3ZTGA

Solution structure of the ring finger-like domain of retinoblastoma binding protein-6 (rbbp6)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
GPLGSEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RBBP6
publication title Solution Structure of the Ring Finger-Like Domain of Retinoblastoma Binding Protein-6 (Rbbp6) Suggests It Functions as a U-Box
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3ztgA00
2C2LA 5C13A 3KQIA 2JMDA 4A0CD 2XEUA 1U6GB 3QZVA 1LDJB 1RMDA 5C11A 5FB1A 3LQIA 4PTBA 2KWNA 4F52B 2VPDA 1K2FA 2YQMA 5H1TA 2BAYA 4MVTA 2DX8A 5LKUA 3RTRB 3N9QA 1WILA 1WEUA 2LQ6A 2RSDA 2PUYA 4YBTA 1CHCA 4I7BA 4FK5A 4FIPA 5LKZA 3PHDA 3ASLA 3ZVZB 1XWHA 4Q6FA 1JM7B 1JOCA 3SOUA 2M6MA 2FSAA 2OXQC 2RI7A 4AP4A 1WESA 2L5UA 2LXPC 2ECIA 4C9ZA 3L11A 5B79A 4PPEA 4UI9B 2VP7A 2YYRA 3V43A 2I50A 3ZTGA 2F6JA 3ZPVE 1VD4A 5B77A 3MHSA 2KGGA 4FJCA 4AYCA 4YBSA 2E6SA 2JRJA 2L0BA 3O37A 2Y1MA 5FB0A 4L7XA 3KV6A 4WZ3B 3U5PA 3GL6A 3HCSA 2FUIA 4S3OC 3DQVR 3SHBA 4AUQB 4MSXA 5TBNA 3N9PA 3T6RA 5TDWA 2HYED 3N9LA 2MA5A 3PUQA 1T1HA 4L58A 2AN6A 3GV4A 5D1MB 2UZGA 2VJEA 2M85A 5D1LB 4AYCB 4ZUXU 1Z6UA 5DINA 1MM3A 3N9MA 2MA6A 1WEVA 3HTKC 2H0DA 2KFTA 2KE1A 2M1RA 2ECTA 2L80A 3N9NA 1WENA 3NG2A 3FL2A 1ZBDB 5G05B 3M99A 4GNGA 1G25A 4LK9A 1X4IA 5H1UA 3LQHA 2G45A 4P5OB 3ZVYA 2IDAA 3O33A 2VJEB 2KU3A 3ZYQA 4CCGX 5TDRA 5D1KB 2K1JA 1E4UA 3O34A 1Z60A 3SOWA 2D8SA 2K4DA 4O64A 5FEYA 5B8DA 3M62A 3L1ZB 2KWOA 2Y1NA 2NAAA 1WEEA 2H0DB 2YU4A 1V87A 3U5OA 3O36A 1VYXA 3EB6A 5TABA 1X4JA 3RPGC 2KIZA 1VFYA 2YW8A 4V3KC 2YREA 4YABA 5B75A 4GNFA 2EA6A 1WGMA 2KREA 4WA6A 2KGIA 2QIZA 4YBMA 4ZDTA 2KR4A 2LN0A 2C2VS 2ECVA 5KH9A 3IHPA 2XB1A 1DVPA 5LCWB 3HCTA 5TRBA 3U5NA 4GB0A 4R7EA 2KYUA 1F62A 2YURA 4AVXA 3ZNIA 4B7YC 3I2DA 2YSMA 5DKAA 1FP0A 4UP5A 3EB5A 2ECWA 4IC2A 1Z2QA 2ECNA 4YC9A 2LGKA 2EGPA 2MUMA 2LRIC 2MT5A 1MM2A 2LV9A 5AIUA 2M3HA 5LKXA 3LQJA 5B78A 5G0FA 3U5MA 2JMIA 3VK6A 4V3LC 3N9OA 5AITA 2KWJA 1WE9A 2FUUA 2JMJA 2LGVA 4NN2A 2ECGA 4A4CA 2YUCA 4W4UA 2MD7B 1WFKA 2QICA 2L75A 2PNXA 2MNYA 3O70A 1WEMA 3C6WA 4TKPB 2CKLA 1N87A 2LXHC 4LADB 2L43A 4A4BA 4UP0A 2LGGA 3SOXA 4A49A 5H1VA 1WEPA 5H9MA 4GNDA 2CSZA 2EODA 1HYJA 4WZ0A 2LDRA 1WEOA 2VPGA 2E6RA 4N4FA 5LKTA 4WZ2A 2Y43A 4YAXA 4YADA 2HDPA 3RPGB 5KH3A 3M63A 2YHNA 4BBQA 4QF3A 2VPBA 1X4UA 2CKLB 2VJFA 2VNFA 2G6QA 2G43A 4ZQLA 1IYMA 1WIMA 4X3GA 1FBVA 2QJ0A 4N3WA 4BHWA 2K16A 3C5KA 2MNZA 4B86C 2CT2A 4S3OB 1WEWA 2YHOA 3MHHA 2ZETC 4LKAA 2K17A 2LGLA 2F42A 5J3XA 4CA1A 3PURA 2YQLA 1BORA 3HCUA 5B76A 4LJNA 5KH7A 2MIQA 2F6NA 2CSYA 2VPEA 3KV5A 3KNVA 4I7DA 2VJFB 1WEQA 4I7CA 3O35A 1HYIA 3DPLR 5JG6A 2KWKA 4QF2A 4R2YA 3LRQA 4FO9A 3ZPV1 2YT5A 2ECJA 4YATA 5EYAF 3O7AA 1JM7A 5I3LA 1LDKC 3L1XA 4GNEA 4IC3A 4R8PK 4XI1A 2MD8C 2YSJA 5FERA 3T7LA 5G04B 4LLBA
chains in the Genus database with same CATH superfamily
2C2LA 5C13A 3M7KA 3KQIA 2JMDA 4A0CD 2XEUA 1U6GB 3QZVA 1LDJB 1RMDA 5C11A 2B0OE 5FB1A 2YVRA 3LQIA 4PTBA 2KWNA 3FEHA 4F52B 2VPDA 4F1PA 3PLWA 1K2FA 2YQMA 3T9KA 5H1TA 2BAYA 4MVTA 2DX8A 5LKUA 3RTRB 3N9QA 1WILA 1WEUA 2LQ6A 2RSDA 2PUYA 4YBTA 1CHCA 4I7BA 4FK5A 4FIPA 5LKZA 3PHDA 3ASLA 3ZVZB 1XWHA 4Q6FA 1JM7B 1JOCA 3SOUA 2RI7A 2M6MA 2FSAA 2JUNA 2OXQC 4AP4A 1WESA 2L5UA 2LXPC 2ECIA 4C9ZA 3L11A 5B79A 4PPEA 2FD4A 4UI9B 2VP7A 2YYRA 3V43A 2XOYA 2I50A 3MDBC 3ZTGA 2F6JA 3ZPVE 1VD4A 5B77A 3MHSA 2KGGA 4FJCA 4AYCA 3FJUB 4YBSA 4H9DA 2E6SA 2JRJA 2L0BA 3O37A 2Y1MA 5FB0A 4L7XA 3KV6A 4WZ3B 3U5PA 3GL6A 3HCSA 2FUIA 2KKYA 4S3OC 3DQVR 3SHBA 4AUQB 2L7PA 4MSXA 5TBNA 3N9PA 3Q1DA 3T6RA 2XP0A 3LJUX 5TDWA 2HYED 3N9LA 2MA5A 5SVIA 3PUQA 1T1HA 4L58A 2AN6A 3SUBA 3GV4A 5D1MB 2UZGA 2VJEA 2M85A 5D1LB 4AYCB 4ZUXU 1Z6UA 5DINA 1MM3A 3N9MA 2MA6A 1WEVA 3HTKC 2H0DA 2KFTA 1MBMA 2KE1A 2EGMA 2M1RA 2ECTA 2DSMA 2L80A 3N9NA 1WENA 3NG2A 2KKXA 3FL2A 1ZBDB 5G05B 3M99A 4GNGA 1G25A 4LK9A 1X4IA 5H1UA 3LQHA 2G45A 4P5OB 3ZVYA 5SVIB 2DJAA 2IDAA 3O33A 1DCQA 2VJEB 3JUEA 2KU3A 3ZYQA 4CCGX 5TDRA 5D1KB 2K1JA 1E4UA 3O34A 1Z60A 3SOWA 2D8SA 2K4DA 4O64A 5FEYA 5B8DA 5SVXA 3M62A 3L1ZB 2KWOA 2Y1NA 2NAAA 1WEEA 2H0DB 2YU4A 2E61A 1V87A 3U5OA 3O36A 1VYXA 3EB6A 3FANA 5TABA 1X4JA 3RPGC 2KIZA 1VFYA 2YW8A 2FFWA 4V3KC 2YREA 4YABA 5B75A 4GNFA 2EA6A 1WGMA 2KREA 4WA6A 2KGIA 2QIZA 4YBMA 3O47A 4ZDTA 2KR4A 2LN0A 2C2VS 2ECVA 2IQJA 5KH9A 3IHPA 2XB1A 1DVPA 3H7HA 5LCWB 3HCTA 5TRBA 2CRWA 3U5NA 4GB0A 4R7EA 2KYUA 2CRRA 1F62A 2YURA 4AVXA 3ZNIA 4B7YC 3I2DA 2YSMA 5DKAA 1FP0A 4UP5A 3EB5A 2ECWA 3LVQE 4IC2A 3E2DA 1Z2QA 2ECNA 4YC9A 2LGKA 2EGPA 2MUMA 2MT5A 2LRIC 1MM2A 2LV9A 5AIUA 2M3HA 5LKXA 2CSVA 3LQJA 5B78A 5G0FA 3DWDA 5K3QA 3U5MA 4OGCA 2JMIA 2EXUA 3VK6A 4O62A 4V3LC 3N9OA 5AITA 2KWJA 1WE9A 2FUUA 2JMJA 2LGVA 4NN2A 2ECGA 4A4CA 2YUCA 2XOCA 4W4UA 2MD7B 1WFKA 2QICA 2L75A 2PNXA 2MNYA 3O70A 3LDYA 1WEMA 3C6WA 4TKPB 2CKLA 1N87A 2LXHC 4LADB 4OGEA 2L43A 4A4BA 2XOZA 4UP0A 2LGGA 3SOXA 4A49A 5H1VA 1WEPA 5H9MA 4GNDA 2CSZA 3FAOA 2EODA 1HYJA 4WZ0A 2LDRA 1WEOA 2VPGA 2E6RA 4N4FA 3KDEC 5LKTA 3FM8C 4WZ2A 2Y43A 4YAXA 4YADA 2JM3A 2HDPA 3RPGB 5KH3A 3M63A 2CONA 2YHNA 4BBQA 4QF3A 2VPBA 1X4UA 2CKLB 2VJFA 2VNFA 2G6QA 3DDTA 2G43A 4ZQLA 1IYMA 1WIMA 4X3GA 2LAUA 1FBVA 2QJ0A 4N3WA 4BHWA 2RR4A 2D8UA 2K16A 3C5KA 2MKEA 2MNZA 4B86C 2CT2A 4S3OB 4QQ4A 1WEWA 2YHOA 3MHHA 2OWAA 5SVYA 4Z0OA 2ZETC 4LKAA 2K17A 2LGLA 2F42A 5J3XA 4CA1A 3PURA 2YQLA 1BORA 3HCUA 5B76A 4LJNA 5KH7A 2MIQA 2F6NA 4Z0RA 2CSYA 2P57A 2VPEA 3KV5A 3KNVA 4I7DA 2VJFB 1WEQA 4I7CA 3O35A 1HYIA 3DPLR 3LVRE 5JG6A 2KWKA 4QF2A 4R2YA 3LRQA 4FO9A 3ZPV1 2M13A 2YT5A 2ECJA 4YATA 5EYAF 3O7AA 1JM7A 5I3LA 1LDKC 3L1XA 4GNEA 4IC3A 4R8PK 4XI1A 2MD8C 2YSJA 5FERA 3T7LA 5G04B 4LLBA
chains in the Genus database with same CATH topology
2C2LA 5C13A 3KQIA 2JMDA 4A0CD 2XEUA 1U6GB 3QZVA 1LDJB 1RMDA 5C11A 5FB1A 3LQIA 4PTBA 2KWNA 4F52B 2VPDA 1K2FA 2YQMA 5H1TA 2BAYA 4MVTA 2DX8A 5LKUA 3RTRB 3N9QA 1WILA 1WEUA 2LQ6A 2RSDA 2PUYA 4YBTA 1CHCA 4I7BA 4FK5A 4FIPA 5LKZA 3PHDA 3ASLA 3ZVZB 1XWHA 4Q6FA 1JM7B 1JOCA 3SOUA 2M6MA 2FSAA 2OXQC 2RI7A 4AP4A 1WESA 2L5UA 2LXPC 2ECIA 4C9ZA 3L11A 5B79A 4PPEA 4UI9B 2VP7A 2YYRA 3V43A 2I50A 3ZTGA 2F6JA 3ZPVE 1VD4A 5B77A 3MHSA 2KGGA 4FJCA 4AYCA 4YBSA 2E6SA 2JRJA 2L0BA 3O37A 2Y1MA 5FB0A 4L7XA 3KV6A 4WZ3B 3U5PA 3GL6A 3HCSA 2FUIA 4S3OC 3DQVR 3SHBA 4AUQB 4MSXA 5TBNA 3N9PA 3T6RA 5TDWA 2HYED 3N9LA 2MA5A 3PUQA 1T1HA 4L58A 2AN6A 3GV4A 5D1MB 2UZGA 2VJEA 2M85A 5D1LB 4AYCB 4ZUXU 1Z6UA 5DINA 1MM3A 3N9MA 2MA6A 1WEVA 3HTKC 2H0DA 2KFTA 2KE1A 2M1RA 2ECTA 2L80A 3N9NA 1WENA 3NG2A 3FL2A 1ZBDB 5G05B 3M99A 4GNGA 1G25A 4LK9A 1X4IA 5H1UA 3LQHA 2G45A 4P5OB 3ZVYA 2IDAA 3O33A 2VJEB 2KU3A 3ZYQA 4CCGX 5TDRA 5D1KB 2K1JA 1E4UA 3O34A 1Z60A 3SOWA 2D8SA 2K4DA 4O64A 5FEYA 5B8DA 3M62A 3L1ZB 2KWOA 2Y1NA 2NAAA 1WEEA 2H0DB 2YU4A 1V87A 3U5OA 3O36A 1VYXA 3EB6A 5TABA 1X4JA 3RPGC 2KIZA 1VFYA 2YW8A 4V3KC 2YREA 4YABA 5B75A 4GNFA 2EA6A 1WGMA 2KREA 4WA6A 2KGIA 2QIZA 4YBMA 4ZDTA 2KR4A 2LN0A 2C2VS 2ECVA 5KH9A 3IHPA 2XB1A 1DVPA 5LCWB 3HCTA 5TRBA 3U5NA 4GB0A 4R7EA 2KYUA 1F62A 2YURA 4AVXA 3ZNIA 4B7YC 3I2DA 2YSMA 5DKAA 1FP0A 4UP5A 3EB5A 2ECWA 4IC2A 1Z2QA 2ECNA 4YC9A 2LGKA 2EGPA 2MUMA 2LRIC 2MT5A 1MM2A 2LV9A 5AIUA 2M3HA 5LKXA 3LQJA 5B78A 5G0FA 3U5MA 2JMIA 3VK6A 4V3LC 3N9OA 5AITA 2KWJA 1WE9A 2FUUA 2JMJA 2LGVA 4NN2A 2ECGA 4A4CA 2YUCA 4W4UA 2MD7B 1WFKA 2QICA 2L75A 2PNXA 2MNYA 3O70A 1WEMA 3C6WA 4TKPB 2CKLA 1N87A 2LXHC 4LADB 2L43A 4A4BA 4UP0A 2LGGA 3SOXA 4A49A 5H1VA 1WEPA 5H9MA 4GNDA 2CSZA 2EODA 1HYJA 4WZ0A 2LDRA 1WEOA 2VPGA 2E6RA 4N4FA 5LKTA 4WZ2A 2Y43A 4YAXA 4YADA 2HDPA 3RPGB 5KH3A 3M63A 2YHNA 4BBQA 4QF3A 2VPBA 1X4UA 2CKLB 2VJFA 2VNFA 2G6QA 2G43A 4ZQLA 1IYMA 1WIMA 4X3GA 1FBVA 2QJ0A 4N3WA 4BHWA 2K16A 3C5KA 2MNZA 4B86C 2CT2A 4S3OB 1WEWA 2YHOA 3MHHA 2ZETC 4LKAA 2K17A 2LGLA 2F42A 5J3XA 4CA1A 3PURA 2YQLA 1BORA 3HCUA 5B76A 4LJNA 5KH7A 2MIQA 2F6NA 2CSYA 2VPEA 3KV5A 3KNVA 4I7DA 2VJFB 1WEQA 4I7CA 3O35A 1HYIA 3DPLR 5JG6A 2KWKA 4QF2A 4R2YA 3LRQA 4FO9A 3ZPV1 2YT5A 2ECJA 4YATA 5EYAF 3O7AA 1JM7A 5I3LA 1LDKC 3L1XA 4GNEA 4IC3A 4R8PK 4XI1A 2MD8C 2YSJA 5FERA 3T7LA 5G04B 4LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  5C13 A;  3KQI A;  2JMD A;  4A0C D;  2XEU A;  1U6G B;  3QZV A;  1LDJ B;  1RMD A;  5C11 A;  5FB1 A;  3LQI A;  4PTB A;  2KWN A;  4F52 B;  2VPD A;  1K2F A;  2YQM A;  5H1T A;  2BAY A;  4MVT A;  2DX8 A;  5LKU A;  3RTR B;  3N9Q A;  1WIL A;  1WEU A;  2LQ6 A;  2RSD A;  2PUY A;  4YBT A;  1CHC A;  4I7B A;  4FK5 A;  4FIP A;  5LKZ A;  3PHD A;  3ASL A;  3ZVZ B;  1XWH A;  4Q6F A;  1JM7 B;  1JOC A;  3SOU A;  2M6M A;  2FSA A;  2OXQ C;  2RI7 A;  4AP4 A;  1WES A;  2L5U A;  2LXP C;  2ECI A;  4C9Z A;  3L11 A;  5B79 A;  4PPE A;  4UI9 B;  2VP7 A;  2YYR A;  3V43 A;  2I50 A;  3ZTG A;  2F6J A;  3ZPV E;  1VD4 A;  5B77 A;  3MHS A;  2KGG A;  4FJC A;  4AYC A;  4YBS A;  2E6S A;  2JRJ A;  2L0B A;  3O37 A;  2Y1M A;  5FB0 A;  4L7X A;  3KV6 A;  4WZ3 B;  3U5P A;  3GL6 A;  3HCS A;  2FUI A;  4S3O C;  3DQV R;  3SHB A;  4AUQ B;  4MSX A;  5TBN A;  3N9P A;  3T6R A;  5TDW A;  2HYE D;  3N9L A;  2MA5 A;  3PUQ A;  1T1H A;  4L58 A;  2AN6 A;  3GV4 A;  5D1M B;  2UZG A;  2VJE A;  2M85 A;  5D1L B;  4AYC B;  4ZUX U;  1Z6U A;  5DIN A;  1MM3 A;  3N9M A;  2MA6 A;  1WEV A;  3HTK C;  2H0D A;  2KFT A;  2KE1 A;  2M1R A;  2ECT A;  2L80 A;  3N9N A;  1WEN A;  3NG2 A;  3FL2 A;  1ZBD B;  5G05 B;  3M99 A;  4GNG A;  1G25 A;  4LK9 A;  1X4I A;  5H1U A;  3LQH A;  2G45 A;  4P5O B;  3ZVY A;  2IDA A;  3O33 A;  2VJE B;  2KU3 A;  3ZYQ A;  4CCG X;  5TDR A;  5D1K B;  2K1J A;  1E4U A;  3O34 A;  1Z60 A;  3SOW A;  2D8S A;  2K4D A;  4O64 A;  5FEY A;  5B8D A;  3M62 A;  3L1Z B;  2KWO A;  2Y1N A;  2NAA A;  1WEE A;  2H0D B;  2YU4 A;  1V87 A;  3U5O A;  3O36 A;  1VYX A;  3EB6 A;  5TAB A;  1X4J A;  3RPG C;  2KIZ A;  1VFY A;  2YW8 A;  4V3K C;  2YRE A;  4YAB A;  5B75 A;  4GNF A;  2EA6 A;  1WGM A;  2KRE A;  4WA6 A;  2KGI A;  2QIZ A;  4YBM A;  4ZDT A;  2KR4 A;  2LN0 A;  2C2V S;  2ECV A;  5KH9 A;  3IHP A;  2XB1 A;  1DVP A;  5LCW B;  3HCT A;  5TRB A;  3U5N A;  4GB0 A;  4R7E A;  2KYU A;  1F62 A;  2YUR A;  4AVX A;  3ZNI A;  4B7Y C;  3I2D A;  2YSM A;  5DKA A;  1FP0 A;  4UP5 A;  3EB5 A;  2ECW A;  4IC2 A;  1Z2Q A;  2ECN A;  4YC9 A;  2LGK A;  2EGP A;  2MUM A;  2LRI C;  2MT5 A;  1MM2 A;  2LV9 A;  5AIU A;  2M3H A;  5LKX A;  3LQJ A;  5B78 A;  5G0F A;  3U5M A;  2JMI A;  3VK6 A;  4V3L C;  3N9O A;  5AIT A;  2KWJ A;  1WE9 A;  2FUU A;  2JMJ A;  2LGV A;  4NN2 A;  2ECG A;  4A4C A;  2YUC A;  4W4U A;  2MD7 B;  1WFK A;  2QIC A;  2L75 A;  2PNX A;  2MNY A;  3O70 A;  1WEM A;  3C6W A;  4TKP B;  2CKL A;  1N87 A;  2LXH C;  4LAD B;  2L43 A;  4A4B A;  4UP0 A;  2LGG A;  3SOX A;  4A49 A;  5H1V A;  1WEP A;  5H9M A;  4GND A;  2CSZ A;  2EOD A;  1HYJ A;  4WZ0 A;  2LDR A;  1WEO A;  2VPG A;  2E6R A;  4N4F A;  5LKT A;  4WZ2 A;  2Y43 A;  4YAX A;  4YAD A;  2HDP A;  3RPG B;  5KH3 A;  3M63 A;  2YHN A;  4BBQ A;  4QF3 A;  2VPB A;  1X4U A;  2CKL B;  2VJF A;  2VNF A;  2G6Q A;  2G43 A;  4ZQL A;  1IYM A;  1WIM A;  4X3G A;  1FBV A;  2QJ0 A;  4N3W A;  4BHW A;  2K16 A;  3C5K A;  2MNZ A;  4B86 C;  2CT2 A;  4S3O B;  1WEW A;  2YHO A;  3MHH A;  2ZET C;  4LKA A;  2K17 A;  2LGL A;  2F42 A;  5J3X A;  4CA1 A;  3PUR A;  2YQL A;  1BOR A;  3HCU A;  5B76 A;  4LJN A;  5KH7 A;  2MIQ A;  2F6N A;  2CSY A;  2VPE A;  3KV5 A;  3KNV A;  4I7D A;  2VJF B;  1WEQ A;  4I7C A;  3O35 A;  1HYI A;  3DPL R;  5JG6 A;  2KWK A;  4QF2 A;  4R2Y A;  3LRQ A;  4FO9 A;  3ZPV 1;  2YT5 A;  2ECJ A;  4YAT A;  5EYA F;  3O7A A;  1JM7 A;  5I3L A;  1LDK C;  3L1X A;  4GNE A;  4IC3 A;  4R8P K;  4XI1 A;  2MD8 C;  2YSJ A;  5FER A;  3T7L A;  5G04 B;  4LLB A; 
#chains in the Genus database with same CATH topology
 2C2L A;  5C13 A;  3M7K A;  3KQI A;  2JMD A;  4A0C D;  2XEU A;  1U6G B;  3QZV A;  1LDJ B;  1RMD A;  5C11 A;  2B0O E;  5FB1 A;  2YVR A;  3LQI A;  4PTB A;  2KWN A;  3FEH A;  4F52 B;  2VPD A;  4F1P A;  3PLW A;  1K2F A;  2YQM A;  3T9K A;  5H1T A;  2BAY A;  4MVT A;  2DX8 A;  5LKU A;  3RTR B;  3N9Q A;  1WIL A;  1WEU A;  2LQ6 A;  2RSD A;  2PUY A;  4YBT A;  1CHC A;  4I7B A;  4FK5 A;  4FIP A;  5LKZ A;  3PHD A;  3ASL A;  3ZVZ B;  1XWH A;  4Q6F A;  1JM7 B;  1JOC A;  3SOU A;  2RI7 A;  2M6M A;  2FSA A;  2JUN A;  2OXQ C;  4AP4 A;  1WES A;  2L5U A;  2LXP C;  2ECI A;  4C9Z A;  3L11 A;  5B79 A;  4PPE A;  2FD4 A;  4UI9 B;  2VP7 A;  2YYR A;  3V43 A;  2XOY A;  2I50 A;  3MDB C;  3ZTG A;  2F6J A;  3ZPV E;  1VD4 A;  5B77 A;  3MHS A;  2KGG A;  4FJC A;  4AYC A;  3FJU B;  4YBS A;  4H9D A;  2E6S A;  2JRJ A;  2L0B A;  3O37 A;  2Y1M A;  5FB0 A;  4L7X A;  3KV6 A;  4WZ3 B;  3U5P A;  3GL6 A;  3HCS A;  2FUI A;  2KKY A;  4S3O C;  3DQV R;  3SHB A;  4AUQ B;  2L7P A;  4MSX A;  5TBN A;  3N9P A;  3Q1D A;  3T6R A;  2XP0 A;  3LJU X;  5TDW A;  2HYE D;  3N9L A;  2MA5 A;  5SVI A;  3PUQ A;  1T1H A;  4L58 A;  2AN6 A;  3SUB A;  3GV4 A;  5D1M B;  2UZG A;  2VJE A;  2M85 A;  5D1L B;  4AYC B;  4ZUX U;  1Z6U A;  5DIN A;  1MM3 A;  3N9M A;  2MA6 A;  1WEV A;  3HTK C;  2H0D A;  2KFT A;  1MBM A;  2KE1 A;  2EGM A;  2M1R A;  2ECT A;  2DSM A;  2L80 A;  3N9N A;  1WEN A;  3NG2 A;  2KKX A;  3FL2 A;  1ZBD B;  5G05 B;  3M99 A;  4GNG A;  1G25 A;  4LK9 A;  1X4I A;  5H1U A;  3LQH A;  2G45 A;  4P5O B;  3ZVY A;  5SVI B;  2DJA A;  2IDA A;  3O33 A;  1DCQ A;  2VJE B;  3JUE A;  2KU3 A;  3ZYQ A;  4CCG X;  5TDR A;  5D1K B;  2K1J A;  1E4U A;  3O34 A;  1Z60 A;  3SOW A;  2D8S A;  2K4D A;  4O64 A;  5FEY A;  5B8D A;  5SVX A;  3M62 A;  3L1Z B;  2KWO A;  2Y1N A;  2NAA A;  1WEE A;  2H0D B;  2YU4 A;  2E61 A;  1V87 A;  3U5O A;  3O36 A;  1VYX A;  3EB6 A;  3FAN A;  5TAB A;  1X4J A;  3RPG C;  2KIZ A;  1VFY A;  2YW8 A;  2FFW A;  4V3K C;  2YRE A;  4YAB A;  5B75 A;  4GNF A;  2EA6 A;  1WGM A;  2KRE A;  4WA6 A;  2KGI A;  2QIZ A;  4YBM A;  3O47 A;  4ZDT A;  2KR4 A;  2LN0 A;  2C2V S;  2ECV A;  2IQJ A;  5KH9 A;  3IHP A;  2XB1 A;  1DVP A;  3H7H A;  5LCW B;  3HCT A;  5TRB A;  2CRW A;  3U5N A;  4GB0 A;  4R7E A;  2KYU A;  2CRR A;  1F62 A;  2YUR A;  4AVX A;  3ZNI A;  4B7Y C;  3I2D A;  2YSM A;  5DKA A;  1FP0 A;  4UP5 A;  3EB5 A;  2ECW A;  3LVQ E;  4IC2 A;  3E2D A;  1Z2Q A;  2ECN A;  4YC9 A;  2LGK A;  2EGP A;  2MUM A;  2MT5 A;  2LRI C;  1MM2 A;  2LV9 A;  5AIU A;  2M3H A;  5LKX A;  2CSV A;  3LQJ A;  5B78 A;  5G0F A;  3DWD A;  5K3Q A;  3U5M A;  4OGC A;  2JMI A;  2EXU A;  3VK6 A;  4O62 A;  4V3L C;  3N9O A;  5AIT A;  2KWJ A;  1WE9 A;  2FUU A;  2JMJ A;  2LGV A;  4NN2 A;  2ECG A;  4A4C A;  2YUC A;  2XOC A;  4W4U A;  2MD7 B;  1WFK A;  2QIC A;  2L75 A;  2PNX A;  2MNY A;  3O70 A;  3LDY A;  1WEM A;  3C6W A;  4TKP B;  2CKL A;  1N87 A;  2LXH C;  4LAD B;  4OGE A;  2L43 A;  4A4B A;  2XOZ A;  4UP0 A;  2LGG A;  3SOX A;  4A49 A;  5H1V A;  1WEP A;  5H9M A;  4GND A;  2CSZ A;  3FAO A;  2EOD A;  1HYJ A;  4WZ0 A;  2LDR A;  1WEO A;  2VPG A;  2E6R A;  4N4F A;  3KDE C;  5LKT A;  3FM8 C;  4WZ2 A;  2Y43 A;  4YAX A;  4YAD A;  2JM3 A;  2HDP A;  3RPG B;  5KH3 A;  3M63 A;  2CON A;  2YHN A;  4BBQ A;  4QF3 A;  2VPB A;  1X4U A;  2CKL B;  2VJF A;  2VNF A;  2G6Q A;  3DDT A;  2G43 A;  4ZQL A;  1IYM A;  1WIM A;  4X3G A;  2LAU A;  1FBV A;  2QJ0 A;  4N3W A;  4BHW A;  2RR4 A;  2D8U A;  2K16 A;  3C5K A;  2MKE A;  2MNZ A;  4B86 C;  2CT2 A;  4S3O B;  4QQ4 A;  1WEW A;  2YHO A;  3MHH A;  2OWA A;  5SVY A;  4Z0O A;  2ZET C;  4LKA A;  2K17 A;  2LGL A;  2F42 A;  5J3X A;  4CA1 A;  3PUR A;  2YQL A;  1BOR A;  3HCU A;  5B76 A;  4LJN A;  5KH7 A;  2MIQ A;  2F6N A;  4Z0R A;  2CSY A;  2P57 A;  2VPE A;  3KV5 A;  3KNV A;  4I7D A;  2VJF B;  1WEQ A;  4I7C A;  3O35 A;  1HYI A;  3DPL R;  3LVR E;  5JG6 A;  2KWK A;  4QF2 A;  4R2Y A;  3LRQ A;  4FO9 A;  3ZPV 1;  2M13 A;  2YT5 A;  2ECJ A;  4YAT A;  5EYA F;  3O7A A;  1JM7 A;  5I3L A;  1LDK C;  3L1X A;  4GNE A;  4IC3 A;  4R8P K;  4XI1 A;  2MD8 C;  2YSJ A;  5FER A;  3T7L A;  5G04 B;  4LLB A; 
#chains in the Genus database with same CATH homology
 2C2L A;  5C13 A;  3KQI A;  2JMD A;  4A0C D;  2XEU A;  1U6G B;  3QZV A;  1LDJ B;  1RMD A;  5C11 A;  5FB1 A;  3LQI A;  4PTB A;  2KWN A;  4F52 B;  2VPD A;  1K2F A;  2YQM A;  5H1T A;  2BAY A;  4MVT A;  2DX8 A;  5LKU A;  3RTR B;  3N9Q A;  1WIL A;  1WEU A;  2LQ6 A;  2RSD A;  2PUY A;  4YBT A;  1CHC A;  4I7B A;  4FK5 A;  4FIP A;  5LKZ A;  3PHD A;  3ASL A;  3ZVZ B;  1XWH A;  4Q6F A;  1JM7 B;  1JOC A;  3SOU A;  2M6M A;  2FSA A;  2OXQ C;  2RI7 A;  4AP4 A;  1WES A;  2L5U A;  2LXP C;  2ECI A;  4C9Z A;  3L11 A;  5B79 A;  4PPE A;  4UI9 B;  2VP7 A;  2YYR A;  3V43 A;  2I50 A;  3ZTG A;  2F6J A;  3ZPV E;  1VD4 A;  5B77 A;  3MHS A;  2KGG A;  4FJC A;  4AYC A;  4YBS A;  2E6S A;  2JRJ A;  2L0B A;  3O37 A;  2Y1M A;  5FB0 A;  4L7X A;  3KV6 A;  4WZ3 B;  3U5P A;  3GL6 A;  3HCS A;  2FUI A;  4S3O C;  3DQV R;  3SHB A;  4AUQ B;  4MSX A;  5TBN A;  3N9P A;  3T6R A;  5TDW A;  2HYE D;  3N9L A;  2MA5 A;  3PUQ A;  1T1H A;  4L58 A;  2AN6 A;  3GV4 A;  5D1M B;  2UZG A;  2VJE A;  2M85 A;  5D1L B;  4AYC B;  4ZUX U;  1Z6U A;  5DIN A;  1MM3 A;  3N9M A;  2MA6 A;  1WEV A;  3HTK C;  2H0D A;  2KFT A;  2KE1 A;  2M1R A;  2ECT A;  2L80 A;  3N9N A;  1WEN A;  3NG2 A;  3FL2 A;  1ZBD B;  5G05 B;  3M99 A;  4GNG A;  1G25 A;  4LK9 A;  1X4I A;  5H1U A;  3LQH A;  2G45 A;  4P5O B;  3ZVY A;  2IDA A;  3O33 A;  2VJE B;  2KU3 A;  3ZYQ A;  4CCG X;  5TDR A;  5D1K B;  2K1J A;  1E4U A;  3O34 A;  1Z60 A;  3SOW A;  2D8S A;  2K4D A;  4O64 A;  5FEY A;  5B8D A;  3M62 A;  3L1Z B;  2KWO A;  2Y1N A;  2NAA A;  1WEE A;  2H0D B;  2YU4 A;  1V87 A;  3U5O A;  3O36 A;  1VYX A;  3EB6 A;  5TAB A;  1X4J A;  3RPG C;  2KIZ A;  1VFY A;  2YW8 A;  4V3K C;  2YRE A;  4YAB A;  5B75 A;  4GNF A;  2EA6 A;  1WGM A;  2KRE A;  4WA6 A;  2KGI A;  2QIZ A;  4YBM A;  4ZDT A;  2KR4 A;  2LN0 A;  2C2V S;  2ECV A;  5KH9 A;  3IHP A;  2XB1 A;  1DVP A;  5LCW B;  3HCT A;  5TRB A;  3U5N A;  4GB0 A;  4R7E A;  2KYU A;  1F62 A;  2YUR A;  4AVX A;  3ZNI A;  4B7Y C;  3I2D A;  2YSM A;  5DKA A;  1FP0 A;  4UP5 A;  3EB5 A;  2ECW A;  4IC2 A;  1Z2Q A;  2ECN A;  4YC9 A;  2LGK A;  2EGP A;  2MUM A;  2LRI C;  2MT5 A;  1MM2 A;  2LV9 A;  5AIU A;  2M3H A;  5LKX A;  3LQJ A;  5B78 A;  5G0F A;  3U5M A;  2JMI A;  3VK6 A;  4V3L C;  3N9O A;  5AIT A;  2KWJ A;  1WE9 A;  2FUU A;  2JMJ A;  2LGV A;  4NN2 A;  2ECG A;  4A4C A;  2YUC A;  4W4U A;  2MD7 B;  1WFK A;  2QIC A;  2L75 A;  2PNX A;  2MNY A;  3O70 A;  1WEM A;  3C6W A;  4TKP B;  2CKL A;  1N87 A;  2LXH C;  4LAD B;  2L43 A;  4A4B A;  4UP0 A;  2LGG A;  3SOX A;  4A49 A;  5H1V A;  1WEP A;  5H9M A;  4GND A;  2CSZ A;  2EOD A;  1HYJ A;  4WZ0 A;  2LDR A;  1WEO A;  2VPG A;  2E6R A;  4N4F A;  5LKT A;  4WZ2 A;  2Y43 A;  4YAX A;  4YAD A;  2HDP A;  3RPG B;  5KH3 A;  3M63 A;  2YHN A;  4BBQ A;  4QF3 A;  2VPB A;  1X4U A;  2CKL B;  2VJF A;  2VNF A;  2G6Q A;  2G43 A;  4ZQL A;  1IYM A;  1WIM A;  4X3G A;  1FBV A;  2QJ0 A;  4N3W A;  4BHW A;  2K16 A;  3C5K A;  2MNZ A;  4B86 C;  2CT2 A;  4S3O B;  1WEW A;  2YHO A;  3MHH A;  2ZET C;  4LKA A;  2K17 A;  2LGL A;  2F42 A;  5J3X A;  4CA1 A;  3PUR A;  2YQL A;  1BOR A;  3HCU A;  5B76 A;  4LJN A;  5KH7 A;  2MIQ A;  2F6N A;  2CSY A;  2VPE A;  3KV5 A;  3KNV A;  4I7D A;  2VJF B;  1WEQ A;  4I7C A;  3O35 A;  1HYI A;  3DPL R;  5JG6 A;  2KWK A;  4QF2 A;  4R2Y A;  3LRQ A;  4FO9 A;  3ZPV 1;  2YT5 A;  2ECJ A;  4YAT A;  5EYA F;  3O7A A;  1JM7 A;  5I3L A;  1LDK C;  3L1X A;  4GNE A;  4IC3 A;  4R8P K;  4XI1 A;  2MD8 C;  2YSJ A;  5FER A;  3T7L A;  5G04 B;  4LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...