2JUNA

Structure of the mid1 tandem b-boxes reveals an interaction reminiscent of intermolecular ring heterodimers
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
AEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the MID1 Tandem B-Boxes Reveals an Interaction Reminiscent of Intermolecular Ring Heterodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Midline-1
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2junA00
5K3QA 2D8UA 3Q1DA 2EGMA 2JUNA 2DJAA 2YVRA 2CSVA 3DDTA
chains in the Genus database with same CATH superfamily
2PNXA 2LQ6A 2E61A 4YBMA 1K2FA 2YQLA 4IC3A 2KWOA 5TABA 3ZTGA 2K16A 3ZVYA 2YVRA 5B76A 5KH9A 4A4BA 1E4UA 2LDRA 4AUQB 4BHWA 2H0DA 2ECIA 2CSVA 3ZNIA 4AP4A 2LGGA 4YAXA 1JM7A 3LQIA 2ECNA 2Y1NA 5TBNA 2KGGA 2D8UA 5D1LB 3U5NA 5JG6A 4WZ3B 2G6QA 5G04B 4MSXA 4V3KC 1VD4A 1WE9A 2VJFA 3LQJA 4H9DA 4R7EA 3QZVA 3O36A 2LGKA 2LV9A 5C11A 1WEUA 3PUQA 2KYUA 5D1KB 4PPEA 3NG2A 3FANA 4C9ZA 3T6RA 3FL2A 2FUUA 3JUEA 2KFTA 3ZPV1 4AYCB 4QF2A 4UP0A 1N87A 2MA5A 4LLBA 4FK5A 2HYED 4O64A 5SVYA 3M62A 4TKPB 2YURA 2EA6A 3LJUX 3LDYA 5LKZA 4CA1A 2VJFB 3SOXA 3T7LA 4I7BA 4L7XA 5LCWB 5FB1A 2VPBA 4S3OC 1WEMA 2MNZA 4WA6A 4LK9A 2XB1A 2NAAA 2QIZA 2L5UA 1WILA 2YT5A 4F1PA 1WEWA 4BBQA 5J3XA 1LDKC 5K3QA 2KREA 1JM7B 2Y1MA 4I7DA 2KE1A 2XOCA 5DINA 2ECGA 2B0OE 3KDEC 2OWAA 3PLWA 3Q1DA 2YHOA 4LKAA 2EODA 3MHHA 3SOUA 4GNFA 3N9QA 3V43A 2ECTA 4YC9A 3HTKC 2MIQA 2KWNA 4GNEA 4Z0RA 1U6GB 5B8DA 1WEVA 2IQJA 2YQMA 3HCSA 3FJUB 4YADA 2G45A 2K1JA 2YREA 1JOCA 2MKEA 2M1RA 3KV6A 2KGIA 3LQHA 2VPDA 4N4FA 2FSAA 1VYXA 2RSDA 1WEOA 3FAOA 2DJAA 2ECJA 3L11A 1WGMA 3SOWA 2L7PA 4AYCA 1XWHA 2KKXA 3H7HA 2ECVA 2OXQC 5SVIB 4X3GA 3KV5A 3ASLA 5H1UA 2MA6A 4ZDTA 2F42A 4N3WA 3M7KA 1X4IA 3RPGB 4I7CA 1FBVA 2YW8A 4NN2A 3O7AA 3HCUA 1X4UA 2LAUA 2CRWA 3U5MA 5TRBA 4B7YC 3GL6A 4WZ2A 1MM2A 2KIZA 1IYMA 1WIMA 4PTBA 3MHSA 4GNDA 1MM3A 2E6RA 2MT5A 4GB0A 4ZUXU 4QF3A 5C13A 2C2VS 3KNVA 5SVIA 2JMDA 2VNFA 2Y43A 5I3LA 2LXHC 3SHBA 4OGCA 2L75A 3C5KA 3HCTA 1VFYA 3IHPA 5B78A 4GNGA 4B86C 3PHDA 4ZQLA 3LVQE 2MD8C 2L0BA 2MUMA 3O34A 3DDTA 3N9LA 1WENA 3VK6A 1LDJB 4LADB 4XI1A 2QJ0A 2JMIA 4CCGX 2M3HA 5B77A 2RI7A 4P5OB 5TDWA 4FO9A 2DX8A 1G25A 1Z2QA 2YU4A 3SUBA 2VJEA 3DPLR 1V87A 4R2YA 2EGPA 2VPGA 3E2DA 3LVRE 3GV4A 4FIPA 4YABA 4LJNA 3LRQA 2EXUA 2CKLA 2P57A 2UZGA 3T9KA 5LKXA 5AIUA 3M99A 3L1XA 2IDAA 1WFKA 3I2DA 2KWJA 5AITA 2KWKA 4IC2A 3O35A 2KU3A 3O47A 2HDPA 3N9OA 5B79A 2F6NA 4S3OB 2YYRA 2M13A 2RR4A 5H9MA 4UI9B 2CONA 1DCQA 3M63A 1F62A 3RTRB 4R8PK 5DKAA 2K4DA 1MBMA 2ECWA 1WEEA 4OGEA 4MVTA 3U5PA 5EYAF 5H1VA 3EB5A 3MDBC 3N9NA 2ZETC 2PUYA 2MD7B 1Z6UA 2M6MA 2QICA 2LGLA 2EGMA 2K17A 3KQIA 2FUIA 4O62A 2BAYA 2JM3A 5FERA 5KH7A 4A4CA 4W4UA 2G43A 2M85A 2H0DB 1Z60A 2LXPC 3DWDA 2AN6A 2YSJA 3PURA 4WZ0A 2JMJA 5G0FA 3RPGC 4F52B 3DQVR 3L1ZB 2VPEA 2XOZA 4Z0OA 2LN0A 3EB6A 3C6WA 5TDRA 1WESA 2KKYA 1DVPA 2XP0A 4YATA 1HYJA 1HYIA 4YBTA 2YUCA 4QQ4A 2F6JA 1RMDA 3U5OA 5LKUA 1FP0A 2L80A 5SVXA 2XEUA 4FJCA 3ZPVE 2KR4A 3O33A 2FD4A 5LKTA 2VP7A 1BORA 5B75A 2JUNA 2YHNA 2YSMA 3FM8C 2CKLB 2E6SA 5KH3A 4A0CD 4UP5A 2CSZA 1ZBDB 5H1TA 2C2LA 4AVXA 2DSMA 3N9PA 4A49A 2MNYA 1X4JA 2LRIC 4Q6FA 2VJEB 2CSYA 2CRRA 4V3LC 5D1MB 5FB0A 4YBSA 2L43A 5FEYA 2LGVA 5G05B 2FFWA 1CHCA 3O70A 3ZYQA 2JRJA 2CT2A 1WEQA 3O37A 4L58A 1T1HA 1WEPA 2I50A 3ZVZB 2D8SA 2XOYA 3N9MA 3FEHA
chains in the Genus database with same CATH topology
2OWAA 3PLWA 2E61A 3Q1DA 2KKYA 2CRRA 2FD4A 2XP0A 3JUEA 3E2DA 3O47A 3LVRE 3LVQE 4OGEA 3M7KA 2D8UA 5SVIA 3KDEC 3DWDA 2FFWA 2JUNA 2DJAA 3DDTA 4F1PA 3FM8C 2LAUA 4QQ4A 2CRWA 2EXUA 3MDBC 2M13A 4H9DA 4Z0RA 2RR4A 5K3QA 2IQJA 4Z0OA 2CONA 2P57A 5SVYA 3T9KA 2YVRA 1DCQA 4OGCA 2L7PA 3FJUB 2KKXA 2XOCA 5SVXA 3LJUX 3H7HA 2YREA 3LDYA 2EGMA 2XOYA 2XOZA 2B0OE 2MKEA 5SVIB 3FEHA 4O62A 2CSVA 2JM3A 3SUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K3Q A;  2D8U A;  3Q1D A;  2EGM A;  2JUN A;  2DJA A;  2YVR A;  2CSV A;  3DDT A; 
#chains in the Genus database with same CATH topology
 2PNX A;  2LQ6 A;  2E61 A;  4YBM A;  1K2F A;  2YQL A;  4IC3 A;  2KWO A;  5TAB A;  3ZTG A;  2K16 A;  3ZVY A;  2YVR A;  5B76 A;  5KH9 A;  4A4B A;  1E4U A;  2LDR A;  4AUQ B;  4BHW A;  2H0D A;  2ECI A;  2CSV A;  3ZNI A;  4AP4 A;  2LGG A;  4YAX A;  1JM7 A;  3LQI A;  2ECN A;  2Y1N A;  5TBN A;  2KGG A;  2D8U A;  5D1L B;  3U5N A;  5JG6 A;  4WZ3 B;  2G6Q A;  5G04 B;  4MSX A;  4V3K C;  1VD4 A;  1WE9 A;  2VJF A;  3LQJ A;  4H9D A;  4R7E A;  3QZV A;  3O36 A;  2LGK A;  2LV9 A;  5C11 A;  1WEU A;  3PUQ A;  2KYU A;  5D1K B;  4PPE A;  3NG2 A;  3FAN A;  4C9Z A;  3T6R A;  3FL2 A;  2FUU A;  3JUE A;  2KFT A;  3ZPV 1;  4AYC B;  4QF2 A;  4UP0 A;  1N87 A;  2MA5 A;  4LLB A;  4FK5 A;  2HYE D;  4O64 A;  5SVY A;  3M62 A;  4TKP B;  2YUR A;  2EA6 A;  3LJU X;  3LDY A;  5LKZ A;  4CA1 A;  2VJF B;  3SOX A;  3T7L A;  4I7B A;  4L7X A;  5LCW B;  5FB1 A;  2VPB A;  4S3O C;  1WEM A;  2MNZ A;  4WA6 A;  4LK9 A;  2XB1 A;  2NAA A;  2QIZ A;  2L5U A;  1WIL A;  2YT5 A;  4F1P A;  1WEW A;  4BBQ A;  5J3X A;  1LDK C;  5K3Q A;  2KRE A;  1JM7 B;  2Y1M A;  4I7D A;  2KE1 A;  2XOC A;  5DIN A;  2ECG A;  2B0O E;  3KDE C;  2OWA A;  3PLW A;  3Q1D A;  2YHO A;  4LKA A;  2EOD A;  3MHH A;  3SOU A;  4GNF A;  3N9Q A;  3V43 A;  2ECT A;  4YC9 A;  3HTK C;  2MIQ A;  2KWN A;  4GNE A;  4Z0R A;  1U6G B;  5B8D A;  1WEV A;  2IQJ A;  2YQM A;  3HCS A;  3FJU B;  4YAD A;  2G45 A;  2K1J A;  2YRE A;  1JOC A;  2MKE A;  2M1R A;  3KV6 A;  2KGI A;  3LQH A;  2VPD A;  4N4F A;  2FSA A;  1VYX A;  2RSD A;  1WEO A;  3FAO A;  2DJA A;  2ECJ A;  3L11 A;  1WGM A;  3SOW A;  2L7P A;  4AYC A;  1XWH A;  2KKX A;  3H7H A;  2ECV A;  2OXQ C;  5SVI B;  4X3G A;  3KV5 A;  3ASL A;  5H1U A;  2MA6 A;  4ZDT A;  2F42 A;  4N3W A;  3M7K A;  1X4I A;  3RPG B;  4I7C A;  1FBV A;  2YW8 A;  4NN2 A;  3O7A A;  3HCU A;  1X4U A;  2LAU A;  2CRW A;  3U5M A;  5TRB A;  4B7Y C;  3GL6 A;  4WZ2 A;  1MM2 A;  2KIZ A;  1IYM A;  1WIM A;  4PTB A;  3MHS A;  4GND A;  1MM3 A;  2E6R A;  2MT5 A;  4GB0 A;  4ZUX U;  4QF3 A;  5C13 A;  2C2V S;  3KNV A;  5SVI A;  2JMD A;  2VNF A;  2Y43 A;  5I3L A;  2LXH C;  3SHB A;  4OGC A;  2L75 A;  3C5K A;  3HCT A;  1VFY A;  3IHP A;  5B78 A;  4GNG A;  4B86 C;  3PHD A;  4ZQL A;  3LVQ E;  2MD8 C;  2L0B A;  2MUM A;  3O34 A;  3DDT A;  3N9L A;  1WEN A;  3VK6 A;  1LDJ B;  4LAD B;  4XI1 A;  2QJ0 A;  2JMI A;  4CCG X;  2M3H A;  5B77 A;  2RI7 A;  4P5O B;  5TDW A;  4FO9 A;  2DX8 A;  1G25 A;  1Z2Q A;  2YU4 A;  3SUB A;  2VJE A;  3DPL R;  1V87 A;  4R2Y A;  2EGP A;  2VPG A;  3E2D A;  3LVR E;  3GV4 A;  4FIP A;  4YAB A;  4LJN A;  3LRQ A;  2EXU A;  2CKL A;  2P57 A;  2UZG A;  3T9K A;  5LKX A;  5AIU A;  3M99 A;  3L1X A;  2IDA A;  1WFK A;  3I2D A;  2KWJ A;  5AIT A;  2KWK A;  4IC2 A;  3O35 A;  2KU3 A;  3O47 A;  2HDP A;  3N9O A;  5B79 A;  2F6N A;  4S3O B;  2YYR A;  2M13 A;  2RR4 A;  5H9M A;  4UI9 B;  2CON A;  1DCQ A;  3M63 A;  1F62 A;  3RTR B;  4R8P K;  5DKA A;  2K4D A;  1MBM A;  2ECW A;  1WEE A;  4OGE A;  4MVT A;  3U5P A;  5EYA F;  5H1V A;  3EB5 A;  3MDB C;  3N9N A;  2ZET C;  2PUY A;  2MD7 B;  1Z6U A;  2M6M A;  2QIC A;  2LGL A;  2EGM A;  2K17 A;  3KQI A;  2FUI A;  4O62 A;  2BAY A;  2JM3 A;  5FER A;  5KH7 A;  4A4C A;  4W4U A;  2G43 A;  2M85 A;  2H0D B;  1Z60 A;  2LXP C;  3DWD A;  2AN6 A;  2YSJ A;  3PUR A;  4WZ0 A;  2JMJ A;  5G0F A;  3RPG C;  4F52 B;  3DQV R;  3L1Z B;  2VPE A;  2XOZ A;  4Z0O A;  2LN0 A;  3EB6 A;  3C6W A;  5TDR A;  1WES A;  2KKY A;  1DVP A;  2XP0 A;  4YAT A;  1HYJ A;  1HYI A;  4YBT A;  2YUC A;  4QQ4 A;  2F6J A;  1RMD A;  3U5O A;  5LKU A;  1FP0 A;  2L80 A;  5SVX A;  2XEU A;  4FJC A;  3ZPV E;  2KR4 A;  3O33 A;  2FD4 A;  5LKT A;  2VP7 A;  1BOR A;  5B75 A;  2JUN A;  2YHN A;  2YSM A;  3FM8 C;  2CKL B;  2E6S A;  5KH3 A;  4A0C D;  4UP5 A;  2CSZ A;  1ZBD B;  5H1T A;  2C2L A;  4AVX A;  2DSM A;  3N9P A;  4A49 A;  2MNY A;  1X4J A;  2LRI C;  4Q6F A;  2VJE B;  2CSY A;  2CRR A;  4V3L C;  5D1M B;  5FB0 A;  4YBS A;  2L43 A;  5FEY A;  2LGV A;  5G05 B;  2FFW A;  1CHC A;  3O70 A;  3ZYQ A;  2JRJ A;  2CT2 A;  1WEQ A;  3O37 A;  4L58 A;  1T1H A;  1WEP A;  2I50 A;  3ZVZ B;  2D8S A;  2XOY A;  3N9M A;  3FEH A; 
#chains in the Genus database with same CATH homology
 2OWA A;  3PLW A;  2E61 A;  3Q1D A;  2KKY A;  2CRR A;  2FD4 A;  2XP0 A;  3JUE A;  3E2D A;  3O47 A;  3LVR E;  3LVQ E;  4OGE A;  3M7K A;  2D8U A;  5SVI A;  3KDE C;  3DWD A;  2FFW A;  2JUN A;  2DJA A;  3DDT A;  4F1P A;  3FM8 C;  2LAU A;  4QQ4 A;  2CRW A;  2EXU A;  3MDB C;  2M13 A;  4H9D A;  4Z0R A;  2RR4 A;  5K3Q A;  2IQJ A;  4Z0O A;  2CON A;  2P57 A;  5SVY A;  3T9K A;  2YVR A;  1DCQ A;  4OGC A;  2L7P A;  3FJU B;  2KKX A;  2XOC A;  5SVX A;  3LJU X;  3H7H A;  2YRE A;  3LDY A;  2EGM A;  2XOY A;  2XOZ A;  2B0O E;  2MKE A;  5SVI B;  3FEH A;  4O62 A;  2CSV A;  2JM3 A;  3SUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...