ A;  5D1K B;  5I3L A;  5LKX A;  5FB1 A;  3I2D A;  4YAT A;  4C9Z A;  5AIT A;  3U5P A;  5C11 A;  2FUI A;  5JG6 A;  3EB6 A;  3ZTG A;  2YHO A;  5TRB A;  4PTB A;  1JM7 B;  1WIL A;  5FER A;  3HCT A;  3KQI A;  2MNY A;  1VYX A;  2KWO A;  2KWJ A;  2PUY A;  2MUM A;  4GNG A;  5AIU A;  5H1U A;  4N3W A;  4QF3 A;  5G0F A;  4BBQ A;  3HCU A;  5DKA A;  4A0C D;  3KV5 A;  2YRE A;  5LCW B;  3L11 A;  3QZV A;  3O34 A;  4L58 A;  2HYE D;  4LLB A;  4ZQL A;  2K1J A;  2VJF B;  3O35 A;  3ZNI A;  3O36 A;  2K16 A;  2LV9 A;  2XB1 A;  2VJF A;  3RPG B;  4I7B A;  1N87 A;  2M6M A;  4MSX A;  5D1L B;  5EYA F;  1HYJ A;  5J3X A;  5B79 A;  2LDR A;  5B75 A;  2QIZ A;  3GL6 A;  2RSD A;  4LAD B;  2ECT A;  2LQ6 A;  2YYR A;  1FBV A;  3RTR B;  3GV4 A;  2FSA A;  1X4J A;  4FIP A;  5B76 A;  3ZPV E;  2FUU A;  3M99 A;  4GND A;  1WFK A;  2JMI A;  2LRI C;  1WEW A;  3HTK C;  2F42 A;  2KU3 A;  1WE9 A;  1Z2Q A;  3MHS A;  4S3O B;  4WZ2 A;  1WEU A;  4A49 A;  2LN0 A;  1CHC A;  1Z6U A;  2YUR A;  1RMD A;  3EB5 A;  3N9Q A;  3L1X A;  3LRQ A;  5G04 B;  2IDA A;  2ECG A;  4P5O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...