2JUNA

Structure of the mid1 tandem b-boxes reveals an interaction reminiscent of intermolecular ring heterodimers
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
AEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the MID1 Tandem B-Boxes Reveals an Interaction Reminiscent of Intermolecular Ring Heterodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Midline-1
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2junA00
2D8UA 2JUNA 3Q1DA 3DDTA 5K3QA 2DJAA 2YVRA 2CSVA 2EGMA
chains in the Genus database with same CATH superfamily
2JUNA 2KWNA 3V43A 5TRBA 4O64A 4MVTA 1Z6UA 3L1ZB 4Q6FA 3U5PA 3KNVA 3KV5A 3N9QA 2F42A 5SVYA 1LDKC 2ECNA 2CKLB 2KE1A 3DQVR 4CA1A 4P5OB 2VPGA 1MM3A 5FB0A 2CSZA 4OGEA 3DDTA 4Z0RA 2MD7B 4GNGA 1MM2A 1WE9A 2XOCA 5FB1A 4L58A 3SOXA 2YT5A 3EB6A 2KR4A 2FFWA 2XP0A 5TBNA 1K2FA 5AITA 3LRQA 4LLBA 2VJEA 2YQLA 1VD4A 2ECGA 2LGVA 3O47A 2EXUA 3O7AA 4O62A 4NN2A 2FUIA 2CSYA 2CSVA 2PUYA 2BAYA 2M13A 2YREA 2XB1A 2DSMA 4ZDTA 1E4UA 2NAAA 1WEMA 4FJCA 3SHBA 4UP5A 5LCWB 1WEQA 2YU4A 4A4BA 3PHDA 4QQ4A 4GNEA 4V3KC 3KDEC 4X3GA 4OGCA 2EGMA 3FM8C 2L7PA 1WGMA 1WFKA 3JUEA 1JM7A 2QICA 3M7KA 2XOZA 3M63A 3SUBA 1VFYA 5AIUA 2MA6A 2LDRA 4AUQB 5B76A 3L1XA 4N3WA 3ZYQA 2KU3A 3O35A 2MT5A 2MD8C 2G43A 3ZVYA 4WZ0A 3LVRE 3I2DA 2JMIA 2VPEA 2LRIC 2FD4A 3FANA 3FAOA 3L11A 3ZPVE 3ZPV1 2B0OE 2JM3A 5KH7A 2LGKA 5FEYA 1X4IA 1RMDA 2YSMA 5J3XA 5H1VA 5LKZA 4YATA 4AP4A 3LQJA 4A49A 3GV4A 2L80A 3LDYA 2CONA 2ECTA 1VYXA 3N9OA 2C2VS 3PURA 2QJ0A 4YBTA 2F6NA 4I7DA 3NG2A 3SOUA 2VPBA 3T7LA 3HCUA 4YBMA 1WENA 2H0DA 4IC2A 5H9MA 5JG6A 2HYED 5H1UA 4N4FA 5D1LB 5B75A 1X4JA 1HYIA 1HYJA 3PLWA 4WZ3B 2LXPC 3DPLR 1FP0A 2K17A 4GNFA 3RPGB 2RR4A 2ECWA 2G45A 5KH9A 1LDJB 1BORA 4YBSA 5H1TA 2MUMA 1DVPA 2E6SA 2LGGA 2JMDA 2UZGA 2KWKA 2MKEA 4GNDA 5B78A 5DKAA 4R8PK 3O70A 4MSXA 4C9ZA 3HCSA 3ASLA 4R7EA 2EGPA 4FIPA 5B77A 5D1MB 2MIQA 2M6MA 3N9PA 2KIZA 2YSJA 4IC3A 3ZNIA 4A0CD 2IQJA 2FSAA 2XOYA 3FEHA 3LQIA 4S3OB 2D8UA 2QIZA 3ZTGA 1WEPA 3DWDA 3N9MA 2KKYA 2YVRA 1WEWA 2E6RA 2K1JA 4ZQLA 1IYMA 3T9KA 2ECJA 3ZVZB 3U5MA 4ZUXU 2YHNA 1WILA 4YAXA 2H0DB 4AYCB 4LJNA 4YC9A 2VJEB 4L7XA 2YURA 2VP7A 4QF3A 5SVXA 5LKUA 2KGGA 5G0FA 2VNFA 2MNZA 5KH3A 2YYRA 2IDAA 2AN6A 3FL2A 1T1HA 4V3LC 5LKTA 2KFTA 3Q1DA 3MHHA 4H9DA 4B7YC 2M85A 4Z0OA 3GL6A 2CT2A 1DCQA 1WEVA 3IHPA 2ECIA 3O33A 2HDPA 3RTRB 4BHWA 3QZVA 5TABA 4QF2A 2LN0A 4PTBA 1WEOA 2LXHC 4B86C 2YUCA 5K3QA 3O36A 4F1PA 5TDRA 2MNYA 2DJAA 5TDWA 1N87A 5I3LA 5D1KB 3O37A 1WEEA 2M3HA 1G25A 2RI7A 1Z60A 3EB5A 2D8SA 3C6WA 2L43A 4I7BA 2LGLA 2Y1MA 4LADB 3MDBC 4UP0A 2VJFB 3FJUB 3LVQE 3E2DA 2VPDA 2F6JA 2VJFA 4FO9A 4S3OC 1V87A 2KGIA 5EYAF 2LAUA 4WZ2A 3U5NA 2L0BA 3LQHA 4UI9B 5SVIA 2YW8A 2PNXA 4LKAA 2C2LA 2LV9A 3HTKC 4AYCA 2EODA 2CKLA 5SVIB 4TKPB 4LK9A 3O34A 5G05B 3N9NA 3VK6A 4YABA 4AVXA 4CCGX 5DINA 1F62A 1WEUA 3N9LA 3U5OA 2G6QA 2I50A 4A4CA 1XWHA 3KQIA 3SOWA 5C11A 5C13A 1U6GB 2YQMA 4F52B 2K16A 1Z2QA 2CRWA 4I7CA 4PPEA 5B8DA 2K4DA 2ECVA 2KKXA 2P57A 5FERA 2LQ6A 3M62A 5G04B 3PUQA 2Y1NA 3C5KA 3T6RA 2OWAA 4W4UA 2M1RA 3H7HA 2CRRA 1JM7B 2DX8A 4YADA 1JOCA 3KV6A 2FUUA 3RPGC 2KYUA 2JRJA 3M99A 4BBQA 1X4UA 2E61A 2MA5A 2KREA 4R2YA 1FBVA 2L5UA 2XEUA 2JMJA 4WA6A 1MBMA 5LKXA 2EA6A 2OXQC 3MHSA 2Y43A 2KWJA 1CHCA 5B79A 1ZBDB 2L75A 3HCTA 4XI1A 2KWOA 2YHOA 1WIMA 1WESA 3LJUX 2RSDA 4FK5A 2ZETC 4GB0A
chains in the Genus database with same CATH topology
3E2DA 2L7PA 2XP0A 3FM8C 2E61A 2JUNA 3Q1DA 2FD4A 2P57A 4H9DA 2DJAA 4Z0OA 3JUEA 2B0OE 2LAUA 4OGEA 2JM3A 3M7KA 2XOZA 3DDTA 2IQJA 4Z0RA 1DCQA 2OWAA 2MKEA 2XOYA 3FEHA 2EXUA 3O47A 3PLWA 4O62A 3H7HA 5SVIA 3SUBA 2CRRA 2D8UA 3T9KA 3DWDA 5SVIB 2KKYA 2YVRA 2CSVA 5SVYA 2XOCA 3LDYA 2CONA 4QQ4A 5SVXA 3KDEC 2RR4A 2CRWA 3MDBC 5K3QA 3LVRE 3LJUX 2FFWA 3FJUB 4F1PA 3LVQE 2KKXA 4OGCA 2EGMA 2M13A 2YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8U A;  2JUN A;  3Q1D A;  3DDT A;  5K3Q A;  2DJA A;  2YVR A;  2CSV A;  2EGM A; 
#chains in the Genus database with same CATH topology
 2JUN A;  2KWN A;  3V43 A;  5TRB A;  4O64 A;  4MVT A;  1Z6U A;  3L1Z B;  4Q6F A;  3U5P A;  3KNV A;  3KV5 A;  3N9Q A;  2F42 A;  5SVY A;  1LDK C;  2ECN A;  2CKL B;  2KE1 A;  3DQV R;  4CA1 A;  4P5O B;  2VPG A;  1MM3 A;  5FB0 A;  2CSZ A;  4OGE A;  3DDT A;  4Z0R A;  2MD7 B;  4GNG A;  1MM2 A;  1WE9 A;  2XOC A;  5FB1 A;  4L58 A;  3SOX A;  2YT5 A;  3EB6 A;  2KR4 A;  2FFW A;  2XP0 A;  5TBN A;  1K2F A;  5AIT A;  3LRQ A;  4LLB A;  2VJE A;  2YQL A;  1VD4 A;  2ECG A;  2LGV A;  3O47 A;  2EXU A;  3O7A A;  4O62 A;  4NN2 A;  2FUI A;  2CSY A;  2CSV A;  2PUY A;  2BAY A;  2M13 A;  2YRE A;  2XB1 A;  2DSM A;  4ZDT A;  1E4U A;  2NAA A;  1WEM A;  4FJC A;  3SHB A;  4UP5 A;  5LCW B;  1WEQ A;  2YU4 A;  4A4B A;  3PHD A;  4QQ4 A;  4GNE A;  4V3K C;  3KDE C;  4X3G A;  4OGC A;  2EGM A;  3FM8 C;  2L7P A;  1WGM A;  1WFK A;  3JUE A;  1JM7 A;  2QIC A;  3M7K A;  2XOZ A;  3M63 A;  3SUB A;  1VFY A;  5AIU A;  2MA6 A;  2LDR A;  4AUQ B;  5B76 A;  3L1X A;  4N3W A;  3ZYQ A;  2KU3 A;  3O35 A;  2MT5 A;  2MD8 C;  2G43 A;  3ZVY A;  4WZ0 A;  3LVR E;  3I2D A;  2JMI A;  2VPE A;  2LRI C;  2FD4 A;  3FAN A;  3FAO A;  3L11 A;  3ZPV E;  3ZPV 1;  2B0O E;  2JM3 A;  5KH7 A;  2LGK A;  5FEY A;  1X4I A;  1RMD A;  2YSM A;  5J3X A;  5H1V A;  5LKZ A;  4YAT A;  4AP4 A;  3LQJ A;  4A49 A;  3GV4 A;  2L80 A;  3LDY A;  2CON A;  2ECT A;  1VYX A;  3N9O A;  2C2V S;  3PUR A;  2QJ0 A;  4YBT A;  2F6N A;  4I7D A;  3NG2 A;  3SOU A;  2VPB A;  3T7L A;  3HCU A;  4YBM A;  1WEN A;  2H0D A;  4IC2 A;  5H9M A;  5JG6 A;  2HYE D;  5H1U A;  4N4F A;  5D1L B;  5B75 A;  1X4J A;  1HYI A;  1HYJ A;  3PLW A;  4WZ3 B;  2LXP C;  3DPL R;  1FP0 A;  2K17 A;  4GNF A;  3RPG B;  2RR4 A;  2ECW A;  2G45 A;  5KH9 A;  1LDJ B;  1BOR A;  4YBS A;  5H1T A;  2MUM A;  1DVP A;  2E6S A;  2LGG A;  2JMD A;  2UZG A;  2KWK A;  2MKE A;  4GND A;  5B78 A;  5DKA A;  4R8P K;  3O70 A;  4MSX A;  4C9Z A;  3HCS A;  3ASL A;  4R7E A;  2EGP A;  4FIP A;  5B77 A;  5D1M B;  2MIQ A;  2M6M A;  3N9P A;  2KIZ A;  2YSJ A;  4IC3 A;  3ZNI A;  4A0C D;  2IQJ A;  2FSA A;  2XOY A;  3FEH A;  3LQI A;  4S3O B;  2D8U A;  2QIZ A;  3ZTG A;  1WEP A;  3DWD A;  3N9M A;  2KKY A;  2YVR A;  1WEW A;  2E6R A;  2K1J A;  4ZQL A;  1IYM A;  3T9K A;  2ECJ A;  3ZVZ B;  3U5M A;  4ZUX U;  2YHN A;  1WIL A;  4YAX A;  2H0D B;  4AYC B;  4LJN A;  4YC9 A;  2VJE B;  4L7X A;  2YUR A;  2VP7 A;  4QF3 A;  5SVX A;  5LKU A;  2KGG A;  5G0F A;  2VNF A;  2MNZ A;  5KH3 A;  2YYR A;  2IDA A;  2AN6 A;  3FL2 A;  1T1H A;  4V3L C;  5LKT A;  2KFT A;  3Q1D A;  3MHH A;  4H9D A;  4B7Y C;  2M85 A;  4Z0O A;  3GL6 A;  2CT2 A;  1DCQ A;  1WEV A;  3IHP A;  2ECI A;  3O33 A;  2HDP A;  3RTR B;  4BHW A;  3QZV A;  5TAB A;  4QF2 A;  2LN0 A;  4PTB A;  1WEO A;  2LXH C;  4B86 C;  2YUC A;  5K3Q A;  3O36 A;  4F1P A;  5TDR A;  2MNY A;  2DJA A;  5TDW A;  1N87 A;  5I3L A;  5D1K B;  3O37 A;  1WEE A;  2M3H A;  1G25 A;  2RI7 A;  1Z60 A;  3EB5 A;  2D8S A;  3C6W A;  2L43 A;  4I7B A;  2LGL A;  2Y1M A;  4LAD B;  3MDB C;  4UP0 A;  2VJF B;  3FJU B;  3LVQ E;  3E2D A;  2VPD A;  2F6J A;  2VJF A;  4FO9 A;  4S3O C;  1V87 A;  2KGI A;  5EYA F;  2LAU A;  4WZ2 A;  3U5N A;  2L0B A;  3LQH A;  4UI9 B;  5SVI A;  2YW8 A;  2PNX A;  4LKA A;  2C2L A;  2LV9 A;  3HTK C;  4AYC A;  2EOD A;  2CKL A;  5SVI B;  4TKP B;  4LK9 A;  3O34 A;  5G05 B;  3N9N A;  3VK6 A;  4YAB A;  4AVX A;  4CCG X;  5DIN A;  1F62 A;  1WEU A;  3N9L A;  3U5O A;  2G6Q A;  2I50 A;  4A4C A;  1XWH A;  3KQI A;  3SOW A;  5C11 A;  5C13 A;  1U6G B;  2YQM A;  4F52 B;  2K16 A;  1Z2Q A;  2CRW A;  4I7C A;  4PPE A;  5B8D A;  2K4D A;  2ECV A;  2KKX A;  2P57 A;  5FER A;  2LQ6 A;  3M62 A;  5G04 B;  3PUQ A;  2Y1N A;  3C5K A;  3T6R A;  2OWA A;  4W4U A;  2M1R A;  3H7H A;  2CRR A;  1JM7 B;  2DX8 A;  4YAD A;  1JOC A;  3KV6 A;  2FUU A;  3RPG C;  2KYU A;  2JRJ A;  3M99 A;  4BBQ A;  1X4U A;  2E61 A;  2MA5 A;  2KRE A;  4R2Y A;  1FBV A;  2L5U A;  2XEU A;  2JMJ A;  4WA6 A;  1MBM A;  5LKX A;  2EA6 A;  2OXQ C;  3MHS A;  2Y43 A;  2KWJ A;  1CHC A;  5B79 A;  1ZBD B;  2L75 A;  3HCT A;  4XI1 A;  2KWO A;  2YHO A;  1WIM A;  1WES A;  3LJU X;  2RSD A;  4FK5 A;  2ZET C;  4GB0 A; 
#chains in the Genus database with same CATH homology
 3E2D A;  2L7P A;  2XP0 A;  3FM8 C;  2E61 A;  2JUN A;  3Q1D A;  2FD4 A;  2P57 A;  4H9D A;  2DJA A;  4Z0O A;  3JUE A;  2B0O E;  2LAU A;  4OGE A;  2JM3 A;  3M7K A;  2XOZ A;  3DDT A;  2IQJ A;  4Z0R A;  1DCQ A;  2OWA A;  2MKE A;  2XOY A;  3FEH A;  2EXU A;  3O47 A;  3PLW A;  4O62 A;  3H7H A;  5SVI A;  3SUB A;  2CRR A;  2D8U A;  3T9K A;  3DWD A;  5SVI B;  2KKY A;  2YVR A;  2CSV A;  5SVY A;  2XOC A;  3LDY A;  2CON A;  4QQ4 A;  5SVX A;  3KDE C;  2RR4 A;  2CRW A;  3MDB C;  5K3Q A;  3LVR E;  3LJU X;  2FFW A;  3FJU B;  4F1P A;  3LVQ E;  2KKX A;  4OGC A;  2EGM A;  2M13 A;  2YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...