3LDYA

An extraordinary mechanism of dna perturbation exhibited by the rare-cutting hnh restriction endonuclease paci
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
b'MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
molecule tags Hydrolase/dna
total genus 48
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ldyA00
3LDYA 3M7KA
chains in the Genus database with same CATH superfamily
3KDEC 3GL6A 2HDPA 4UP0A 5TDWA 4GNEA 4AVXA 2ECNA 2LXHC 4I7CA 4Q6FA 5TBNA 2YSJA 4I7BA 2M1RA 4WZ0A 3ZVYA 4A49A 1E4UA 2H0DA 2YW8A 3FEHA 4YATA 3PURA 3ZTGA 2M13A 3SOUA 4LKAA 5LKXA 4WA6A 1K2FA 3O33A 4LADB 2KWNA 2HYED 2YHOA 4FK5A 5SVIB 3EB5A 2EGMA 3O7AA 3SOWA 2KGIA 2CSVA 5KH9A 2F6JA 3DWDA 2G45A 5LKTA 2EA6A 3EB6A 2QIZA 3O34A 2K16A 2MUMA 4ZQLA 2H0DB 5TDRA 5H1TA 2KWKA 3RTRB 3U5MA 2YUCA 4V3KC 4R8PK 1WEQA 1MBMA 2YU4A 3L1ZB 3KQIA 2E61A 5D1MB 2IQJA 5SVYA 4QQ4A 4GNGA 3C5KA 3FJUB 3N9MA 5AIUA 2KWJA 1DVPA 1VYXA 3LRQA 3FM8C 2FFWA 5TABA 3T7LA 3U5PA 4LJNA 4BHWA 1WFKA 1X4JA 3N9PA 3N9LA 4ZUXU 4WZ3B 3QZVA 5B76A 4CA1A 2M6MA 2MKEA 2KREA 3VK6A 2JMDA 3JUEA 3KV5A 2FUUA 5B79A 5EYAF 2ECGA 2K4DA 1MM3A 3ZNIA 5C11A 1WILA 3L11A 3KNVA 2XOZA 3ZVZB 1WEMA 3U5NA 4C9ZA 4IC3A 1IYMA 4O62A 2M85A 2FUIA 3SOXA 2VJFA 2MNYA 3U5OA 2L80A 1Z60A 4L7XA 3SUBA 1X4UA 2IDAA 5FEYA 2YURA 2OWAA 2YQLA 3DQVR 5KH3A 1RMDA 3GV4A 4OGCA 4PPEA 1VD4A 4OGEA 3M7KA 4R7EA 1F62A 4CCGX 1T1HA 2KFTA 3HCUA 5J3XA 3N9OA 2ECTA 2KR4A 2I50A 2NAAA 2M3HA 2OXQC 2MT5A 2VPDA 5LKUA 2Y43A 4LK9A 4FJCA 2ECVA 2VJFB 4NN2A 2DX8A 2AN6A 2CRRA 1VFYA 3LDYA 3FANA 5AITA 2LGLA 2L7PA 1BORA 1DCQA 2YT5A 2VJEA 2VPGA 1G25A 2CONA 4P5OB 3E2DA 5FB1A 5FB0A 3MHSA 2L43A 2F42A 3ASLA 3N9QA 5SVXA 2YHNA 1U6GB 2K1JA 3O36A 4A0CD 2LGKA 5G05B 4O64A 3ZYQA 4GNDA 4TKPB 2LXPC 5LCWB 3O47A 4Z0RA 3IHPA 2LV9A 5K3QA 2XOYA 4S3OC 5B75A 3ZPVE 2MD8C 4MSXA 2MNZA 2RSDA 3KV6A 4N3WA 4YABA 2ZETC 5FERA 2VJEB 2FSAA 4WZ2A 2DSMA 5TRBA 4A4CA 4IC2A 2BAYA 2KE1A 1JM7A 3PLWA 2KIZA 2QJ0A 3FL2A 4B86C 3V43A 2VPBA 1MM2A 2ECWA 2UZGA 1WEUA 4UI9B 2VPEA 3HTKC 5JG6A 2L75A 1N87A 5G04B 2C2VS 2ECIA 2G6QA 3DDTA 4GB0A 3O70A 2RR4A 3MHHA 4F1PA 5C13A 2XB1A 3M99A 1WEEA 3C6WA 2KKXA 4Z0OA 2JM3A 1HYIA 4LLBA 1FP0A 3I2DA 2CRWA 3PUQA 1WEOA 2LRIC 1XWHA 3LQIA 1FBVA 1JM7B 2MA5A 3MDBC 5B78A 4QF3A 2CSZA 4H9DA 4XI1A 2KKYA 4N4FA 2VNFA 2JMIA 4L58A 5LKZA 2YSMA 2PUYA 2EXUA 2XOCA 3N9NA 4A4BA 3FAOA 4AP4A 4X3GA 5B8DA 2L5UA 4ZDTA 1HYJA 2DJAA 2QICA 5D1KB 2B0OE 3M63A 1WEPA 2CT2A 4F52B 4YC9A 3LVQE 2LDRA 2MIQA 5D1LB 4QF2A 3LQHA 2LGGA 4AYCA 2EODA 2L0BA 3Q1DA 2KWOA 2MA6A 4W4UA 2F6NA 2CKLA 2VP7A 5H9MA 2D8SA 3M62A 2RI7A 2CSYA 4FIPA 3T9KA 2ECJA 1WE9A 2YYRA 3SHBA 2KU3A 4YAXA 4MVTA 1CHCA 4UP5A 2Y1NA 3O37A 4YADA 2FD4A 2LGVA 5H1UA 3O35A 4FO9A 4YBMA 3H7HA 1WEVA 3LJUX 2LQ6A 4AUQB 1WEWA 4V3LC 3LVRE 4I7DA 4AYCB 2JMJA 5KH7A 5B77A 5I3LA 3RPGC 1Z6UA 4R2YA 2CKLB 3DPLR 1WENA 1V87A 5G0FA 3PHDA 3T6RA 4YBTA 1LDKC 1WIMA 2LAUA 2JUNA 4S3OB 4YBSA 2E6RA 2D8UA 2KGGA 2KYUA 2YREA 3NG2A 3RPGB 2XEUA 2Y1MA 2YQMA 2EGPA 1WGMA 4B7YC 2C2LA 4PTBA 2G43A 2JRJA 3ZPV1 1JOCA 2XP0A 1WESA 4GNFA 5DKAA 5H1VA 5DINA 1ZBDB 1Z2QA 1LDJB 1X4IA 2P57A 3L1XA 4BBQA 2YVRA 2PNXA 3HCTA 2LN0A 3LQJA 2E6SA 3HCSA 5SVIA 2K17A 2MD7B
chains in the Genus database with same CATH topology
3KDEC 2D8UA 3SUBA 3DDTA 2XP0A 3E2DA 3LVRE 3MDBC 2YREA 2OWAA 2RR4A 2DJAA 2B0OE 4H9DA 3FM8C 4F1PA 5SVXA 2FFWA 2CRRA 4OGCA 2XOZA 5SVIB 2P57A 2EGMA 3T9KA 3LDYA 2KKYA 2KKXA 4OGEA 3LVQE 2YVRA 3M7KA 2CSVA 3PLWA 3H7HA 3DWDA 4Z0OA 2JM3A 4O62A 2L7PA 2E61A 2CRWA 2FD4A 3FEHA 2IQJA 2MKEA 2EXUA 2XOCA 3FJUB 3O47A 3Q1DA 4Z0RA 5SVYA 4QQ4A 1DCQA 5K3QA 5SVIA 3JUEA 2XOYA 2M13A 2LAUA 2JUNA 3LJUX 2CONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDY A;  3M7K A; 
#chains in the Genus database with same CATH topology
 3KDE C;  3GL6 A;  2HDP A;  4UP0 A;  5TDW A;  4GNE A;  4AVX A;  2ECN A;  2LXH C;  4I7C A;  4Q6F A;  5TBN A;  2YSJ A;  4I7B A;  2M1R A;  4WZ0 A;  3ZVY A;  4A49 A;  1E4U A;  2H0D A;  2YW8 A;  3FEH A;  4YAT A;  3PUR A;  3ZTG A;  2M13 A;  3SOU A;  4LKA A;  5LKX A;  4WA6 A;  1K2F A;  3O33 A;  4LAD B;  2KWN A;  2HYE D;  2YHO A;  4FK5 A;  5SVI B;  3EB5 A;  2EGM A;  3O7A A;  3SOW A;  2KGI A;  2CSV A;  5KH9 A;  2F6J A;  3DWD A;  2G45 A;  5LKT A;  2EA6 A;  3EB6 A;  2QIZ A;  3O34 A;  2K16 A;  2MUM A;  4ZQL A;  2H0D B;  5TDR A;  5H1T A;  2KWK A;  3RTR B;  3U5M A;  2YUC A;  4V3K C;  4R8P K;  1WEQ A;  1MBM A;  2YU4 A;  3L1Z B;  3KQI A;  2E61 A;  5D1M B;  2IQJ A;  5SVY A;  4QQ4 A;  4GNG A;  3C5K A;  3FJU B;  3N9M A;  5AIU A;  2KWJ A;  1DVP A;  1VYX A;  3LRQ A;  3FM8 C;  2FFW A;  5TAB A;  3T7L A;  3U5P A;  4LJN A;  4BHW A;  1WFK A;  1X4J A;  3N9P A;  3N9L A;  4ZUX U;  4WZ3 B;  3QZV A;  5B76 A;  4CA1 A;  2M6M A;  2MKE A;  2KRE A;  3VK6 A;  2JMD A;  3JUE A;  3KV5 A;  2FUU A;  5B79 A;  5EYA F;  2ECG A;  2K4D A;  1MM3 A;  3ZNI A;  5C11 A;  1WIL A;  3L11 A;  3KNV A;  2XOZ A;  3ZVZ B;  1WEM A;  3U5N A;  4C9Z A;  4IC3 A;  1IYM A;  4O62 A;  2M85 A;  2FUI A;  3SOX A;  2VJF A;  2MNY A;  3U5O A;  2L80 A;  1Z60 A;  4L7X A;  3SUB A;  1X4U A;  2IDA A;  5FEY A;  2YUR A;  2OWA A;  2YQL A;  3DQV R;  5KH3 A;  1RMD A;  3GV4 A;  4OGC A;  4PPE A;  1VD4 A;  4OGE A;  3M7K A;  4R7E A;  1F62 A;  4CCG X;  1T1H A;  2KFT A;  3HCU A;  5J3X A;  3N9O A;  2ECT A;  2KR4 A;  2I50 A;  2NAA A;  2M3H A;  2OXQ C;  2MT5 A;  2VPD A;  5LKU A;  2Y43 A;  4LK9 A;  4FJC A;  2ECV A;  2VJF B;  4NN2 A;  2DX8 A;  2AN6 A;  2CRR A;  1VFY A;  3LDY A;  3FAN A;  5AIT A;  2LGL A;  2L7P A;  1BOR A;  1DCQ A;  2YT5 A;  2VJE A;  2VPG A;  1G25 A;  2CON A;  4P5O B;  3E2D A;  5FB1 A;  5FB0 A;  3MHS A;  2L43 A;  2F42 A;  3ASL A;  3N9Q A;  5SVX A;  2YHN A;  1U6G B;  2K1J A;  3O36 A;  4A0C D;  2LGK A;  5G05 B;  4O64 A;  3ZYQ A;  4GND A;  4TKP B;  2LXP C;  5LCW B;  3O47 A;  4Z0R A;  3IHP A;  2LV9 A;  5K3Q A;  2XOY A;  4S3O C;  5B75 A;  3ZPV E;  2MD8 C;  4MSX A;  2MNZ A;  2RSD A;  3KV6 A;  4N3W A;  4YAB A;  2ZET C;  5FER A;  2VJE B;  2FSA A;  4WZ2 A;  2DSM A;  5TRB A;  4A4C A;  4IC2 A;  2BAY A;  2KE1 A;  1JM7 A;  3PLW A;  2KIZ A;  2QJ0 A;  3FL2 A;  4B86 C;  3V43 A;  2VPB A;  1MM2 A;  2ECW A;  2UZG A;  1WEU A;  4UI9 B;  2VPE A;  3HTK C;  5JG6 A;  2L75 A;  1N87 A;  5G04 B;  2C2V S;  2ECI A;  2G6Q A;  3DDT A;  4GB0 A;  3O70 A;  2RR4 A;  3MHH A;  4F1P A;  5C13 A;  2XB1 A;  3M99 A;  1WEE A;  3C6W A;  2KKX A;  4Z0O A;  2JM3 A;  1HYI A;  4LLB A;  1FP0 A;  3I2D A;  2CRW A;  3PUQ A;  1WEO A;  2LRI C;  1XWH A;  3LQI A;  1FBV A;  1JM7 B;  2MA5 A;  3MDB C;  5B78 A;  4QF3 A;  2CSZ A;  4H9D A;  4XI1 A;  2KKY A;  4N4F A;  2VNF A;  2JMI A;  4L58 A;  5LKZ A;  2YSM A;  2PUY A;  2EXU A;  2XOC A;  3N9N A;  4A4B A;  3FAO A;  4AP4 A;  4X3G A;  5B8D A;  2L5U A;  4ZDT A;  1HYJ A;  2DJA A;  2QIC A;  5D1K B;  2B0O E;  3M63 A;  1WEP A;  2CT2 A;  4F52 B;  4YC9 A;  3LVQ E;  2LDR A;  2MIQ A;  5D1L B;  4QF2 A;  3LQH A;  2LGG A;  4AYC A;  2EOD A;  2L0B A;  3Q1D A;  2KWO A;  2MA6 A;  4W4U A;  2F6N A;  2CKL A;  2VP7 A;  5H9M A;  2D8S A;  3M62 A;  2RI7 A;  2CSY A;  4FIP A;  3T9K A;  2ECJ A;  1WE9 A;  2YYR A;  3SHB A;  2KU3 A;  4YAX A;  4MVT A;  1CHC A;  4UP5 A;  2Y1N A;  3O37 A;  4YAD A;  2FD4 A;  2LGV A;  5H1U A;  3O35 A;  4FO9 A;  4YBM A;  3H7H A;  1WEV A;  3LJU X;  2LQ6 A;  4AUQ B;  1WEW A;  4V3L C;  3LVR E;  4I7D A;  4AYC B;  2JMJ A;  5KH7 A;  5B77 A;  5I3L A;  3RPG C;  1Z6U A;  4R2Y A;  2CKL B;  3DPL R;  1WEN A;  1V87 A;  5G0F A;  3PHD A;  3T6R A;  4YBT A;  1LDK C;  1WIM A;  2LAU A;  2JUN A;  4S3O B;  4YBS A;  2E6R A;  2D8U A;  2KGG A;  2KYU A;  2YRE A;  3NG2 A;  3RPG B;  2XEU A;  2Y1M A;  2YQM A;  2EGP A;  1WGM A;  4B7Y C;  2C2L A;  4PTB A;  2G43 A;  2JRJ A;  3ZPV 1;  1JOC A;  2XP0 A;  1WES A;  4GNF A;  5DKA A;  5H1V A;  5DIN A;  1ZBD B;  1Z2Q A;  1LDJ B;  1X4I A;  2P57 A;  3L1X A;  4BBQ A;  2YVR A;  2PNX A;  3HCT A;  2LN0 A;  3LQJ A;  2E6S A;  3HCS A;  5SVI A;  2K17 A;  2MD7 B; 
#chains in the Genus database with same CATH homology
 3KDE C;  2D8U A;  3SUB A;  3DDT A;  2XP0 A;  3E2D A;  3LVR E;  3MDB C;  2YRE A;  2OWA A;  2RR4 A;  2DJA A;  2B0O E;  4H9D A;  3FM8 C;  4F1P A;  5SVX A;  2FFW A;  2CRR A;  4OGC A;  2XOZ A;  5SVI B;  2P57 A;  2EGM A;  3T9K A;  3LDY A;  2KKY A;  2KKX A;  4OGE A;  3LVQ E;  2YVR A;  3M7K A;  2CSV A;  3PLW A;  3H7H A;  3DWD A;  4Z0O A;  2JM3 A;  4O62 A;  2L7P A;  2E61 A;  2CRW A;  2FD4 A;  3FEH A;  2IQJ A;  2MKE A;  2EXU A;  2XOC A;  3FJU B;  3O47 A;  3Q1D A;  4Z0R A;  5SVY A;  4QQ4 A;  1DCQ A;  5K3Q A;  5SVI A;  3JUE A;  2XOY A;  2M13 A;  2LAU A;  2JUN A;  3LJU X;  2CON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...