2JUNA

Structure of the mid1 tandem b-boxes reveals an interaction reminiscent of intermolecular ring heterodimers
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
b'AEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Midline-1
publication title Structure of the MID1 Tandem B-Boxes Reveals an Interaction Reminiscent of Intermolecular Ring Heterodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2junA00
3DDTA 2YVRA 2EGMA 2DJAA 3Q1DA 2JUNA 2CSVA 5K3QA 2D8UA
chains in the Genus database with same CATH superfamily
1WILA 2ZETC 2L5UA 3O36A 2Y1MA 2KU3A 2D8SA 2DSMA 2VJEB 4MSXA 1MM3A 3NG2A 4A4BA 1WEEA 2VJEA 2ECVA 3U5NA 4GNFA 2KWNA 2JM3A 2KREA 2VJFB 5D1LB 5B76A 1XWHA 4XI1A 2VJFA 2KWJA 2F42A 2MUMA 5D1KB 2KKYA 3SHBA 4GNDA 2YQMA 5G0FA 3M63A 2BAYA 2VP7A 1VD4A 2DJAA 2YHOA 3KQIA 1BORA 2PNXA 5TBNA 4FO9A 1FBVA 5D1MB 2OWAA 3LVRE 5K3QA 4R7EA 3M62A 2VPGA 3O34A 2P57A 5I3LA 3VK6A 2MNYA 3O47A 2JMDA 3DPLR 5FERA 4UP0A 3O35A 3HCTA 3Q1DA 5H1TA 3DWDA 4PTBA 4UP5A 2QJ0A 1K2FA 2KFTA 3KDEC 1WEPA 2RI7A 2YUCA 2ECNA 3FANA 2YQLA 1WEOA 1MM2A 1WESA 4A0CD 2G6QA 4YC9A 3U5OA 5C13A 3KV5A 4V3KC 2ECTA 2XOYA 1LDKC 5AITA 2KIZA 5EYAF 5DINA 5H9MA 3DQVR 5AIUA 4IC2A 2FUUA 2Y43A 4YBMA 3N9OA 4AUQB 2MT5A 5LKXA 3C5KA 2M13A 4CA1A 3N9LA 2YURA 3ZVZB 2KE1A 2ECWA 2KWKA 2EODA 1V87A 2AN6A 1X4UA 5SVIB 3GV4A 4Z0RA 1U6GB 4YADA 5TRBA 3FM8C 3GL6A 4FJCA 3RTRB 5KH7A 2E61A 3HTKC 4S3OB 2G43A 2YSMA 3M7KA 2H0DB 3FEHA 4A4CA 4YBSA 2CSYA 2CRWA 2H0DA 4ZUXU 2E6RA 5FEYA 2VPEA 1DVPA 2LN0A 5FB1A 4R8PK 2XOZA 1Z60A 4OGEA 2XB1A 4F1PA 1HYJA 1WEMA 2HYED 1G25A 2KWOA 2PUYA 4GB0A 5B79A 3SOWA 4O64A 5LKUA 2B0OE 2JMIA 4OGCA 2LGLA 3KNVA 1WGMA 2QICA 4LADB 2G45A 2K16A 3EB5A 4CCGX 2L75A 4YATA 1T1HA 4N3WA 5TABA 2EGPA 4O62A 5H1UA 3O7AA 4BBQA 5G04B 1E4UA 2HDPA 4IC3A 2QIZA 4B7YC 5TDWA 4R2YA 2LXHC 2VPBA 2XOCA 5H1VA 3SOUA 4L58A 1WIMA 5B78A 3EB6A 5SVXA 4QQ4A 2UZGA 2VNFA 5B77A 5G05B 2L0BA 3U5MA 1F62A 3O37A 2L80A 4AYCA 2RSDA 3LQHA 2EGMA 4WA6A 3PHDA 2JRJA 5C11A 2YSJA 3V43A 2ECGA 4I7BA 2LXPC 3MHHA 3H7HA 4QF3A 2MA5A 4Z0OA 4NN2A 3RPGC 3N9NA 4AVXA 1CHCA 2Y1NA 4YAXA 3I2DA 3QZVA 2M3HA 1Z6UA 2CT2A 2OXQC 4N4FA 4I7DA 2JUNA 3O70A 4YBTA 2MNZA 3M99A 3L11A 3L1ZB 2FD4A 2D8UA 1JM7B 2NAAA 3FAOA 3ZNIA 1JM7A 1DCQA 2KYUA 1N87A 2LRIC 4WZ0A 5LCWB 4QF2A 4P5OB 4I7CA 2K4DA 3LDYA 3PUQA 2I50A 1IYMA 3ZTGA 2ECJA 4LJNA 2CONA 1WFKA 2IQJA 4F52B 1X4IA 2LAUA 4S3OC 5J3XA 4B86C 2YU4A 2LGKA 4X3GA 2FFWA 4FIPA 2YVRA 2L7PA 3N9PA 2FSAA 1LDJB 1ZBDB 1HYIA 3O33A 2RR4A 3ZYQA 3N9MA 5B75A 4LKAA 2F6JA 2FUIA 4AP4A 3T7LA 2LDRA 3JUEA 5JG6A 4A49A 2ECIA 1VFYA 1WEUA 2F6NA 2EXUA 3E2DA 4MVTA 4WZ2A 1FP0A 3IHPA 4C9ZA 4W4UA 5DKAA 4GNEA 2LGGA 5TDRA 2XP0A 1VYXA 4FK5A 2C2LA 3N9QA 2K17A 3LQIA 4ZDTA 2YT5A 2YHNA 3T6RA 4UI9B 2L43A 4V3LC 4Q6FA 4AYCB 1JOCA 5B8DA 2VPDA 1WE9A 2YYRA 2CKLB 2M1RA 2KR4A 2C2VS 3ZVYA 3ZPV1 2CKLA 2K1JA 2M6MA 2MIQA 4L7XA 2LQ6A 2IDAA 5KH9A 5LKTA 3C6WA 2KGGA 4H9DA 4WZ3B 4LLBA 3FJUB 1X4JA 2MD8C 2CSVA 2EA6A 2CRRA 3DDTA 3RPGB 3LQJA 3U5PA 1WEQA 2KKXA 5FB0A 2LV9A 2E6SA 2MA6A 3LVQE 3LRQA 3SUBA 3T9KA 3SOXA 2M85A 3LJUX 2KGIA 5LKZA 1WENA 1WEVA 5KH3A 2LGVA 1Z2QA 2YREA 3L1XA 3MHSA 1RMDA 3ZPVE 2XEUA 3PURA 4GNGA 2MKEA 2MD7B 4PPEA 3FL2A 4TKPB 1WEWA 2CSZA 4YABA 3PLWA 1MBMA 2JMJA 4ZQLA 3HCUA 5SVYA 3ASLA 2YW8A 3HCSA 3KV6A 5SVIA 4LK9A 2DX8A 3MDBC 4BHWA
chains in the Genus database with same CATH topology
2E61A 3DDTA 2YVRA 3O47A 1DCQA 2M13A 2MKEA 4OGCA 3M7KA 2L7PA 2XOCA 3FEHA 3LDYA 2CRWA 2EGMA 2DJAA 2XOYA 3Q1DA 5SVXA 2KKXA 4QQ4A 2RR4A 3DWDA 2JUNA 3PLWA 2CONA 2XOZA 4OGEA 4F1PA 3LVQE 3SUBA 3T9KA 3KDEC 2XP0A 2IQJA 2JM3A 3JUEA 4O62A 2FD4A 3LJUX 4H9DA 2D8UA 2OWAA 3LVRE 5SVYA 5SVIB 5K3QA 2LAUA 3FJUB 4Z0RA 2YREA 3H7HA 4Z0OA 5SVIA 2P57A 3FM8C 2EXUA 3E2DA 2CSVA 2FFWA 3MDBC 2KKYA 2B0OE 2CRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDT A;  2YVR A;  2EGM A;  2DJA A;  3Q1D A;  2JUN A;  2CSV A;  5K3Q A;  2D8U A; 
#chains in the Genus database with same CATH topology
 1WIL A;  2ZET C;  2L5U A;  3O36 A;  2Y1M A;  2KU3 A;  2D8S A;  2DSM A;  2VJE B;  4MSX A;  1MM3 A;  3NG2 A;  4A4B A;  1WEE A;  2VJE A;  2ECV A;  3U5N A;  4GNF A;  2KWN A;  2JM3 A;  2KRE A;  2VJF B;  5D1L B;  5B76 A;  1XWH A;  4XI1 A;  2VJF A;  2KWJ A;  2F42 A;  2MUM A;  5D1K B;  2KKY A;  3SHB A;  4GND A;  2YQM A;  5G0F A;  3M63 A;  2BAY A;  2VP7 A;  1VD4 A;  2DJA A;  2YHO A;  3KQI A;  1BOR A;  2PNX A;  5TBN A;  4FO9 A;  1FBV A;  5D1M B;  2OWA A;  3LVR E;  5K3Q A;  4R7E A;  3M62 A;  2VPG A;  3O34 A;  2P57 A;  5I3L A;  3VK6 A;  2MNY A;  3O47 A;  2JMD A;  3DPL R;  5FER A;  4UP0 A;  3O35 A;  3HCT A;  3Q1D A;  5H1T A;  3DWD A;  4PTB A;  4UP5 A;  2QJ0 A;  1K2F A;  2KFT A;  3KDE C;  1WEP A;  2RI7 A;  2YUC A;  2ECN A;  3FAN A;  2YQL A;  1WEO A;  1MM2 A;  1WES A;  4A0C D;  2G6Q A;  4YC9 A;  3U5O A;  5C13 A;  3KV5 A;  4V3K C;  2ECT A;  2XOY A;  1LDK C;  5AIT A;  2KIZ A;  5EYA F;  5DIN A;  5H9M A;  3DQV R;  5AIU A;  4IC2 A;  2FUU A;  2Y43 A;  4YBM A;  3N9O A;  4AUQ B;  2MT5 A;  5LKX A;  3C5K A;  2M13 A;  4CA1 A;  3N9L A;  2YUR A;  3ZVZ B;  2KE1 A;  2ECW A;  2KWK A;  2EOD A;  1V87 A;  2AN6 A;  1X4U A;  5SVI B;  3GV4 A;  4Z0R A;  1U6G B;  4YAD A;  5TRB A;  3FM8 C;  3GL6 A;  4FJC A;  3RTR B;  5KH7 A;  2E61 A;  3HTK C;  4S3O B;  2G43 A;  2YSM A;  3M7K A;  2H0D B;  3FEH A;  4A4C A;  4YBS A;  2CSY A;  2CRW A;  2H0D A;  4ZUX U;  2E6R A;  5FEY A;  2VPE A;  1DVP A;  2LN0 A;  5FB1 A;  4R8P K;  2XOZ A;  1Z60 A;  4OGE A;  2XB1 A;  4F1P A;  1HYJ A;  1WEM A;  2HYE D;  1G25 A;  2KWO A;  2PUY A;  4GB0 A;  5B79 A;  3SOW A;  4O64 A;  5LKU A;  2B0O E;  2JMI A;  4OGC A;  2LGL A;  3KNV A;  1WGM A;  2QIC A;  4LAD B;  2G45 A;  2K16 A;  3EB5 A;  4CCG X;  2L75 A;  4YAT A;  1T1H A;  4N3W A;  5TAB A;  2EGP A;  4O62 A;  5H1U A;  3O7A A;  4BBQ A;  5G04 B;  1E4U A;  2HDP A;  4IC3 A;  2QIZ A;  4B7Y C;  5TDW A;  4R2Y A;  2LXH C;  2VPB A;  2XOC A;  5H1V A;  3SOU A;  4L58 A;  1WIM A;  5B78 A;  3EB6 A;  5SVX A;  4QQ4 A;  2UZG A;  2VNF A;  5B77 A;  5G05 B;  2L0B A;  3U5M A;  1F62 A;  3O37 A;  2L80 A;  4AYC A;  2RSD A;  3LQH A;  2EGM A;  4WA6 A;  3PHD A;  2JRJ A;  5C11 A;  2YSJ A;  3V43 A;  2ECG A;  4I7B A;  2LXP C;  3MHH A;  3H7H A;  4QF3 A;  2MA5 A;  4Z0O A;  4NN2 A;  3RPG C;  3N9N A;  4AVX A;  1CHC A;  2Y1N A;  4YAX A;  3I2D A;  3QZV A;  2M3H A;  1Z6U A;  2CT2 A;  2OXQ C;  4N4F A;  4I7D A;  2JUN A;  3O70 A;  4YBT A;  2MNZ A;  3M99 A;  3L11 A;  3L1Z B;  2FD4 A;  2D8U A;  1JM7 B;  2NAA A;  3FAO A;  3ZNI A;  1JM7 A;  1DCQ A;  2KYU A;  1N87 A;  2LRI C;  4WZ0 A;  5LCW B;  4QF2 A;  4P5O B;  4I7C A;  2K4D A;  3LDY A;  3PUQ A;  2I50 A;  1IYM A;  3ZTG A;  2ECJ A;  4LJN A;  2CON A;  1WFK A;  2IQJ A;  4F52 B;  1X4I A;  2LAU A;  4S3O C;  5J3X A;  4B86 C;  2YU4 A;  2LGK A;  4X3G A;  2FFW A;  4FIP A;  2YVR A;  2L7P A;  3N9P A;  2FSA A;  1LDJ B;  1ZBD B;  1HYI A;  3O33 A;  2RR4 A;  3ZYQ A;  3N9M A;  5B75 A;  4LKA A;  2F6J A;  2FUI A;  4AP4 A;  3T7L A;  2LDR A;  3JUE A;  5JG6 A;  4A49 A;  2ECI A;  1VFY A;  1WEU A;  2F6N A;  2EXU A;  3E2D A;  4MVT A;  4WZ2 A;  1FP0 A;  3IHP A;  4C9Z A;  4W4U A;  5DKA A;  4GNE A;  2LGG A;  5TDR A;  2XP0 A;  1VYX A;  4FK5 A;  2C2L A;  3N9Q A;  2K17 A;  3LQI A;  4ZDT A;  2YT5 A;  2YHN A;  3T6R A;  4UI9 B;  2L43 A;  4V3L C;  4Q6F A;  4AYC B;  1JOC A;  5B8D A;  2VPD A;  1WE9 A;  2YYR A;  2CKL B;  2M1R A;  2KR4 A;  2C2V S;  3ZVY A;  3ZPV 1;  2CKL A;  2K1J A;  2M6M A;  2MIQ A;  4L7X A;  2LQ6 A;  2IDA A;  5KH9 A;  5LKT A;  3C6W A;  2KGG A;  4H9D A;  4WZ3 B;  4LLB A;  3FJU B;  1X4J A;  2MD8 C;  2CSV A;  2EA6 A;  2CRR A;  3DDT A;  3RPG B;  3LQJ A;  3U5P A;  1WEQ A;  2KKX A;  5FB0 A;  2LV9 A;  2E6S A;  2MA6 A;  3LVQ E;  3LRQ A;  3SUB A;  3T9K A;  3SOX A;  2M85 A;  3LJU X;  2KGI A;  5LKZ A;  1WEN A;  1WEV A;  5KH3 A;  2LGV A;  1Z2Q A;  2YRE A;  3L1X A;  3MHS A;  1RMD A;  3ZPV E;  2XEU A;  3PUR A;  4GNG A;  2MKE A;  2MD7 B;  4PPE A;  3FL2 A;  4TKP B;  1WEW A;  2CSZ A;  4YAB A;  3PLW A;  1MBM A;  2JMJ A;  4ZQL A;  3HCU A;  5SVY A;  3ASL A;  2YW8 A;  3HCS A;  3KV6 A;  5SVI A;  4LK9 A;  2DX8 A;  3MDB C;  4BHW A; 
#chains in the Genus database with same CATH homology
 2E61 A;  3DDT A;  2YVR A;  3O47 A;  1DCQ A;  2M13 A;  2MKE A;  4OGC A;  3M7K A;  2L7P A;  2XOC A;  3FEH A;  3LDY A;  2CRW A;  2EGM A;  2DJA A;  2XOY A;  3Q1D A;  5SVX A;  2KKX A;  4QQ4 A;  2RR4 A;  3DWD A;  2JUN A;  3PLW A;  2CON A;  2XOZ A;  4OGE A;  4F1P A;  3LVQ E;  3SUB A;  3T9K A;  3KDE C;  2XP0 A;  2IQJ A;  2JM3 A;  3JUE A;  4O62 A;  2FD4 A;  3LJU X;  4H9D A;  2D8U A;  2OWA A;  3LVR E;  5SVY A;  5SVI B;  5K3Q A;  2LAU A;  3FJU B;  4Z0R A;  2YRE A;  3H7H A;  4Z0O A;  5SVI A;  2P57 A;  3FM8 C;  2EXU A;  3E2D A;  2CSV A;  2FFW A;  3MDB C;  2KKY A;  2B0O E;  2CRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...