3LDYA

An extraordinary mechanism of dna perturbation exhibited by the rare-cutting hnh restriction endonuclease paci
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
total genus 48
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ldyA00
3LDYA 3M7KA
chains in the Genus database with same CATH superfamily
4N3WA 4O64A 2L43A 3MHHA 2YT5A 2YUCA 4GB0A 4GNDA 4BHWA 2P57A 3LQIA 3O34A 4QF2A 5B78A 2VNFA 2LGVA 2KR4A 2MNYA 1X4JA 1DCQA 5LKXA 2K16A 2YQMA 1F62A 2G43A 5G0FA 3U5NA 5DINA 3N9NA 5I3LA 2CRWA 1WEOA 4V3KC 2HDPA 2KWKA 2I50A 5AIUA 4AVXA 3M99A 3ZNIA 2CT2A 3DDTA 1VYXA 3KDEC 2K17A 2E6SA 2ECWA 2JMDA 2H0DB 1WGMA 4L58A 4V3LC 1X4IA 2M1RA 5KH3A 3FANA 2L5UA 2LN0A 3VK6A 4FJCA 4F1PA 3L11A 5LCWB 5B75A 4UI9B 3QZVA 5LKZA 4QF3A 2K4DA 3LRQA 4NN2A 2RSDA 2DSMA 2KWOA 3N9LA 3KV5A 2C2LA 4WA6A 4MVTA 2D8SA 3PURA 3ZVYA 4GNFA 2YW8A 3T6RA 2OXQC 2YQLA 2E61A 2ECTA 2L0BA 2VJEA 2C2VS 5TDWA 2NAAA 1Z6UA 2UZGA 1IYMA 5G04B 4WZ2A 4YABA 2ZETC 4Z0RA 3PUQA 3SHBA 3ASLA 3O37A 2MT5A 5TBNA 2MD7B 2MA6A 2EGMA 2KKXA 5FB1A 2KGGA 3GL6A 2DJAA 1WEMA 1ZBDB 3U5OA 3HCTA 3ZYQA 3N9PA 3T7LA 2HYED 2G6QA 2Y1NA 2FFWA 4P5OB 1WENA 4YC9A 2RI7A 1CHCA 5K3QA 4PPEA 4F52B 2EA6A 1WEQA 1LDJB 2LAUA 2VPEA 3EB6A 4YADA 3ZTGA 2FD4A 2B0OE 2KKYA 5SVIA 4LADB 3RPGC 3O70A 3FEHA 5H1UA 5B76A 5C11A 2KU3A 4I7BA 4Q6FA 4X3GA 1V87A 2KWNA 4YBSA 3U5PA 4TKPB 2KE1A 1HYJA 3FM8C 2EGPA 4GNEA 4OGCA 3NG2A 2DX8A 1LDKC 2Y43A 2MD8C 2F6JA 5SVYA 1Z60A 2YU4A 4N4FA 5LKTA 4YBMA 2YHOA 4R8PK 2M6MA 3PHDA 3RPGB 4FO9A 2M85A 4FK5A 2FSAA 1E4UA 4I7DA 1MM3A 2XEUA 2RR4A 3MHSA 3C6WA 4MSXA 3KQIA 1WILA 3IHPA 3M7KA 3C5KA 4QQ4A 1HYIA 5LKUA 2BAYA 3HCUA 2E6RA 2KWJA 2LV9A 5H1VA 3DQVR 2LQ6A 2MUMA 5KH9A 2VPGA 4ZDTA 4YATA 5TDRA 1JM7B 3ZPVE 3ZPV1 3N9QA 2H0DA 3SOUA 4FIPA 5J3XA 4CCGX 3HCSA 2K1JA 3SOWA 2ECNA 2LGKA 4ZQLA 4BBQA 1WEUA 5FB0A 4IC2A 5TABA 5KH7A 3H7HA 2L80A 3LVQE 1FP0A 2JMJA 2YYRA 2JUNA 3FL2A 3LVRE 1WE9A 2LRIC 1MBMA 2FUUA 3ZVZB 2MKEA 2CSYA 2M13A 2XOYA 2KIZA 3FAOA 3L1ZB 5B77A 4LKAA 3O36A 2F42A 2MA5A 2YSMA 5D1LB 3GV4A 3DWDA 4S3OC 2VJFB 1WEPA 2ECIA 4A4BA 3MDBC 4AYCB 5G05B 3SOXA 2CKLB 5SVXA 2IDAA 2XB1A 1WFKA 1VFYA 4LK9A 4LLBA 1FBVA 1JOCA 1WEWA 2VJFA 2YHNA 4AYCA 3L1XA 2Y1MA 2QJ0A 3O47A 2L75A 3E2DA 3JUEA 2YURA 1T1HA 2KYUA 3KNVA 2G45A 2VPDA 3PLWA 2QICA 2JMIA 4OGEA 3N9OA 2D8UA 4IC3A 4L7XA 1XWHA 1WIMA 3LDYA 3T9KA 2PUYA 5AITA 4YBTA 1N87A 2LXHC 2XP0A 1Z2QA 3LJUX 5FEYA 4R2YA 1G25A 4LJNA 5TRBA 1VD4A 1MM2A 5DKAA 5EYAF 4W4UA 3M62A 4XI1A 2IQJA 2YVRA 4B7YC 4A0CD 2MNZA 2F6NA 4YAXA 2L7PA 5D1MB 5C13A 3M63A 2FUIA 1WEVA 4I7CA 4AUQB 1WEEA 4B86C 1U6GB 3KV6A 3V43A 1DVPA 2EODA 2CRRA 2KGIA 5FERA 4O62A 4GNGA 3HTKC 2PNXA 5H1TA 3RTRB 2YSJA 2XOCA 2VP7A 4WZ3B 5H9MA 1JM7A 3EB5A 4C9ZA 2ECJA 4CA1A 2XOZA 2VJEB 3LQJA 3O35A 4UP5A 1RMDA 5B8DA 5JG6A 2MIQA 2KREA 2JRJA 3LQHA 5D1KB 2ECVA 2VPBA 4ZUXU 2OWAA 2KFTA 2QIZA 3U5MA 4R7EA 2CONA 2LGGA 2AN6A 3Q1DA 4H9DA 2JM3A 3DPLR 1K2FA 2LGLA 1BORA 3O7AA 2CSVA 4UP0A 4PTBA 4AP4A 2LXPC 3I2DA 1WESA 2CKLA 5SVIB 4Z0OA 4A4CA 2ECGA 4S3OB 4A49A 2LDRA 2YREA 3O33A 2EXUA 3N9MA 3SUBA 2CSZA 1X4UA 2M3HA 3FJUB 4WZ0A 5B79A
chains in the Genus database with same CATH topology
4F1PA 2CONA 3FEHA 3H7HA 2CRWA 3LVQE 3LDYA 2L7PA 3T9KA 2XOZA 2FFWA 3DWDA 3Q1DA 4Z0OA 5SVIB 4H9DA 2RR4A 4Z0RA 3FM8C 2P57A 3MDBC 2XP0A 2JM3A 3LJUX 2JUNA 3O47A 5K3QA 4OGCA 3E2DA 3JUEA 3LVRE 2YREA 5SVXA 3DDTA 3M7KA 5SVYA 2EGMA 2LAUA 2CRRA 2KKXA 1DCQA 2EXUA 2CSVA 3PLWA 4QQ4A 3KDEC 2OWAA 4O62A 3SUBA 5SVIA 2MKEA 2FD4A 4OGEA 2E61A 2M13A 2B0OE 2XOYA 2IQJA 2D8UA 2DJAA 3FJUB 2KKYA 2XOCA 2YVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDY A;  3M7K A; 
#chains in the Genus database with same CATH topology
 4N3W A;  4O64 A;  2L43 A;  3MHH A;  2YT5 A;  2YUC A;  4GB0 A;  4GND A;  4BHW A;  2P57 A;  3LQI A;  3O34 A;  4QF2 A;  5B78 A;  2VNF A;  2LGV A;  2KR4 A;  2MNY A;  1X4J A;  1DCQ A;  5LKX A;  2K16 A;  2YQM A;  1F62 A;  2G43 A;  5G0F A;  3U5N A;  5DIN A;  3N9N A;  5I3L A;  2CRW A;  1WEO A;  4V3K C;  2HDP A;  2KWK A;  2I50 A;  5AIU A;  4AVX A;  3M99 A;  3ZNI A;  2CT2 A;  3DDT A;  1VYX A;  3KDE C;  2K17 A;  2E6S A;  2ECW A;  2JMD A;  2H0D B;  1WGM A;  4L58 A;  4V3L C;  1X4I A;  2M1R A;  5KH3 A;  3FAN A;  2L5U A;  2LN0 A;  3VK6 A;  4FJC A;  4F1P A;  3L11 A;  5LCW B;  5B75 A;  4UI9 B;  3QZV A;  5LKZ A;  4QF3 A;  2K4D A;  3LRQ A;  4NN2 A;  2RSD A;  2DSM A;  2KWO A;  3N9L A;  3KV5 A;  2C2L A;  4WA6 A;  4MVT A;  2D8S A;  3PUR A;  3ZVY A;  4GNF A;  2YW8 A;  3T6R A;  2OXQ C;  2YQL A;  2E61 A;  2ECT A;  2L0B A;  2VJE A;  2C2V S;  5TDW A;  2NAA A;  1Z6U A;  2UZG A;  1IYM A;  5G04 B;  4WZ2 A;  4YAB A;  2ZET C;  4Z0R A;  3PUQ A;  3SHB A;  3ASL A;  3O37 A;  2MT5 A;  5TBN A;  2MD7 B;  2MA6 A;  2EGM A;  2KKX A;  5FB1 A;  2KGG A;  3GL6 A;  2DJA A;  1WEM A;  1ZBD B;  3U5O A;  3HCT A;  3ZYQ A;  3N9P A;  3T7L A;  2HYE D;  2G6Q A;  2Y1N A;  2FFW A;  4P5O B;  1WEN A;  4YC9 A;  2RI7 A;  1CHC A;  5K3Q A;  4PPE A;  4F52 B;  2EA6 A;  1WEQ A;  1LDJ B;  2LAU A;  2VPE A;  3EB6 A;  4YAD A;  3ZTG A;  2FD4 A;  2B0O E;  2KKY A;  5SVI A;  4LAD B;  3RPG C;  3O70 A;  3FEH A;  5H1U A;  5B76 A;  5C11 A;  2KU3 A;  4I7B A;  4Q6F A;  4X3G A;  1V87 A;  2KWN A;  4YBS A;  3U5P A;  4TKP B;  2KE1 A;  1HYJ A;  3FM8 C;  2EGP A;  4GNE A;  4OGC A;  3NG2 A;  2DX8 A;  1LDK C;  2Y43 A;  2MD8 C;  2F6J A;  5SVY A;  1Z60 A;  2YU4 A;  4N4F A;  5LKT A;  4YBM A;  2YHO A;  4R8P K;  2M6M A;  3PHD A;  3RPG B;  4FO9 A;  2M85 A;  4FK5 A;  2FSA A;  1E4U A;  4I7D A;  1MM3 A;  2XEU A;  2RR4 A;  3MHS A;  3C6W A;  4MSX A;  3KQI A;  1WIL A;  3IHP A;  3M7K A;  3C5K A;  4QQ4 A;  1HYI A;  5LKU A;  2BAY A;  3HCU A;  2E6R A;  2KWJ A;  2LV9 A;  5H1V A;  3DQV R;  2LQ6 A;  2MUM A;  5KH9 A;  2VPG A;  4ZDT A;  4YAT A;  5TDR A;  1JM7 B;  3ZPV E;  3ZPV 1;  3N9Q A;  2H0D A;  3SOU A;  4FIP A;  5J3X A;  4CCG X;  3HCS A;  2K1J A;  3SOW A;  2ECN A;  2LGK A;  4ZQL A;  4BBQ A;  1WEU A;  5FB0 A;  4IC2 A;  5TAB A;  5KH7 A;  3H7H A;  2L80 A;  3LVQ E;  1FP0 A;  2JMJ A;  2YYR A;  2JUN A;  3FL2 A;  3LVR E;  1WE9 A;  2LRI C;  1MBM A;  2FUU A;  3ZVZ B;  2MKE A;  2CSY A;  2M13 A;  2XOY A;  2KIZ A;  3FAO A;  3L1Z B;  5B77 A;  4LKA A;  3O36 A;  2F42 A;  2MA5 A;  2YSM A;  5D1L B;  3GV4 A;  3DWD A;  4S3O C;  2VJF B;  1WEP A;  2ECI A;  4A4B A;  3MDB C;  4AYC B;  5G05 B;  3SOX A;  2CKL B;  5SVX A;  2IDA A;  2XB1 A;  1WFK A;  1VFY A;  4LK9 A;  4LLB A;  1FBV A;  1JOC A;  1WEW A;  2VJF A;  2YHN A;  4AYC A;  3L1X A;  2Y1M A;  2QJ0 A;  3O47 A;  2L75 A;  3E2D A;  3JUE A;  2YUR A;  1T1H A;  2KYU A;  3KNV A;  2G45 A;  2VPD A;  3PLW A;  2QIC A;  2JMI A;  4OGE A;  3N9O A;  2D8U A;  4IC3 A;  4L7X A;  1XWH A;  1WIM A;  3LDY A;  3T9K A;  2PUY A;  5AIT A;  4YBT A;  1N87 A;  2LXH C;  2XP0 A;  1Z2Q A;  3LJU X;  5FEY A;  4R2Y A;  1G25 A;  4LJN A;  5TRB A;  1VD4 A;  1MM2 A;  5DKA A;  5EYA F;  4W4U A;  3M62 A;  4XI1 A;  2IQJ A;  2YVR A;  4B7Y C;  4A0C D;  2MNZ A;  2F6N A;  4YAX A;  2L7P A;  5D1M B;  5C13 A;  3M63 A;  2FUI A;  1WEV A;  4I7C A;  4AUQ B;  1WEE A;  4B86 C;  1U6G B;  3KV6 A;  3V43 A;  1DVP A;  2EOD A;  2CRR A;  2KGI A;  5FER A;  4O62 A;  4GNG A;  3HTK C;  2PNX A;  5H1T A;  3RTR B;  2YSJ A;  2XOC A;  2VP7 A;  4WZ3 B;  5H9M A;  1JM7 A;  3EB5 A;  4C9Z A;  2ECJ A;  4CA1 A;  2XOZ A;  2VJE B;  3LQJ A;  3O35 A;  4UP5 A;  1RMD A;  5B8D A;  5JG6 A;  2MIQ A;  2KRE A;  2JRJ A;  3LQH A;  5D1K B;  2ECV A;  2VPB A;  4ZUX U;  2OWA A;  2KFT A;  2QIZ A;  3U5M A;  4R7E A;  2CON A;  2LGG A;  2AN6 A;  3Q1D A;  4H9D A;  2JM3 A;  3DPL R;  1K2F A;  2LGL A;  1BOR A;  3O7A A;  2CSV A;  4UP0 A;  4PTB A;  4AP4 A;  2LXP C;  3I2D A;  1WES A;  2CKL A;  5SVI B;  4Z0O A;  4A4C A;  2ECG A;  4S3O B;  4A49 A;  2LDR A;  2YRE A;  3O33 A;  2EXU A;  3N9M A;  3SUB A;  2CSZ A;  1X4U A;  2M3H A;  3FJU B;  4WZ0 A;  5B79 A; 
#chains in the Genus database with same CATH homology
 4F1P A;  2CON A;  3FEH A;  3H7H A;  2CRW A;  3LVQ E;  3LDY A;  2L7P A;  3T9K A;  2XOZ A;  2FFW A;  3DWD A;  3Q1D A;  4Z0O A;  5SVI B;  4H9D A;  2RR4 A;  4Z0R A;  3FM8 C;  2P57 A;  3MDB C;  2XP0 A;  2JM3 A;  3LJU X;  2JUN A;  3O47 A;  5K3Q A;  4OGC A;  3E2D A;  3JUE A;  3LVR E;  2YRE A;  5SVX A;  3DDT A;  3M7K A;  5SVY A;  2EGM A;  2LAU A;  2CRR A;  2KKX A;  1DCQ A;  2EXU A;  2CSV A;  3PLW A;  4QQ4 A;  3KDE C;  2OWA A;  4O62 A;  3SUB A;  5SVI A;  2MKE A;  2FD4 A;  4OGE A;  2E61 A;  2M13 A;  2B0O E;  2XOY A;  2IQJ A;  2D8U A;  2DJA A;  3FJU B;  2KKY A;  2XOC A;  2YVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...