3LDYA

An extraordinary mechanism of dna perturbation exhibited by the rare-cutting hnh restriction endonuclease paci
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
molecule tags Hydrolase/dna
molecule keywords restriction endonuclease PacI
total genus 48
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ldyA00
3LDYA 3M7KA
chains in the Genus database with same CATH superfamily
5KH3A 4I7DA 4C9ZA 2CKLB 4X3GA 1RMDA 3PHDA 4XI1A 2DJAA 4AVXA 3O37A 4QF2A 4BBQA 2PUYA 1IYMA 2IQJA 5D1MB 3IHPA 2KGGA 1T1HA 2M3HA 3FL2A 5G04B 3O36A 2MD8C 2MT5A 1WEQA 5TRBA 3ZVZB 1U6GB 2XOZA 3VK6A 2L75A 4B86C 4GNDA 2Y1NA 3DWDA 4P5OB 1Z6UA 2CRWA 3N9LA 3PLWA 4ZQLA 4MVTA 2DX8A 2JM3A 3O47A 4FO9A 4A4BA 4O62A 2JUNA 2YURA 3C6WA 5B78A 4A49A 2KREA 2CSZA 2KFTA 2LRIC 4FIPA 2FUIA 2YUCA 3O7AA 4GB0A 4A0CD 2ECJA 2LQ6A 1ZBDB 4S3OB 3ZVYA 1MBMA 2YQMA 3M62A 4N4FA 4WZ0A 2LGKA 2JMJA 2LDRA 1G25A 1VYXA 3KDEC 4YADA 1DVPA 3SUBA 3N9PA 1V87A 2VPEA 2F6JA 2UZGA 5D1KB 2FD4A 2ECTA 3U5MA 4AP4A 3E2DA 1WEMA 5G05B 3HCTA 5SVIA 2DSMA 4A4CA 3GV4A 3SOWA 1BORA 4R2YA 2XOYA 5H1UA 4MSXA 2VPGA 2MIQA 5TABA 4IC3A 2QIZA 3ZYQA 1X4IA 4GNFA 2KIZA 2MUMA 2H0DA 1LDJB 5J3XA 3MDBC 3FANA 3T6RA 2KWOA 5TDRA 4V3KC 1JM7A 3KNVA 3KV6A 3N9NA 4FK5A 4B7YC 2E6SA 1WE9A 2EODA 4I7CA 3L1ZB 5EYAF 4L7XA 2CSYA 4R7EA 3PURA 2K16A 2HYED 1JOCA 5LKTA 2YU4A 4LJNA 2L43A 3RPGB 1FP0A 2XEUA 4V3LC 5LKXA 2QJ0A 3O33A 4QQ4A 2VJFB 4CCGX 5SVXA 4PTBA 2JMIA 2XOCA 2CSVA 2NAAA 2I50A 3FM8C 5FEYA 3FEHA 4YATA 2M6MA 2KU3A 3C5KA 5B79A 2YVRA 2QICA 3LQJA 4NN2A 5B76A 1WESA 2KR4A 2M1RA 3T7LA 5B8DA 2OWAA 5C11A 3U5NA 3SOXA 4UP5A 1F62A 3LQIA 1HYJA 3LJUX 3LDYA 2JMDA 2MNYA 2MA6A 2D8SA 3O35A 4AYCB 4F1PA 4YBTA 5H9MA 2G43A 2M85A 4ZDTA 2KYUA 4YBSA 5I3LA 3HTKC 2G45A 2ZETC 4Z0RA 3T9KA 4AUQB 4OGCA 5FB1A 4YAXA 5JG6A 3DQVR 2CKLA 2Y1MA 2YYRA 4GNGA 4CA1A 4TKPB 2RR4A 2KWJA 5LKZA 3HCUA 2YW8A 2RI7A 2K1JA 2K4DA 2VJFA 5K3QA 4LLBA 3SHBA 2H0DB 4N3WA 3M7KA 1Z60A 3Q1DA 3ASLA 2E6RA 2IDAA 5G0FA 1X4UA 4WZ2A 2EA6A 3MHSA 2YREA 3HCSA 1WGMA 3ZTGA 4YBMA 2FFWA 5SVIB 3L11A 2L80A 2ECNA 4UP0A 2LN0A 3DPLR 1VD4A 5AIUA 1MM3A 2ECGA 3LRQA 4IC2A 5D1LB 1HYIA 2FSAA 2YSJA 2ECWA 1WEEA 2XB1A 4O64A 2YT5A 4YABA 1N87A 2ECVA 2D8UA 1LDKC 1WEOA 1FBVA 2VPDA 3O70A 2YSMA 3N9OA 4LK9A 3I2DA 4Z0OA 4UI9B 1JM7B 5B77A 1WENA 2C2LA 2KKXA 2VPBA 2MNZA 2MKEA 3DDTA 2YHNA 2JRJA 5LKUA 2E61A 3M63A 4Q6FA 4S3OC 5TBNA 2FUUA 3L1XA 4LADB 1K2FA 2VP7A 1WEPA 3SOUA 2LGVA 2KKYA 2VJEB 3H7HA 4WZ3B 2L0BA 3U5PA 2M13A 2LXHC 5H1TA 2AN6A 5DINA 4F52B 2K17A 4FJCA 5B75A 3JUEA 5AITA 4L58A 2F6NA 4BHWA 5LCWB 5KH9A 2VNFA 3ZPVE 4YC9A 2LAUA 2RSDA 3N9MA 3N9QA 3ZNIA 2Y43A 2KWKA 4QF3A 3LVQE 2F42A 2KE1A 1WEWA 1WEVA 5FB0A 3QZVA 1CHCA 2YQLA 2CRRA 1WIMA 2L7PA 3MHHA 2OXQC 4PPEA 2P57A 2PNXA 1X4JA 3EB5A 3PUQA 2MD7B 2VJEA 3RPGC 2MA5A 4I7BA 5KH7A 1WEUA 2L5UA 3GL6A 3KQIA 2LGGA 1VFYA 4OGEA 3ZPV1 3O34A 2KGIA 4H9DA 2BAYA 2CONA 1DCQA 4WA6A 5FERA 2LV9A 3FAOA 1XWHA 2XP0A 1MM2A 4ZUXU 3EB6A 4W4UA 1E4UA 3U5OA 3LQHA 2B0OE 2KWNA 3NG2A 2CT2A 2G6QA 4GNEA 4R8PK 3M99A 5TDWA 1Z2QA 5DKAA 2LGLA 3KV5A 3LVRE 2YHOA 2EGMA 5H1VA 1WFKA 2EGPA 2LXPC 4LKAA 2EXUA 4AYCA 2HDPA 2ECIA 5SVYA 2C2VS 5C13A 3V43A 3RTRB 1WILA 3FJUB
chains in the Genus database with same CATH topology
2XOCA 2KKXA 4OGEA 3DWDA 2CSVA 3MDBC 3E2DA 3M7KA 2CRWA 3PLWA 4H9DA 3Q1DA 2MKEA 2DJAA 3DDTA 5SVIA 2OWAA 3FM8C 3LVRE 2JM3A 3FEHA 2E61A 2EGMA 2CRRA 3JUEA 2L7PA 3O47A 2CONA 1DCQA 2EXUA 2P57A 2IQJA 2RR4A 3LJUX 3LDYA 3KDEC 2XOYA 2D8UA 2YREA 4F1PA 4O62A 2JUNA 5K3QA 2LAUA 2XP0A 2YVRA 3SUBA 5SVYA 3LVQE 4QQ4A 2FFWA 2XOZA 5SVIB 4Z0OA 2KKYA 3FJUB 5SVXA 4Z0RA 2B0OE 3H7HA 3T9KA 4OGCA 2M13A 2FD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDY A;  3M7K A; 
#chains in the Genus database with same CATH topology
 5KH3 A;  4I7D A;  4C9Z A;  2CKL B;  4X3G A;  1RMD A;  3PHD A;  4XI1 A;  2DJA A;  4AVX A;  3O37 A;  4QF2 A;  4BBQ A;  2PUY A;  1IYM A;  2IQJ A;  5D1M B;  3IHP A;  2KGG A;  1T1H A;  2M3H A;  3FL2 A;  5G04 B;  3O36 A;  2MD8 C;  2MT5 A;  1WEQ A;  5TRB A;  3ZVZ B;  1U6G B;  2XOZ A;  3VK6 A;  2L75 A;  4B86 C;  4GND A;  2Y1N A;  3DWD A;  4P5O B;  1Z6U A;  2CRW A;  3N9L A;  3PLW A;  4ZQL A;  4MVT A;  2DX8 A;  2JM3 A;  3O47 A;  4FO9 A;  4A4B A;  4O62 A;  2JUN A;  2YUR A;  3C6W A;  5B78 A;  4A49 A;  2KRE A;  2CSZ A;  2KFT A;  2LRI C;  4FIP A;  2FUI A;  2YUC A;  3O7A A;  4GB0 A;  4A0C D;  2ECJ A;  2LQ6 A;  1ZBD B;  4S3O B;  3ZVY A;  1MBM A;  2YQM A;  3M62 A;  4N4F A;  4WZ0 A;  2LGK A;  2JMJ A;  2LDR A;  1G25 A;  1VYX A;  3KDE C;  4YAD A;  1DVP A;  3SUB A;  3N9P A;  1V87 A;  2VPE A;  2F6J A;  2UZG A;  5D1K B;  2FD4 A;  2ECT A;  3U5M A;  4AP4 A;  3E2D A;  1WEM A;  5G05 B;  3HCT A;  5SVI A;  2DSM A;  4A4C A;  3GV4 A;  3SOW A;  1BOR A;  4R2Y A;  2XOY A;  5H1U A;  4MSX A;  2VPG A;  2MIQ A;  5TAB A;  4IC3 A;  2QIZ A;  3ZYQ A;  1X4I A;  4GNF A;  2KIZ A;  2MUM A;  2H0D A;  1LDJ B;  5J3X A;  3MDB C;  3FAN A;  3T6R A;  2KWO A;  5TDR A;  4V3K C;  1JM7 A;  3KNV A;  3KV6 A;  3N9N A;  4FK5 A;  4B7Y C;  2E6S A;  1WE9 A;  2EOD A;  4I7C A;  3L1Z B;  5EYA F;  4L7X A;  2CSY A;  4R7E A;  3PUR A;  2K16 A;  2HYE D;  1JOC A;  5LKT A;  2YU4 A;  4LJN A;  2L43 A;  3RPG B;  1FP0 A;  2XEU A;  4V3L C;  5LKX A;  2QJ0 A;  3O33 A;  4QQ4 A;  2VJF B;  4CCG X;  5SVX A;  4PTB A;  2JMI A;  2XOC A;  2CSV A;  2NAA A;  2I50 A;  3FM8 C;  5FEY A;  3FEH A;  4YAT A;  2M6M A;  2KU3 A;  3C5K A;  5B79 A;  2YVR A;  2QIC A;  3LQJ A;  4NN2 A;  5B76 A;  1WES A;  2KR4 A;  2M1R A;  3T7L A;  5B8D A;  2OWA A;  5C11 A;  3U5N A;  3SOX A;  4UP5 A;  1F62 A;  3LQI A;  1HYJ A;  3LJU X;  3LDY A;  2JMD A;  2MNY A;  2MA6 A;  2D8S A;  3O35 A;  4AYC B;  4F1P A;  4YBT A;  5H9M A;  2G43 A;  2M85 A;  4ZDT A;  2KYU A;  4YBS A;  5I3L A;  3HTK C;  2G45 A;  2ZET C;  4Z0R A;  3T9K A;  4AUQ B;  4OGC A;  5FB1 A;  4YAX A;  5JG6 A;  3DQV R;  2CKL A;  2Y1M A;  2YYR A;  4GNG A;  4CA1 A;  4TKP B;  2RR4 A;  2KWJ A;  5LKZ A;  3HCU A;  2YW8 A;  2RI7 A;  2K1J A;  2K4D A;  2VJF A;  5K3Q A;  4LLB A;  3SHB A;  2H0D B;  4N3W A;  3M7K A;  1Z60 A;  3Q1D A;  3ASL A;  2E6R A;  2IDA A;  5G0F A;  1X4U A;  4WZ2 A;  2EA6 A;  3MHS A;  2YRE A;  3HCS A;  1WGM A;  3ZTG A;  4YBM A;  2FFW A;  5SVI B;  3L11 A;  2L80 A;  2ECN A;  4UP0 A;  2LN0 A;  3DPL R;  1VD4 A;  5AIU A;  1MM3 A;  2ECG A;  3LRQ A;  4IC2 A;  5D1L B;  1HYI A;  2FSA A;  2YSJ A;  2ECW A;  1WEE A;  2XB1 A;  4O64 A;  2YT5 A;  4YAB A;  1N87 A;  2ECV A;  2D8U A;  1LDK C;  1WEO A;  1FBV A;  2VPD A;  3O70 A;  2YSM A;  3N9O A;  4LK9 A;  3I2D A;  4Z0O A;  4UI9 B;  1JM7 B;  5B77 A;  1WEN A;  2C2L A;  2KKX A;  2VPB A;  2MNZ A;  2MKE A;  3DDT A;  2YHN A;  2JRJ A;  5LKU A;  2E61 A;  3M63 A;  4Q6F A;  4S3O C;  5TBN A;  2FUU A;  3L1X A;  4LAD B;  1K2F A;  2VP7 A;  1WEP A;  3SOU A;  2LGV A;  2KKY A;  2VJE B;  3H7H A;  4WZ3 B;  2L0B A;  3U5P A;  2M13 A;  2LXH C;  5H1T A;  2AN6 A;  5DIN A;  4F52 B;  2K17 A;  4FJC A;  5B75 A;  3JUE A;  5AIT A;  4L58 A;  2F6N A;  4BHW A;  5LCW B;  5KH9 A;  2VNF A;  3ZPV E;  4YC9 A;  2LAU A;  2RSD A;  3N9M A;  3N9Q A;  3ZNI A;  2Y43 A;  2KWK A;  4QF3 A;  3LVQ E;  2F42 A;  2KE1 A;  1WEW A;  1WEV A;  5FB0 A;  3QZV A;  1CHC A;  2YQL A;  2CRR A;  1WIM A;  2L7P A;  3MHH A;  2OXQ C;  4PPE A;  2P57 A;  2PNX A;  1X4J A;  3EB5 A;  3PUQ A;  2MD7 B;  2VJE A;  3RPG C;  2MA5 A;  4I7B A;  5KH7 A;  1WEU A;  2L5U A;  3GL6 A;  3KQI A;  2LGG A;  1VFY A;  4OGE A;  3ZPV 1;  3O34 A;  2KGI A;  4H9D A;  2BAY A;  2CON A;  1DCQ A;  4WA6 A;  5FER A;  2LV9 A;  3FAO A;  1XWH A;  2XP0 A;  1MM2 A;  4ZUX U;  3EB6 A;  4W4U A;  1E4U A;  3U5O A;  3LQH A;  2B0O E;  2KWN A;  3NG2 A;  2CT2 A;  2G6Q A;  4GNE A;  4R8P K;  3M99 A;  5TDW A;  1Z2Q A;  5DKA A;  2LGL A;  3KV5 A;  3LVR E;  2YHO A;  2EGM A;  5H1V A;  1WFK A;  2EGP A;  2LXP C;  4LKA A;  2EXU A;  4AYC A;  2HDP A;  2ECI A;  5SVY A;  2C2V S;  5C13 A;  3V43 A;  3RTR B;  1WIL A;  3FJU B; 
#chains in the Genus database with same CATH homology
 2XOC A;  2KKX A;  4OGE A;  3DWD A;  2CSV A;  3MDB C;  3E2D A;  3M7K A;  2CRW A;  3PLW A;  4H9D A;  3Q1D A;  2MKE A;  2DJA A;  3DDT A;  5SVI A;  2OWA A;  3FM8 C;  3LVR E;  2JM3 A;  3FEH A;  2E61 A;  2EGM A;  2CRR A;  3JUE A;  2L7P A;  3O47 A;  2CON A;  1DCQ A;  2EXU A;  2P57 A;  2IQJ A;  2RR4 A;  3LJU X;  3LDY A;  3KDE C;  2XOY A;  2D8U A;  2YRE A;  4F1P A;  4O62 A;  2JUN A;  5K3Q A;  2LAU A;  2XP0 A;  2YVR A;  3SUB A;  5SVY A;  3LVQ E;  4QQ4 A;  2FFW A;  2XOZ A;  5SVI B;  4Z0O A;  2KKY A;  3FJU B;  5SVX A;  4Z0R A;  2B0O E;  3H7H A;  3T9K A;  4OGC A;  2M13 A;  2FD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...