3LDYA

An extraordinary mechanism of dna perturbation exhibited by the rare-cutting hnh restriction endonuclease paci
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
molecule tags Hydrolase/dna
total genus 48
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ldyA00
3M7KA 3LDYA
chains in the Genus database with same CATH superfamily
3PURA 2XP0A 4B7YC 5LKUA 4R8PK 4F52B 4N3WA 4L58A 1WIMA 2LQ6A 4LADB 1WEUA 2HDPA 2K1JA 4GB0A 5AIUA 3LDYA 3PUQA 1LDKC 2MKEA 5KH9A 4XI1A 4YAXA 2DJAA 3LQHA 2YUCA 2C2LA 2ZETC 4YADA 3KV6A 2K16A 2VNFA 4WZ3B 2JUNA 2VJFA 4UI9B 2OWAA 3LVQE 3N9NA 3RPGC 2ECWA 5G0FA 2VP7A 3O36A 1E4UA 2G6QA 4QQ4A 2M6MA 5TDRA 2JMDA 5SVYA 4LK9A 4I7BA 2VJEA 3RPGB 4LLBA 4W4UA 3KDEC 3FJUB 4YBMA 2KGGA 3N9OA 4AVXA 4FO9A 2HYED 3ZPVE 2MUMA 2B0OE 4WZ0A 5FERA 1JM7B 5H1TA 4C9ZA 4PTBA 4FIPA 4V3LC 4AUQB 5EYAF 4Q6FA 4R2YA 2LGVA 2MT5A 3EB5A 2JMIA 5B78A 2YYRA 4WA6A 2OXQC 2KKYA 1WILA 2M1RA 5DINA 2EA6A 1Z2QA 2H0DA 2FUIA 2YSJA 2YHOA 3N9LA 1X4UA 2EXUA 2KR4A 3O33A 2LV9A 3ZNIA 2ECIA 2KIZA 2Y1NA 5KH3A 2FD4A 2CRWA 1WENA 2JMJA 1DCQA 4YC9A 3FANA 2EODA 2YREA 2Y43A 3FM8C 3U5PA 3FEHA 1JOCA 3LQIA 4MVTA 4O64A 3U5OA 3SHBA 2YW8A 3N9MA 2L5UA 2YVRA 5LKZA 1WEOA 3FAOA 5SVIB 4YBTA 3T9KA 5I3LA 3N9PA 2PNXA 4QF2A 4AYCB 1X4IA 2PUYA 1VFYA 2G43A 2IDAA 5D1LB 1T1HA 3L1XA 3C5KA 2KWKA 3NG2A 3LRQA 3PLWA 5B76A 2ECVA 2CKLA 2IQJA 4NN2A 2LRIC 4A49A 5TABA 2MIQA 2MA6A 1RMDA 1WGMA 1VD4A 2FFWA 5B77A 2ECNA 2LN0A 3N9QA 4BBQA 1U6GB 2KYUA 5H1UA 4QF3A 2FUUA 1LDJB 1VYXA 4WZ2A 3HCTA 2L80A 5B8DA 3MDBC 1V87A 1WEQA 3ZPV1 2QIZA 4FJCA 2LGKA 4GNDA 5JG6A 2DSMA 2F6NA 1FBVA 3GV4A 2EGMA 4CA1A 2E6RA 4TKPB 2FSAA 3KNVA 5B79A 3EB6A 3VK6A 2LAUA 4O62A 2QICA 4A4CA 2VPEA 2M3HA 4X3GA 1Z60A 3O35A 5D1MB 2P57A 3JUEA 5LKXA 5DKAA 3ZYQA 2LXPC 2C2VS 2KGIA 2LGGA 3L11A 1WESA 5FB1A 4GNEA 2VPBA 5FEYA 4OGCA 2L0BA 2YU4A 4L7XA 2YHNA 1ZBDB 4B86C 1FP0A 2MA5A 5G04B 2VPDA 5H9MA 4UP0A 1N87A 1K2FA 1WEMA 4MSXA 2LXHC 3M99A 2KU3A 1WEPA 4A0CD 2JRJA 4LKAA 5SVXA 3PHDA 2RI7A 2ECTA 5TBNA 4YABA 3QZVA 1JM7A 3M7KA 2ECGA 5D1KB 2RR4A 1HYIA 2LDRA 3O34A 2KWOA 2VJEB 1WE9A 3MHSA 1DVPA 1F62A 4IC2A 3LVRE 3Q1DA 4ZQLA 2KKXA 3H7HA 4Z0RA 2CSZA 2YQMA 3ASLA 2XB1A 4F1PA 4I7CA 4YATA 2LGLA 2Y1MA 2YT5A 1MM2A 2CT2A 3KQIA 2E6SA 4N4FA 2CSVA 3HCUA 4GNFA 3SOXA 2D8SA 4I7DA 5G05B 5AITA 2I50A 2QJ0A 5TRBA 4IC3A 2D8UA 3M63A 4FK5A 2H0DB 2EGPA 4V3KC 2E61A 5K3QA 5KH7A 2CSYA 3SUBA 1G25A 2AN6A 2XEUA 3O37A 2BAYA 3ZTGA 4R7EA 3ZVZB 5LKTA 2KREA 2UZGA 3DPLR 3RTRB 3KV5A 4ZDTA 5SVIA 2KWNA 2MNZA 3HCSA 2F42A 4S3OC 4AYCA 3V43A 2JM3A 2MD7B 2XOZA 1WFKA 2DX8A 1XWHA 4UP5A 1CHCA 4H9DA 4LJNA 2L7PA 2XOYA 4S3OB 1HYJA 2F6JA 2M13A 2L43A 3DDTA 3O47A 3C6WA 4PPEA 3LJUX 4ZUXU 3O70A 1IYMA 2KFTA 3HTKC 2ECJA 5C11A 3GL6A 3LQJA 1X4JA 2KE1A 4P5OB 5H1VA 2CONA 3SOUA 3I2DA 2CRRA 2CKLB 2MD8C 2K17A 2RSDA 2L75A 2MNYA 1BORA 4BHWA 3FL2A 3MHHA 2K4DA 4AP4A 2VJFB 4OGEA 5C13A 1MBMA 4Z0OA 5FB0A 5TDWA 4GNGA 3ZVYA 5B75A 4A4BA 2YQLA 3M62A 3U5MA 2YURA 3T6RA 5J3XA 2VPGA 3U5NA 1WEEA 3IHPA 1WEWA 3SOWA 3DQVR 1WEVA 1MM3A 3DWDA 2YSMA 3E2DA 3T7LA 1Z6UA 2XOCA 3L1ZB 2KWJA 5LCWB 3O7AA 4YBSA 2G45A 4CCGX 2NAAA 2M85A
chains in the Genus database with same CATH topology
4F1PA 3SUBA 2IQJA 2FD4A 2JM3A 2CRWA 2XP0A 5SVIB 3T9KA 3MDBC 2XOZA 3M7KA 3KDEC 1DCQA 3FJUB 2KKYA 2RR4A 2P57A 3JUEA 2JUNA 2CONA 2YREA 3FM8C 4H9DA 2OWAA 2CRRA 2B0OE 2L7PA 2FFWA 2XOYA 3FEHA 3LVQE 2CSVA 3LVRE 3DWDA 3Q1DA 3E2DA 2M13A 2KKXA 3H7HA 3O47A 3DDTA 4OGCA 4Z0RA 5SVIA 2EGMA 5SVXA 3LDYA 2XOCA 3LJUX 2EXUA 2D8UA 4QQ4A 2MKEA 3PLWA 2LAUA 4O62A 5SVYA 4OGEA 2E61A 2YVRA 5K3QA 4Z0OA 2DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7K A;  3LDY A; 
#chains in the Genus database with same CATH topology
 3PUR A;  2XP0 A;  4B7Y C;  5LKU A;  4R8P K;  4F52 B;  4N3W A;  4L58 A;  1WIM A;  2LQ6 A;  4LAD B;  1WEU A;  2HDP A;  2K1J A;  4GB0 A;  5AIU A;  3LDY A;  3PUQ A;  1LDK C;  2MKE A;  5KH9 A;  4XI1 A;  4YAX A;  2DJA A;  3LQH A;  2YUC A;  2C2L A;  2ZET C;  4YAD A;  3KV6 A;  2K16 A;  2VNF A;  4WZ3 B;  2JUN A;  2VJF A;  4UI9 B;  2OWA A;  3LVQ E;  3N9N A;  3RPG C;  2ECW A;  5G0F A;  2VP7 A;  3O36 A;  1E4U A;  2G6Q A;  4QQ4 A;  2M6M A;  5TDR A;  2JMD A;  5SVY A;  4LK9 A;  4I7B A;  2VJE A;  3RPG B;  4LLB A;  4W4U A;  3KDE C;  3FJU B;  4YBM A;  2KGG A;  3N9O A;  4AVX A;  4FO9 A;  2HYE D;  3ZPV E;  2MUM A;  2B0O E;  4WZ0 A;  5FER A;  1JM7 B;  5H1T A;  4C9Z A;  4PTB A;  4FIP A;  4V3L C;  4AUQ B;  5EYA F;  4Q6F A;  4R2Y A;  2LGV A;  2MT5 A;  3EB5 A;  2JMI A;  5B78 A;  2YYR A;  4WA6 A;  2OXQ C;  2KKY A;  1WIL A;  2M1R A;  5DIN A;  2EA6 A;  1Z2Q A;  2H0D A;  2FUI A;  2YSJ A;  2YHO A;  3N9L A;  1X4U A;  2EXU A;  2KR4 A;  3O33 A;  2LV9 A;  3ZNI A;  2ECI A;  2KIZ A;  2Y1N A;  5KH3 A;  2FD4 A;  2CRW A;  1WEN A;  2JMJ A;  1DCQ A;  4YC9 A;  3FAN A;  2EOD A;  2YRE A;  2Y43 A;  3FM8 C;  3U5P A;  3FEH A;  1JOC A;  3LQI A;  4MVT A;  4O64 A;  3U5O A;  3SHB A;  2YW8 A;  3N9M A;  2L5U A;  2YVR A;  5LKZ A;  1WEO A;  3FAO A;  5SVI B;  4YBT A;  3T9K A;  5I3L A;  3N9P A;  2PNX A;  4QF2 A;  4AYC B;  1X4I A;  2PUY A;  1VFY A;  2G43 A;  2IDA A;  5D1L B;  1T1H A;  3L1X A;  3C5K A;  2KWK A;  3NG2 A;  3LRQ A;  3PLW A;  5B76 A;  2ECV A;  2CKL A;  2IQJ A;  4NN2 A;  2LRI C;  4A49 A;  5TAB A;  2MIQ A;  2MA6 A;  1RMD A;  1WGM A;  1VD4 A;  2FFW A;  5B77 A;  2ECN A;  2LN0 A;  3N9Q A;  4BBQ A;  1U6G B;  2KYU A;  5H1U A;  4QF3 A;  2FUU A;  1LDJ B;  1VYX A;  4WZ2 A;  3HCT A;  2L80 A;  5B8D A;  3MDB C;  1V87 A;  1WEQ A;  3ZPV 1;  2QIZ A;  4FJC A;  2LGK A;  4GND A;  5JG6 A;  2DSM A;  2F6N A;  1FBV A;  3GV4 A;  2EGM A;  4CA1 A;  2E6R A;  4TKP B;  2FSA A;  3KNV A;  5B79 A;  3EB6 A;  3VK6 A;  2LAU A;  4O62 A;  2QIC A;  4A4C A;  2VPE A;  2M3H A;  4X3G A;  1Z60 A;  3O35 A;  5D1M B;  2P57 A;  3JUE A;  5LKX A;  5DKA A;  3ZYQ A;  2LXP C;  2C2V S;  2KGI A;  2LGG A;  3L11 A;  1WES A;  5FB1 A;  4GNE A;  2VPB A;  5FEY A;  4OGC A;  2L0B A;  2YU4 A;  4L7X A;  2YHN A;  1ZBD B;  4B86 C;  1FP0 A;  2MA5 A;  5G04 B;  2VPD A;  5H9M A;  4UP0 A;  1N87 A;  1K2F A;  1WEM A;  4MSX A;  2LXH C;  3M99 A;  2KU3 A;  1WEP A;  4A0C D;  2JRJ A;  4LKA A;  5SVX A;  3PHD A;  2RI7 A;  2ECT A;  5TBN A;  4YAB A;  3QZV A;  1JM7 A;  3M7K A;  2ECG A;  5D1K B;  2RR4 A;  1HYI A;  2LDR A;  3O34 A;  2KWO A;  2VJE B;  1WE9 A;  3MHS A;  1DVP A;  1F62 A;  4IC2 A;  3LVR E;  3Q1D A;  4ZQL A;  2KKX A;  3H7H A;  4Z0R A;  2CSZ A;  2YQM A;  3ASL A;  2XB1 A;  4F1P A;  4I7C A;  4YAT A;  2LGL A;  2Y1M A;  2YT5 A;  1MM2 A;  2CT2 A;  3KQI A;  2E6S A;  4N4F A;  2CSV A;  3HCU A;  4GNF A;  3SOX A;  2D8S A;  4I7D A;  5G05 B;  5AIT A;  2I50 A;  2QJ0 A;  5TRB A;  4IC3 A;  2D8U A;  3M63 A;  4FK5 A;  2H0D B;  2EGP A;  4V3K C;  2E61 A;  5K3Q A;  5KH7 A;  2CSY A;  3SUB A;  1G25 A;  2AN6 A;  2XEU A;  3O37 A;  2BAY A;  3ZTG A;  4R7E A;  3ZVZ B;  5LKT A;  2KRE A;  2UZG A;  3DPL R;  3RTR B;  3KV5 A;  4ZDT A;  5SVI A;  2KWN A;  2MNZ A;  3HCS A;  2F42 A;  4S3O C;  4AYC A;  3V43 A;  2JM3 A;  2MD7 B;  2XOZ A;  1WFK A;  2DX8 A;  1XWH A;  4UP5 A;  1CHC A;  4H9D A;  4LJN A;  2L7P A;  2XOY A;  4S3O B;  1HYJ A;  2F6J A;  2M13 A;  2L43 A;  3DDT A;  3O47 A;  3C6W A;  4PPE A;  3LJU X;  4ZUX U;  3O70 A;  1IYM A;  2KFT A;  3HTK C;  2ECJ A;  5C11 A;  3GL6 A;  3LQJ A;  1X4J A;  2KE1 A;  4P5O B;  5H1V A;  2CON A;  3SOU A;  3I2D A;  2CRR A;  2CKL B;  2MD8 C;  2K17 A;  2RSD A;  2L75 A;  2MNY A;  1BOR A;  4BHW A;  3FL2 A;  3MHH A;  2K4D A;  4AP4 A;  2VJF B;  4OGE A;  5C13 A;  1MBM A;  4Z0O A;  5FB0 A;  5TDW A;  4GNG A;  3ZVY A;  5B75 A;  4A4B A;  2YQL A;  3M62 A;  3U5M A;  2YUR A;  3T6R A;  5J3X A;  2VPG A;  3U5N A;  1WEE A;  3IHP A;  1WEW A;  3SOW A;  3DQV R;  1WEV A;  1MM3 A;  3DWD A;  2YSM A;  3E2D A;  3T7L A;  1Z6U A;  2XOC A;  3L1Z B;  2KWJ A;  5LCW B;  3O7A A;  4YBS A;  2G45 A;  4CCG X;  2NAA A;  2M85 A; 
#chains in the Genus database with same CATH homology
 4F1P A;  3SUB A;  2IQJ A;  2FD4 A;  2JM3 A;  2CRW A;  2XP0 A;  5SVI B;  3T9K A;  3MDB C;  2XOZ A;  3M7K A;  3KDE C;  1DCQ A;  3FJU B;  2KKY A;  2RR4 A;  2P57 A;  3JUE A;  2JUN A;  2CON A;  2YRE A;  3FM8 C;  4H9D A;  2OWA A;  2CRR A;  2B0O E;  2L7P A;  2FFW A;  2XOY A;  3FEH A;  3LVQ E;  2CSV A;  3LVR E;  3DWD A;  3Q1D A;  3E2D A;  2M13 A;  2KKX A;  3H7H A;  3O47 A;  3DDT A;  4OGC A;  4Z0R A;  5SVI A;  2EGM A;  5SVX A;  3LDY A;  2XOC A;  3LJU X;  2EXU A;  2D8U A;  4QQ4 A;  2MKE A;  3PLW A;  2LAU A;  4O62 A;  5SVY A;  4OGE A;  2E61 A;  2YVR A;  5K3Q A;  4Z0O A;  2DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...