2JUNA

Structure of the mid1 tandem b-boxes reveals an interaction reminiscent of intermolecular ring heterodimers
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
AEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Midline-1
publication title Structure of the MID1 Tandem B-Boxes Reveals an Interaction Reminiscent of Intermolecular Ring Heterodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2junA00
3Q1DA 5K3QA 2CSVA 2YVRA 2D8UA 3DDTA 2DJAA 2JUNA 2EGMA
chains in the Genus database with same CATH superfamily
5LKZA 3LRQA 5TDRA 2K16A 2EODA 4BBQA 3H7HA 4A0CD 1U6GB 3C5KA 4Q6FA 3M99A 1Z60A 3U5NA 2KKXA 3SUBA 1LDJB 1N87A 3HCTA 4F52B 2ZETC 4GNDA 2YHOA 4ZQLA 4I7BA 3ZTGA 3U5MA 5DINA 3ZVYA 4YAXA 5FEYA 3LQIA 3PURA 3LVQE 4BHWA 3DPLR 3KQIA 5G0FA 2E6SA 1Z6UA 4AVXA 4I7CA 4CCGX 2F6NA 3LQJA 5FERA 2HDPA 3ZPV1 5TABA 5B75A 4B86C 2L0BA 5H1VA 2YU4A 2LDRA 3Q1DA 2L5UA 2CSZA 4WZ3B 1WEUA 4C9ZA 2KIZA 2VPDA 3KNVA 2EXUA 3SOXA 2MKEA 3SOWA 3O37A 4LLBA 4N4FA 1MM2A 4YBMA 4V3KC 3MHSA 4QF2A 5DKAA 1BORA 2FD4A 2YVRA 2D8UA 3N9OA 2IQJA 3ZPVE 3N9MA 4A4CA 4Z0RA 2G43A 3O35A 3JUEA 2E61A 4LK9A 1WESA 2H0DB 1DVPA 2MA6A 4AYCA 2B0OE 4AYCB 1VFYA 5G04B 2LGLA 4O62A 2CSYA 4X3GA 1ZBDB 1WEOA 2EGPA 2EGMA 4UP5A 4FJCA 2VNFA 5D1KB 3KDEC 2MD8C 2JRJA 5AIUA 5LKTA 2KYUA 5KH7A 3FL2A 3ZYQA 1WILA 3FAOA 2XB1A 4A4BA 3O34A 4V3LC 2FSAA 5TDWA 2JUNA 4WZ2A 1DCQA 2M85A 3NG2A 4WZ0A 4N3WA 3LDYA 3LJUX 5D1MB 3HTKC 4AP4A 2DSMA 1HYJA 1WEQA 2G45A 2YYRA 4MSXA 2VJFA 2FFWA 2Y1MA 1WEMA 2VJFB 2QIZA 1FP0A 2F42A 2I50A 4UI9B 4LADB 2MT5A 4WA6A 3FANA 3O7AA 5EYAF 2YHNA 5H9MA 3I2DA 3DDTA 3IHPA 2M13A 4H9DA 1JOCA 5SVXA 4GNEA 3FEHA 3M63A 3HCUA 1VYXA 3N9LA 3M7KA 4O64A 4B7YC 2MNYA 2MIQA 4YBSA 2ECGA 4F1PA 3GL6A 3L11A 3C6WA 5H1TA 2KKYA 1CHCA 3O70A 5B78A 1VD4A 4P5OB 1G25A 3QZVA 2ECVA 2YQLA 2CONA 4OGEA 4FIPA 2MUMA 2ECTA 3HCSA 3U5PA 1T1HA 4UP0A 4L7XA 4ZUXU 2ECWA 4ZDTA 2RR4A 2KE1A 2LRIC 5TRBA 2E6RA 2Y43A 2XOYA 2YREA 5G05B 3ZNIA 2ECIA 4GNGA 2JMIA 2DJAA 1XWHA 4AUQB 2XOZA 1Z2QA 2XOCA 2M3HA 5KH3A 2PNXA 4LJNA 5TBNA 4NN2A 5B77A 1WEVA 5LKUA 1IYMA 2LGKA 5LKXA 1WFKA 4TKPB 4XI1A 3L1XA 2KFTA 2VP7A 5B76A 1HYIA 4R7EA 5SVYA 2JMJA 2MA5A 2MD7B 4IC2A 4Z0OA 1V87A 4QQ4A 2AN6A 1FBVA 2M1RA 4R2YA 4YABA 1WEPA 2K4DA 2ECJA 1E4UA 2CRWA 4R8PK 4YBTA 2LXPC 1WIMA 2EA6A 1F62A 3PHDA 3M62A 3O33A 2RI7A 2RSDA 1MBMA 3RPGB 3KV5A 2KWJA 2KGIA 3SOUA 3EB6A 4CA1A 2C2LA 2D8SA 2FUUA 3E2DA 2KREA 3RPGC 3L1ZB 5H1UA 2YT5A 5JG6A 1WGMA 2PUYA 3PUQA 2XEUA 2KWKA 3ASLA 3U5OA 2LV9A 3ZVZB 4FK5A 3EB5A 2LN0A 2K17A 4QF3A 2KWNA 2C2VS 2DX8A 2G6QA 5D1LB 2L43A 1MM3A 2LAUA 2KGGA 4YATA 1K2FA 2YUCA 3V43A 5FB0A 3N9NA 2LQ6A 2IDAA 4FO9A 2QJ0A 5I3LA 3FM8C 2LXHC 2CKLA 5KH9A 2XP0A 4GNFA 2CKLB 2CSVA 2L7PA 2FUIA 2YSMA 2MNZA 3DWDA 4PPEA 3LQHA 1WE9A 2KU3A 3DQVR 5B79A 2OXQC 3N9PA 4MVTA 2YQMA 3O36A 3MDBC 3RTRB 1WEEA 1X4UA 3FJUB 4L58A 2VPEA 3MHHA 2P57A 4A49A 3T6RA 5J3XA 1X4IA 4PTBA 3GV4A 2JMDA 5C11A 2YW8A 5FB1A 4LKAA 3T9KA 3LVRE 2KR4A 1JM7A 1LDKC 2VJEA 3O47A 1JM7B 3N9QA 5SVIA 2VJEB 5SVIB 2QICA 2H0DA 3VK6A 2KWOA 2NAAA 1X4JA 2ECNA 2L80A 2CT2A 4YADA 5K3QA 2YURA 2JM3A 2Y1NA 5AITA 2HYED 4OGCA 3T7LA 2BAYA 1RMDA 3KV6A 4GB0A 2CRRA 1WEWA 5B8DA 4I7DA 2L75A 5LCWB 3PLWA 3SHBA 1WENA 2UZGA 2OWAA 2K1JA 4S3OB 5C13A 4IC3A 2YSJA 2LGVA 2VPGA 4W4UA 2VPBA 2F6JA 2M6MA 4YC9A 4S3OC 2LGGA
chains in the Genus database with same CATH topology
3JUEA 2KKYA 2CRRA 2E61A 3MDBC 3FM8C 4H9DA 2EXUA 3FJUB 2XOYA 2MKEA 3LVQE 3H7HA 2FFWA 2YREA 2P57A 5SVYA 5SVXA 2XP0A 2B0OE 3PLWA 2CSVA 3FEHA 2L7PA 4Z0OA 2KKXA 4OGEA 2CONA 4QQ4A 2DJAA 2JUNA 3SUBA 4O62A 1DCQA 2OWAA 5K3QA 3DWDA 3M7KA 2XOZA 2JM3A 3T9KA 2FD4A 2YVRA 3LVRE 2D8UA 3E2DA 2IQJA 2XOCA 2EGMA 3Q1DA 3O47A 4OGCA 3LDYA 3LJUX 4F1PA 5SVIA 2LAUA 2CRWA 2RR4A 3DDTA 5SVIB 3KDEC 4Z0RA 2M13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1D A;  5K3Q A;  2CSV A;  2YVR A;  2D8U A;  3DDT A;  2DJA A;  2JUN A;  2EGM A; 
#chains in the Genus database with same CATH topology
 5LKZ A;  3LRQ A;  5TDR A;  2K16 A;  2EOD A;  4BBQ A;  3H7H A;  4A0C D;  1U6G B;  3C5K A;  4Q6F A;  3M99 A;  1Z60 A;  3U5N A;  2KKX A;  3SUB A;  1LDJ B;  1N87 A;  3HCT A;  4F52 B;  2ZET C;  4GND A;  2YHO A;  4ZQL A;  4I7B A;  3ZTG A;  3U5M A;  5DIN A;  3ZVY A;  4YAX A;  5FEY A;  3LQI A;  3PUR A;  3LVQ E;  4BHW A;  3DPL R;  3KQI A;  5G0F A;  2E6S A;  1Z6U A;  4AVX A;  4I7C A;  4CCG X;  2F6N A;  3LQJ A;  5FER A;  2HDP A;  3ZPV 1;  5TAB A;  5B75 A;  4B86 C;  2L0B A;  5H1V A;  2YU4 A;  2LDR A;  3Q1D A;  2L5U A;  2CSZ A;  4WZ3 B;  1WEU A;  4C9Z A;  2KIZ A;  2VPD A;  3KNV A;  2EXU A;  3SOX A;  2MKE A;  3SOW A;  3O37 A;  4LLB A;  4N4F A;  1MM2 A;  4YBM A;  4V3K C;  3MHS A;  4QF2 A;  5DKA A;  1BOR A;  2FD4 A;  2YVR A;  2D8U A;  3N9O A;  2IQJ A;  3ZPV E;  3N9M A;  4A4C A;  4Z0R A;  2G43 A;  3O35 A;  3JUE A;  2E61 A;  4LK9 A;  1WES A;  2H0D B;  1DVP A;  2MA6 A;  4AYC A;  2B0O E;  4AYC B;  1VFY A;  5G04 B;  2LGL A;  4O62 A;  2CSY A;  4X3G A;  1ZBD B;  1WEO A;  2EGP A;  2EGM A;  4UP5 A;  4FJC A;  2VNF A;  5D1K B;  3KDE C;  2MD8 C;  2JRJ A;  5AIU A;  5LKT A;  2KYU A;  5KH7 A;  3FL2 A;  3ZYQ A;  1WIL A;  3FAO A;  2XB1 A;  4A4B A;  3O34 A;  4V3L C;  2FSA A;  5TDW A;  2JUN A;  4WZ2 A;  1DCQ A;  2M85 A;  3NG2 A;  4WZ0 A;  4N3W A;  3LDY A;  3LJU X;  5D1M B;  3HTK C;  4AP4 A;  2DSM A;  1HYJ A;  1WEQ A;  2G45 A;  2YYR A;  4MSX A;  2VJF A;  2FFW A;  2Y1M A;  1WEM A;  2VJF B;  2QIZ A;  1FP0 A;  2F42 A;  2I50 A;  4UI9 B;  4LAD B;  2MT5 A;  4WA6 A;  3FAN A;  3O7A A;  5EYA F;  2YHN A;  5H9M A;  3I2D A;  3DDT A;  3IHP A;  2M13 A;  4H9D A;  1JOC A;  5SVX A;  4GNE A;  3FEH A;  3M63 A;  3HCU A;  1VYX A;  3N9L A;  3M7K A;  4O64 A;  4B7Y C;  2MNY A;  2MIQ A;  4YBS A;  2ECG A;  4F1P A;  3GL6 A;  3L11 A;  3C6W A;  5H1T A;  2KKY A;  1CHC A;  3O70 A;  5B78 A;  1VD4 A;  4P5O B;  1G25 A;  3QZV A;  2ECV A;  2YQL A;  2CON A;  4OGE A;  4FIP A;  2MUM A;  2ECT A;  3HCS A;  3U5P A;  1T1H A;  4UP0 A;  4L7X A;  4ZUX U;  2ECW A;  4ZDT A;  2RR4 A;  2KE1 A;  2LRI C;  5TRB A;  2E6R A;  2Y43 A;  2XOY A;  2YRE A;  5G05 B;  3ZNI A;  2ECI A;  4GNG A;  2JMI A;  2DJA A;  1XWH A;  4AUQ B;  2XOZ A;  1Z2Q A;  2XOC A;  2M3H A;  5KH3 A;  2PNX A;  4LJN A;  5TBN A;  4NN2 A;  5B77 A;  1WEV A;  5LKU A;  1IYM A;  2LGK A;  5LKX A;  1WFK A;  4TKP B;  4XI1 A;  3L1X A;  2KFT A;  2VP7 A;  5B76 A;  1HYI A;  4R7E A;  5SVY A;  2JMJ A;  2MA5 A;  2MD7 B;  4IC2 A;  4Z0O A;  1V87 A;  4QQ4 A;  2AN6 A;  1FBV A;  2M1R A;  4R2Y A;  4YAB A;  1WEP A;  2K4D A;  2ECJ A;  1E4U A;  2CRW A;  4R8P K;  4YBT A;  2LXP C;  1WIM A;  2EA6 A;  1F62 A;  3PHD A;  3M62 A;  3O33 A;  2RI7 A;  2RSD A;  1MBM A;  3RPG B;  3KV5 A;  2KWJ A;  2KGI A;  3SOU A;  3EB6 A;  4CA1 A;  2C2L A;  2D8S A;  2FUU A;  3E2D A;  2KRE A;  3RPG C;  3L1Z B;  5H1U A;  2YT5 A;  5JG6 A;  1WGM A;  2PUY A;  3PUQ A;  2XEU A;  2KWK A;  3ASL A;  3U5O A;  2LV9 A;  3ZVZ B;  4FK5 A;  3EB5 A;  2LN0 A;  2K17 A;  4QF3 A;  2KWN A;  2C2V S;  2DX8 A;  2G6Q A;  5D1L B;  2L43 A;  1MM3 A;  2LAU A;  2KGG A;  4YAT A;  1K2F A;  2YUC A;  3V43 A;  5FB0 A;  3N9N A;  2LQ6 A;  2IDA A;  4FO9 A;  2QJ0 A;  5I3L A;  3FM8 C;  2LXH C;  2CKL A;  5KH9 A;  2XP0 A;  4GNF A;  2CKL B;  2CSV A;  2L7P A;  2FUI A;  2YSM A;  2MNZ A;  3DWD A;  4PPE A;  3LQH A;  1WE9 A;  2KU3 A;  3DQV R;  5B79 A;  2OXQ C;  3N9P A;  4MVT A;  2YQM A;  3O36 A;  3MDB C;  3RTR B;  1WEE A;  1X4U A;  3FJU B;  4L58 A;  2VPE A;  3MHH A;  2P57 A;  4A49 A;  3T6R A;  5J3X A;  1X4I A;  4PTB A;  3GV4 A;  2JMD A;  5C11 A;  2YW8 A;  5FB1 A;  4LKA A;  3T9K A;  3LVR E;  2KR4 A;  1JM7 A;  1LDK C;  2VJE A;  3O47 A;  1JM7 B;  3N9Q A;  5SVI A;  2VJE B;  5SVI B;  2QIC A;  2H0D A;  3VK6 A;  2KWO A;  2NAA A;  1X4J A;  2ECN A;  2L80 A;  2CT2 A;  4YAD A;  5K3Q A;  2YUR A;  2JM3 A;  2Y1N A;  5AIT A;  2HYE D;  4OGC A;  3T7L A;  2BAY A;  1RMD A;  3KV6 A;  4GB0 A;  2CRR A;  1WEW A;  5B8D A;  4I7D A;  2L75 A;  5LCW B;  3PLW A;  3SHB A;  1WEN A;  2UZG A;  2OWA A;  2K1J A;  4S3O B;  5C13 A;  4IC3 A;  2YSJ A;  2LGV A;  2VPG A;  4W4U A;  2VPB A;  2F6J A;  2M6M A;  4YC9 A;  4S3O C;  2LGG A; 
#chains in the Genus database with same CATH homology
 3JUE A;  2KKY A;  2CRR A;  2E61 A;  3MDB C;  3FM8 C;  4H9D A;  2EXU A;  3FJU B;  2XOY A;  2MKE A;  3LVQ E;  3H7H A;  2FFW A;  2YRE A;  2P57 A;  5SVY A;  5SVX A;  2XP0 A;  2B0O E;  3PLW A;  2CSV A;  3FEH A;  2L7P A;  4Z0O A;  2KKX A;  4OGE A;  2CON A;  4QQ4 A;  2DJA A;  2JUN A;  3SUB A;  4O62 A;  1DCQ A;  2OWA A;  5K3Q A;  3DWD A;  3M7K A;  2XOZ A;  2JM3 A;  3T9K A;  2FD4 A;  2YVR A;  3LVR E;  2D8U A;  3E2D A;  2IQJ A;  2XOC A;  2EGM A;  3Q1D A;  3O47 A;  4OGC A;  3LDY A;  3LJU X;  4F1P A;  5SVI A;  2LAU A;  2CRW A;  2RR4 A;  3DDT A;  5SVI B;  3KDE C;  4Z0R A;  2M13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...