3ZTGA

Solution structure of the ring finger-like domain of retinoblastoma binding protein-6 (rbbp6)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'GPLGSEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RBBP6
publication title Solution Structure of the Ring Finger-Like Domain of Retinoblastoma Binding Protein-6 (Rbbp6) Suggests It Functions as a U-Box
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3ztgA00
1BORA 4N4FA 5H1UA 3C6WA 2MD8C 4L7XA 2HDPA 5TRBA 1WEVA 3PURA 2F6JA 1WFKA 3GL6A 1VD4A 2KU3A 3SOXA 3V43A 3M99A 5LKTA 2MT5A 5C13A 1WEMA 5LKUA 4QF2A 1Z6UA 2KWOA 5EYAF 2C2LA 2L0BA 2E6RA 5B79A 2VPDA 2ECWA 2LN0A 2C2VS 2AN6A 2KWJA 2I50A 2LDRA 5FB0A 4I7DA 4F52B 3L1ZB 2NAAA 3KQIA 2VJFB 4LLBA 2ECGA 3DQVR 4QF3A 2CKLA 2LV9A 2L43A 4WZ2A 2E6SA 2EODA 4I7CA 2YW8A 2PNXA 2K1JA 5KH9A 2MNYA 2M6MA 2EGPA 3C5KA 2L5UA 5B76A 2Y1NA 2LGGA 1ZBDB 2VJEA 2YSJA 2YURA 3IHPA 3KV6A 5I3LA 2MA5A 4ZDTA 2ECIA 2KGGA 5B75A 4FIPA 5AIUA 2F6NA 2JMIA 3U5OA 3SOUA 2LGLA 2YQMA 3SHBA 3U5MA 3KV5A 3PUQA 2K17A 4FO9A 2LGKA 2KE1A 2QIZA 5B78A 2MUMA 2CT2A 3T7LA 3RTRB 1HYJA 2YQLA 4I7BA 3I2DA 1DVPA 2MD7B 4R8PK 1WGMA 2CSYA 3O37A 2MA6A 4CA1A 4MSXA 4S3OC 4L58A 2L80A 2H0DB 4R7EA 1WE9A 3SOWA 3L11A 5H1VA 4LK9A 1N87A 2PUYA 2ZETC 1LDJB 1WEOA 4A4BA 1WESA 3U5NA 5LCWB 2CSZA 5G04B 4YAXA 3QZVA 4BBQA 4AYCA 4GNDA 1F62A 4PTBA 5TDRA 4W4UA 3ZNIA 5LKZA 1WIMA 2KYUA 1RMDA 4AP4A 2KFTA 3N9QA 4IC2A 3DPLR 4LJNA 2QICA 1MM3A 2XEUA 1VFYA 1FP0A 2G43A 5JG6A 1U6GB 4LADB 1X4JA 3M63A 2KWNA 4A4CA 2M85A 4ZUXU 3N9LA 1K2FA 3GV4A 3MHHA 3ZPV1 3ASLA 2QJ0A 5C11A 2VPGA 1WILA 2H0DA 4P5OB 5H9MA 3LQHA 2K4DA 4WZ0A 2KGIA 2ECJA 5B77A 3LRQA 2VPEA 2YHNA 3MHSA 2MIQA 3N9MA 3RPGB 4YADA 4R2YA 5DKAA 2ECNA 2MNZA 2YHOA 2HYED 1T1HA 4WA6A 2YREA 5D1LB 4YC9A 4WZ3B 3T6RA 1X4UA 4Q6FA 5G0FA 2KREA 3ZPVE 2IDAA 1JM7B 1WEUA 4MVTA 2FUIA 4YBTA 4UP0A 1Z60A 5KH3A 3VK6A 3HCSA 2VJFA 5H1TA 2G6QA 2LQ6A 4BHWA 1WEPA 3ZVYA 3LQJA 5G05B 1IYMA 2VP7A 4GNEA 4NN2A 4UP5A 1VYXA 1G25A 1LDKC 2Y1MA 2G45A 4V3LC 2YYRA 2ECTA 4FJCA 3FL2A 2M3HA 4PPEA 2RSDA 1WENA 3U5PA 1HYIA 3NG2A 3O35A 2BAYA 2K16A 2YU4A 2YUCA 2XB1A 4FK5A 5J3XA 4XI1A 1FBVA 4B86C 5KH7A 3O33A 4LKAA 1XWHA 2LXPC 2KIZA 3RPGC 2ECVA 3ZVZB 4YABA 4YBSA 5AITA 1CHCA 3N9PA 3N9OA 2YSMA 2VNFA 2D8SA 5TBNA 5D1KB 5B8DA 2M1RA 5FEYA 4AUQB 1E4UA 1JOCA 3O34A 3M62A 1JM7A 4IC3A 4S3OB 2FSAA 2KR4A 2OXQC 4GNGA 3L1XA 5FB1A 4GB0A 3HCUA 2JMDA 2RI7A 4ZQLA 2JMJA 3ZTGA 1V87A 2LGVA 2UZGA 1WEWA 5D1MB 4CCGX 4AVXA 4O64A 4V3KC 2Y43A 3O70A 4A0CD 4AYCB 3HTKC 2DX8A 4GNFA 4UI9B 3EB6A 2KWKA 3O36A 1X4IA 2EA6A 2LRIC 2JRJA 3PHDA 3HCTA 2L75A 5TABA 5TDWA 5LKXA 2VPBA 1WEQA 2CKLB 4YATA 2YT5A 4X3GA 4YBMA 4TKPB 2LXHC 3EB5A 1WEEA 3N9NA 1Z2QA 5FERA 4N3WA 4B7YC 4C9ZA 5DINA 3LQIA 2FUUA 2VJEB 4A49A 3ZYQA 1MM2A 3O7AA 3KNVA 2F42A
chains in the Genus database with same CATH superfamily
1BORA 4N4FA 5H1UA 3C6WA 2MD8C 4L7XA 2HDPA 5TRBA 1WEVA 3PURA 2F6JA 2XP0A 1WFKA 3GL6A 1VD4A 2KU3A 4QQ4A 3SOXA 3V43A 3M99A 5LKTA 2MT5A 5C13A 1WEMA 5LKUA 4QF2A 1Z6UA 2KWOA 5EYAF 2KKYA 2C2LA 2L0BA 2E6RA 5B79A 2VPDA 2ECWA 2LN0A 2C2VS 2AN6A 2KWJA 2I50A 2LDRA 2RR4A 5FB0A 4I7DA 4F52B 3L1ZB 2NAAA 2KKXA 3KQIA 2VJFB 4LLBA 2ECGA 3DQVR 4QF3A 2CKLA 2LV9A 2L43A 3PLWA 4WZ2A 2E6SA 2EODA 4I7CA 2YW8A 2PNXA 2CONA 2K1JA 3LVRE 5KH9A 2MNYA 2M6MA 2EGPA 3C5KA 2L5UA 5B76A 2Y1NA 2LGGA 1ZBDB 5SVXA 2VJEA 2YSJA 2JM3A 2YURA 3IHPA 3KV6A 5I3LA 2MA5A 4ZDTA 2B0OE 2ECIA 2KGGA 2L7PA 5B75A 3H7HA 4FIPA 5AIUA 2F6NA 2JMIA 3U5OA 3SOUA 2LGLA 2YQMA 3SHBA 3U5MA 2XOCA 3KV5A 3PUQA 2K17A 4FO9A 2LGKA 2KE1A 2QIZA 5B78A 3FJUB 2MUMA 2CT2A 3T7LA 3RTRB 1HYJA 2YQLA 4I7BA 4H9DA 2DSMA 3I2DA 1DVPA 2MD7B 2MKEA 2EXUA 4R8PK 1WGMA 2CSYA 3O37A 2MA6A 4CA1A 4MSXA 4S3OC 4L58A 2L80A 2H0DB 4R7EA 1WE9A 3SOWA 3L11A 5H1VA 4LK9A 1N87A 2PUYA 2ZETC 1LDJB 1WEOA 3LJUX 4A4BA 1WESA 3U5NA 1MBMA 5LCWB 2CSVA 2CSZA 3FAOA 3DDTA 5G04B 4YAXA 3QZVA 3LVQE 4BBQA 4AYCA 4GNDA 1F62A 4PTBA 5TDRA 4W4UA 3ZNIA 5LKZA 1WIMA 2KYUA 2FFWA 1RMDA 4AP4A 2KFTA 3N9QA 3T9KA 2CRRA 4IC2A 3DPLR 2YVRA 4LJNA 3SUBA 2QICA 1MM3A 2XEUA 1VFYA 1FP0A 2G43A 5JG6A 1U6GB 4LADB 1X4JA 3M63A 2KWNA 4A4CA 2M85A 4ZUXU 5SVIB 3N9LA 1K2FA 3GV4A 3MHHA 3ZPV1 3ASLA 2QJ0A 5C11A 2VPGA 2P57A 1WILA 2H0DA 4P5OB 5H9MA 2EGMA 3LQHA 2K4DA 4WZ0A 2KGIA 2ECJA 5B77A 3LRQA 2VPEA 2YHNA 2E61A 3MHSA 2MIQA 3N9MA 3RPGB 4YADA 3LDYA 4R2YA 5DKAA 2ECNA 2MNZA 2YHOA 2HYED 1T1HA 4WA6A 2YREA 5D1LB 4YC9A 3FM8C 4WZ3B 3Q1DA 3T6RA 1X4UA 4Q6FA 5G0FA 3FANA 2KREA 3ZPVE 2IDAA 2XOYA 1JM7B 3DWDA 1WEUA 4MVTA 2FUIA 3O47A 4YBTA 4UP0A 1Z60A 5KH3A 3VK6A 3FEHA 2LAUA 2VJFA 3HCSA 5H1TA 2G6QA 2LQ6A 4BHWA 1WEPA 3ZVYA 5K3QA 3LQJA 3M7KA 2JUNA 5G05B 1IYMA 3KDEC 2VP7A 4GNEA 4NN2A 4UP5A 1VYXA 1G25A 1LDKC 5SVIA 2Y1MA 2G45A 3MDBC 2D8UA 4V3LC 2YYRA 2ECTA 4FJCA 3FL2A 2M3HA 4PPEA 2RSDA 2FD4A 1WENA 3U5PA 1HYIA 2XOZA 3NG2A 3O35A 2BAYA 2K16A 2YU4A 4O62A 2YUCA 2XB1A 4FK5A 5J3XA 4XI1A 1FBVA 4B86C 5KH7A 3O33A 4LKAA 1XWHA 2LXPC 2KIZA 3RPGC 2ECVA 3ZVZB 4YABA 4YBSA 5AITA 1CHCA 1DCQA 3N9PA 3N9OA 2YSMA 2VNFA 2D8SA 5TBNA 5D1KB 5B8DA 2M1RA 5FEYA 4AUQB 1E4UA 1JOCA 4OGCA 3O34A 3M62A 1JM7A 4IC3A 4S3OB 2FSAA 2DJAA 2KR4A 2OXQC 4Z0OA 4GNGA 3L1XA 5FB1A 4GB0A 3HCUA 2JMDA 2RI7A 4ZQLA 2JMJA 3ZTGA 1V87A 2LGVA 2CRWA 2UZGA 1WEWA 5D1MB 4CCGX 4AVXA 4O64A 4V3KC 2Y43A 3O70A 4A0CD 4AYCB 3HTKC 3E2DA 2DX8A 4GNFA 4UI9B 2OWAA 3EB6A 2KWKA 3O36A 2IQJA 4OGEA 1X4IA 2EA6A 2LRIC 2JRJA 3PHDA 3HCTA 2M13A 2L75A 4F1PA 5TABA 5TDWA 5LKXA 2VPBA 1WEQA 2CKLB 4YATA 2YT5A 3JUEA 4Z0RA 4X3GA 4YBMA 5SVYA 4TKPB 2LXHC 3EB5A 1WEEA 3N9NA 1Z2QA 5FERA 4N3WA 4B7YC 4C9ZA 5DINA 3LQIA 2FUUA 2VJEB 4A49A 3ZYQA 1MM2A 3O7AA 3KNVA 2F42A
chains in the Genus database with same CATH topology
1BORA 4N4FA 5H1UA 3C6WA 2MD8C 4L7XA 2HDPA 5TRBA 1WEVA 3PURA 2F6JA 1WFKA 3GL6A 1VD4A 2KU3A 3SOXA 3V43A 3M99A 5LKTA 2MT5A 5C13A 1WEMA 5LKUA 4QF2A 1Z6UA 2KWOA 5EYAF 2C2LA 2L0BA 2E6RA 5B79A 2VPDA 2ECWA 2LN0A 2C2VS 2AN6A 2KWJA 2I50A 2LDRA 5FB0A 4I7DA 4F52B 3L1ZB 2NAAA 3KQIA 2VJFB 4LLBA 2ECGA 3DQVR 4QF3A 2CKLA 2LV9A 2L43A 4WZ2A 2E6SA 2EODA 4I7CA 2YW8A 2PNXA 2K1JA 5KH9A 2MNYA 2M6MA 2EGPA 3C5KA 2L5UA 5B76A 2Y1NA 2LGGA 1ZBDB 2VJEA 2YSJA 2YURA 3IHPA 3KV6A 5I3LA 2MA5A 4ZDTA 2ECIA 2KGGA 5B75A 4FIPA 5AIUA 2F6NA 2JMIA 3U5OA 3SOUA 2LGLA 2YQMA 3SHBA 3U5MA 3KV5A 3PUQA 2K17A 4FO9A 2LGKA 2KE1A 2QIZA 5B78A 2MUMA 2CT2A 3T7LA 3RTRB 1HYJA 2YQLA 4I7BA 3I2DA 1DVPA 2MD7B 4R8PK 1WGMA 2CSYA 3O37A 2MA6A 4CA1A 4MSXA 4S3OC 4L58A 2L80A 2H0DB 4R7EA 1WE9A 3SOWA 3L11A 5H1VA 4LK9A 1N87A 2PUYA 2ZETC 1LDJB 1WEOA 4A4BA 1WESA 3U5NA 5LCWB 2CSZA 5G04B 4YAXA 3QZVA 4BBQA 4AYCA 4GNDA 1F62A 4PTBA 5TDRA 4W4UA 3ZNIA 5LKZA 1WIMA 2KYUA 1RMDA 4AP4A 2KFTA 3N9QA 4IC2A 3DPLR 4LJNA 2QICA 1MM3A 2XEUA 1VFYA 1FP0A 2G43A 5JG6A 1U6GB 4LADB 1X4JA 3M63A 2KWNA 4A4CA 2M85A 4ZUXU 3N9LA 1K2FA 3GV4A 3MHHA 3ZPV1 3ASLA 2QJ0A 5C11A 2VPGA 1WILA 2H0DA 4P5OB 5H9MA 3LQHA 2K4DA 4WZ0A 2KGIA 2ECJA 5B77A 3LRQA 2VPEA 2YHNA 3MHSA 2MIQA 3N9MA 3RPGB 4YADA 4R2YA 5DKAA 2ECNA 2MNZA 2YHOA 2HYED 1T1HA 4WA6A 2YREA 5D1LB 4YC9A 4WZ3B 3T6RA 1X4UA 4Q6FA 5G0FA 2KREA 3ZPVE 2IDAA 1JM7B 1WEUA 4MVTA 2FUIA 4YBTA 4UP0A 1Z60A 5KH3A 3VK6A 3HCSA 2VJFA 5H1TA 2G6QA 2LQ6A 4BHWA 1WEPA 3ZVYA 3LQJA 5G05B 1IYMA 2VP7A 4GNEA 4NN2A 4UP5A 1VYXA 1G25A 1LDKC 2Y1MA 2G45A 4V3LC 2YYRA 2ECTA 4FJCA 3FL2A 2M3HA 4PPEA 2RSDA 1WENA 3U5PA 1HYIA 3NG2A 3O35A 2BAYA 2K16A 2YU4A 2YUCA 2XB1A 4FK5A 5J3XA 4XI1A 1FBVA 4B86C 5KH7A 3O33A 4LKAA 1XWHA 2LXPC 2KIZA 3RPGC 2ECVA 3ZVZB 4YABA 4YBSA 5AITA 1CHCA 3N9PA 3N9OA 2YSMA 2VNFA 2D8SA 5TBNA 5D1KB 5B8DA 2M1RA 5FEYA 4AUQB 1E4UA 1JOCA 3O34A 3M62A 1JM7A 4IC3A 4S3OB 2FSAA 2KR4A 2OXQC 4GNGA 3L1XA 5FB1A 4GB0A 3HCUA 2JMDA 2RI7A 4ZQLA 2JMJA 3ZTGA 1V87A 2LGVA 2UZGA 1WEWA 5D1MB 4CCGX 4AVXA 4O64A 4V3KC 2Y43A 3O70A 4A0CD 4AYCB 3HTKC 2DX8A 4GNFA 4UI9B 3EB6A 2KWKA 3O36A 1X4IA 2EA6A 2LRIC 2JRJA 3PHDA 3HCTA 2L75A 5TABA 5TDWA 5LKXA 2VPBA 1WEQA 2CKLB 4YATA 2YT5A 4X3GA 4YBMA 4TKPB 2LXHC 3EB5A 1WEEA 3N9NA 1Z2QA 5FERA 4N3WA 4B7YC 4C9ZA 5DINA 3LQIA 2FUUA 2VJEB 4A49A 3ZYQA 1MM2A 3O7AA 3KNVA 2F42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOR A;  4N4F A;  5H1U A;  3C6W A;  2MD8 C;  4L7X A;  2HDP A;  5TRB A;  1WEV A;  3PUR A;  2F6J A;  1WFK A;  3GL6 A;  1VD4 A;  2KU3 A;  3SOX A;  3V43 A;  3M99 A;  5LKT A;  2MT5 A;  5C13 A;  1WEM A;  5LKU A;  4QF2 A;  1Z6U A;  2KWO A;  5EYA F;  2C2L A;  2L0B A;  2E6R A;  5B79 A;  2VPD A;  2ECW A;  2LN0 A;  2C2V S;  2AN6 A;  2KWJ A;  2I50 A;  2LDR A;  5FB0 A;  4I7D A;  4F52 B;  3L1Z B;  2NAA A;  3KQI A;  2VJF B;  4LLB A;  2ECG A;  3DQV R;  4QF3 A;  2CKL A;  2LV9 A;  2L43 A;  4WZ2 A;  2E6S A;  2EOD A;  4I7C A;  2YW8 A;  2PNX A;  2K1J A;  5KH9 A;  2MNY A;  2M6M A;  2EGP A;  3C5K A;  2L5U A;  5B76 A;  2Y1N A;  2LGG A;  1ZBD B;  2VJE A;  2YSJ A;  2YUR A;  3IHP A;  3KV6 A;  5I3L A;  2MA5 A;  4ZDT A;  2ECI A;  2KGG A;  5B75 A;  4FIP A;  5AIU A;  2F6N A;  2JMI A;  3U5O A;  3SOU A;  2LGL A;  2YQM A;  3SHB A;  3U5M A;  3KV5 A;  3PUQ A;  2K17 A;  4FO9 A;  2LGK A;  2KE1 A;  2QIZ A;  5B78 A;  2MUM A;  2CT2 A;  3T7L A;  3RTR B;  1HYJ A;  2YQL A;  4I7B A;  3I2D A;  1DVP A;  2MD7 B;  4R8P K;  1WGM A;  2CSY A;  3O37 A;  2MA6 A;  4CA1 A;  4MSX A;  4S3O C;  4L58 A;  2L80 A;  2H0D B;  4R7E A;  1WE9 A;  3SOW A;  3L11 A;  5H1V A;  4LK9 A;  1N87 A;  2PUY A;  2ZET C;  1LDJ B;  1WEO A;  4A4B A;  1WES A;  3U5N A;  5LCW B;  2CSZ A;  5G04 B;  4YAX A;  3QZV A;  4BBQ A;  4AYC A;  4GND A;  1F62 A;  4PTB A;  5TDR A;  4W4U A;  3ZNI A;  5LKZ A;  1WIM A;  2KYU A;  1RMD A;  4AP4 A;  2KFT A;  3N9Q A;  4IC2 A;  3DPL R;  4LJN A;  2QIC A;  1MM3 A;  2XEU A;  1VFY A;  1FP0 A;  2G43 A;  5JG6 A;  1U6G B;  4LAD B;  1X4J A;  3M63 A;  2KWN A;  4A4C A;  2M85 A;  4ZUX U;  3N9L A;  1K2F A;  3GV4 A;  3MHH A;  3ZPV 1;  3ASL A;  2QJ0 A;  5C11 A;  2VPG A;  1WIL A;  2H0D A;  4P5O B;  5H9M A;  3LQH A;  2K4D A;  4WZ0 A;  2KGI A;  2ECJ A;  5B77 A;  3LRQ A;  2VPE A;  2YHN A;  3MHS A;  2MIQ A;  3N9M A;  3RPG B;  4YAD A;  4R2Y A;  5DKA A;  2ECN A;  2MNZ A;  2YHO A;  2HYE D;  1T1H A;  4WA6 A;  2YRE A;  5D1L B;  4YC9 A;  4WZ3 B;  3T6R A;  1X4U A;  4Q6F A;  5G0F A;  2KRE A;  3ZPV E;  2IDA A;  1JM7 B;  1WEU A;  4MVT A;  2FUI A;  4YBT A;  4UP0 A;  1Z60 A;  5KH3 A;  3VK6 A;  3HCS A;  2VJF A;  5H1T A;  2G6Q A;  2LQ6 A;  4BHW A;  1WEP A;  3ZVY A;  3LQJ A;  5G05 B;  1IYM A;  2VP7 A;  4GNE A;  4NN2 A;  4UP5 A;  1VYX A;  1G25 A;  1LDK C;  2Y1M A;  2G45 A;  4V3L C;  2YYR A;  2ECT A;  4FJC A;  3FL2 A;  2M3H A;  4PPE A;  2RSD A;  1WEN A;  3U5P A;  1HYI A;  3NG2 A;  3O35 A;  2BAY A;  2K16 A;  2YU4 A;  2YUC A;  2XB1 A;  4FK5 A;  5J3X A;  4XI1 A;  1FBV A;  4B86 C;  5KH7 A;  3O33 A;  4LKA A;  1XWH A;  2LXP C;  2KIZ A;  3RPG C;  2ECV A;  3ZVZ B;  4YAB A;  4YBS A;  5AIT A;  1CHC A;  3N9P A;  3N9O A;  2YSM A;  2VNF A;  2D8S A;  5TBN A;  5D1K B;  5B8D A;  2M1R A;  5FEY A;  4AUQ B;  1E4U A;  1JOC A;  3O34 A;  3M62 A;  1JM7 A;  4IC3 A;  4S3O B;  2FSA A;  2KR4 A;  2OXQ C;  4GNG A;  3L1X A;  5FB1 A;  4GB0 A;  3HCU A;  2JMD A;  2RI7 A;  4ZQL A;  2JMJ A;  3ZTG A;  1V87 A;  2LGV A;  2UZG A;  1WEW A;  5D1M B;  4CCG X;  4AVX A;  4O64 A;  4V3K C;  2Y43 A;  3O70 A;  4A0C D;  4AYC B;  3HTK C;  2DX8 A;  4GNF A;  4UI9 B;  3EB6 A;  2KWK A;  3O36 A;  1X4I A;  2EA6 A;  2LRI C;  2JRJ A;  3PHD A;  3HCT A;  2L75 A;  5TAB A;  5TDW A;  5LKX A;  2VPB A;  1WEQ A;  2CKL B;  4YAT A;  2YT5 A;  4X3G A;  4YBM A;  4TKP B;  2LXH C;  3EB5 A;  1WEE A;  3N9N A;  1Z2Q A;  5FER A;  4N3W A;  4B7Y C;  4C9Z A;  5DIN A;  3LQI A;  2FUU A;  2VJE B;  4A49 A;  3ZYQ A;  1MM2 A;  3O7A A;  3KNV A;  2F42 A; 
#chains in the Genus database with same CATH topology
 1BOR A;  4N4F A;  5H1U A;  3C6W A;  2MD8 C;  4L7X A;  2HDP A;  5TRB A;  1WEV A;  3PUR A;  2F6J A;  2XP0 A;  1WFK A;  3GL6 A;  1VD4 A;  2KU3 A;  4QQ4 A;  3SOX A;  3V43 A;  3M99 A;  5LKT A;  2MT5 A;  5C13 A;  1WEM A;  5LKU A;  4QF2 A;  1Z6U A;  2KWO A;  5EYA F;  2KKY A;  2C2L A;  2L0B A;  2E6R A;  5B79 A;  2VPD A;  2ECW A;  2LN0 A;  2C2V S;  2AN6 A;  2KWJ A;  2I50 A;  2LDR A;  2RR4 A;  5FB0 A;  4I7D A;  4F52 B;  3L1Z B;  2NAA A;  2KKX A;  3KQI A;  2VJF B;  4LLB A;  2ECG A;  3DQV R;  4QF3 A;  2CKL A;  2LV9 A;  2L43 A;  3PLW A;  4WZ2 A;  2E6S A;  2EOD A;  4I7C A;  2YW8 A;  2PNX A;  2CON A;  2K1J A;  3LVR E;  5KH9 A;  2MNY A;  2M6M A;  2EGP A;  3C5K A;  2L5U A;  5B76 A;  2Y1N A;  2LGG A;  1ZBD B;  5SVX A;  2VJE A;  2YSJ A;  2JM3 A;  2YUR A;  3IHP A;  3KV6 A;  5I3L A;  2MA5 A;  4ZDT A;  2B0O E;  2ECI A;  2KGG A;  2L7P A;  5B75 A;  3H7H A;  4FIP A;  5AIU A;  2F6N A;  2JMI A;  3U5O A;  3SOU A;  2LGL A;  2YQM A;  3SHB A;  3U5M A;  2XOC A;  3KV5 A;  3PUQ A;  2K17 A;  4FO9 A;  2LGK A;  2KE1 A;  2QIZ A;  5B78 A;  3FJU B;  2MUM A;  2CT2 A;  3T7L A;  3RTR B;  1HYJ A;  2YQL A;  4I7B A;  4H9D A;  2DSM A;  3I2D A;  1DVP A;  2MD7 B;  2MKE A;  2EXU A;  4R8P K;  1WGM A;  2CSY A;  3O37 A;  2MA6 A;  4CA1 A;  4MSX A;  4S3O C;  4L58 A;  2L80 A;  2H0D B;  4R7E A;  1WE9 A;  3SOW A;  3L11 A;  5H1V A;  4LK9 A;  1N87 A;  2PUY A;  2ZET C;  1LDJ B;  1WEO A;  3LJU X;  4A4B A;  1WES A;  3U5N A;  1MBM A;  5LCW B;  2CSV A;  2CSZ A;  3FAO A;  3DDT A;  5G04 B;  4YAX A;  3QZV A;  3LVQ E;  4BBQ A;  4AYC A;  4GND A;  1F62 A;  4PTB A;  5TDR A;  4W4U A;  3ZNI A;  5LKZ A;  1WIM A;  2KYU A;  2FFW A;  1RMD A;  4AP4 A;  2KFT A;  3N9Q A;  3T9K A;  2CRR A;  4IC2 A;  3DPL R;  2YVR A;  4LJN A;  3SUB A;  2QIC A;  1MM3 A;  2XEU A;  1VFY A;  1FP0 A;  2G43 A;  5JG6 A;  1U6G B;  4LAD B;  1X4J A;  3M63 A;  2KWN A;  4A4C A;  2M85 A;  4ZUX U;  5SVI B;  3N9L A;  1K2F A;  3GV4 A;  3MHH A;  3ZPV 1;  3ASL A;  2QJ0 A;  5C11 A;  2VPG A;  2P57 A;  1WIL A;  2H0D A;  4P5O B;  5H9M A;  2EGM A;  3LQH A;  2K4D A;  4WZ0 A;  2KGI A;  2ECJ A;  5B77 A;  3LRQ A;  2VPE A;  2YHN A;  2E61 A;  3MHS A;  2MIQ A;  3N9M A;  3RPG B;  4YAD A;  3LDY A;  4R2Y A;  5DKA A;  2ECN A;  2MNZ A;  2YHO A;  2HYE D;  1T1H A;  4WA6 A;  2YRE A;  5D1L B;  4YC9 A;  3FM8 C;  4WZ3 B;  3Q1D A;  3T6R A;  1X4U A;  4Q6F A;  5G0F A;  3FAN A;  2KRE A;  3ZPV E;  2IDA A;  2XOY A;  1JM7 B;  3DWD A;  1WEU A;  4MVT A;  2FUI A;  3O47 A;  4YBT A;  4UP0 A;  1Z60 A;  5KH3 A;  3VK6 A;  3FEH A;  2LAU A;  2VJF A;  3HCS A;  5H1T A;  2G6Q A;  2LQ6 A;  4BHW A;  1WEP A;  3ZVY A;  5K3Q A;  3LQJ A;  3M7K A;  2JUN A;  5G05 B;  1IYM A;  3KDE C;  2VP7 A;  4GNE A;  4NN2 A;  4UP5 A;  1VYX A;  1G25 A;  1LDK C;  5SVI A;  2Y1M A;  2G45 A;  3MDB C;  2D8U A;  4V3L C;  2YYR A;  2ECT A;  4FJC A;  3FL2 A;  2M3H A;  4PPE A;  2RSD A;  2FD4 A;  1WEN A;  3U5P A;  1HYI A;  2XOZ A;  3NG2 A;  3O35 A;  2BAY A;  2K16 A;  2YU4 A;  4O62 A;  2YUC A;  2XB1 A;  4FK5 A;  5J3X A;  4XI1 A;  1FBV A;  4B86 C;  5KH7 A;  3O33 A;  4LKA A;  1XWH A;  2LXP C;  2KIZ A;  3RPG C;  2ECV A;  3ZVZ B;  4YAB A;  4YBS A;  5AIT A;  1CHC A;  1DCQ A;  3N9P A;  3N9O A;  2YSM A;  2VNF A;  2D8S A;  5TBN A;  5D1K B;  5B8D A;  2M1R A;  5FEY A;  4AUQ B;  1E4U A;  1JOC A;  4OGC A;  3O34 A;  3M62 A;  1JM7 A;  4IC3 A;  4S3O B;  2FSA A;  2DJA A;  2KR4 A;  2OXQ C;  4Z0O A;  4GNG A;  3L1X A;  5FB1 A;  4GB0 A;  3HCU A;  2JMD A;  2RI7 A;  4ZQL A;  2JMJ A;  3ZTG A;  1V87 A;  2LGV A;  2CRW A;  2UZG A;  1WEW A;  5D1M B;  4CCG X;  4AVX A;  4O64 A;  4V3K C;  2Y43 A;  3O70 A;  4A0C D;  4AYC B;  3HTK C;  3E2D A;  2DX8 A;  4GNF A;  4UI9 B;  2OWA A;  3EB6 A;  2KWK A;  3O36 A;  2IQJ A;  4OGE A;  1X4I A;  2EA6 A;  2LRI C;  2JRJ A;  3PHD A;  3HCT A;  2M13 A;  2L75 A;  4F1P A;  5TAB A;  5TDW A;  5LKX A;  2VPB A;  1WEQ A;  2CKL B;  4YAT A;  2YT5 A;  3JUE A;  4Z0R A;  4X3G A;  4YBM A;  5SVY A;  4TKP B;  2LXH C;  3EB5 A;  1WEE A;  3N9N A;  1Z2Q A;  5FER A;  4N3W A;  4B7Y C;  4C9Z A;  5DIN A;  3LQI A;  2FUU A;  2VJE B;  4A49 A;  3ZYQ A;  1MM2 A;  3O7A A;  3KNV A;  2F42 A; 
#chains in the Genus database with same CATH homology
 1BOR A;  4N4F A;  5H1U A;  3C6W A;  2MD8 C;  4L7X A;  2HDP A;  5TRB A;  1WEV A;  3PUR A;  2F6J A;  1WFK A;  3GL6 A;  1VD4 A;  2KU3 A;  3SOX A;  3V43 A;  3M99 A;  5LKT A;  2MT5 A;  5C13 A;  1WEM A;  5LKU A;  4QF2 A;  1Z6U A;  2KWO A;  5EYA F;  2C2L A;  2L0B A;  2E6R A;  5B79 A;  2VPD A;  2ECW A;  2LN0 A;  2C2V S;  2AN6 A;  2KWJ A;  2I50 A;  2LDR A;  5FB0 A;  4I7D A;  4F52 B;  3L1Z B;  2NAA A;  3KQI A;  2VJF B;  4LLB A;  2ECG A;  3DQV R;  4QF3 A;  2CKL A;  2LV9 A;  2L43 A;  4WZ2 A;  2E6S A;  2EOD A;  4I7C A;  2YW8 A;  2PNX A;  2K1J A;  5KH9 A;  2MNY A;  2M6M A;  2EGP A;  3C5K A;  2L5U A;  5B76 A;  2Y1N A;  2LGG A;  1ZBD B;  2VJE A;  2YSJ A;  2YUR A;  3IHP A;  3KV6 A;  5I3L A;  2MA5 A;  4ZDT A;  2ECI A;  2KGG A;  5B75 A;  4FIP A;  5AIU A;  2F6N A;  2JMI A;  3U5O A;  3SOU A;  2LGL A;  2YQM A;  3SHB A;  3U5M A;  3KV5 A;  3PUQ A;  2K17 A;  4FO9 A;  2LGK A;  2KE1 A;  2QIZ A;  5B78 A;  2MUM A;  2CT2 A;  3T7L A;  3RTR B;  1HYJ A;  2YQL A;  4I7B A;  3I2D A;  1DVP A;  2MD7 B;  4R8P K;  1WGM A;  2CSY A;  3O37 A;  2MA6 A;  4CA1 A;  4MSX A;  4S3O C;  4L58 A;  2L80 A;  2H0D B;  4R7E A;  1WE9 A;  3SOW A;  3L11 A;  5H1V A;  4LK9 A;  1N87 A;  2PUY A;  2ZET C;  1LDJ B;  1WEO A;  4A4B A;  1WES A;  3U5N A;  5LCW B;  2CSZ A;  5G04 B;  4YAX A;  3QZV A;  4BBQ A;  4AYC A;  4GND A;  1F62 A;  4PTB A;  5TDR A;  4W4U A;  3ZNI A;  5LKZ A;  1WIM A;  2KYU A;  1RMD A;  4AP4 A;  2KFT A;  3N9Q A;  4IC2 A;  3DPL R;  4LJN A;  2QIC A;  1MM3 A;  2XEU A;  1VFY A;  1FP0 A;  2G43 A;  5JG6 A;  1U6G B;  4LAD B;  1X4J A;  3M63 A;  2KWN A;  4A4C A;  2M85 A;  4ZUX U;  3N9L A;  1K2F A;  3GV4 A;  3MHH A;  3ZPV 1;  3ASL A;  2QJ0 A;  5C11 A;  2VPG A;  1WIL A;  2H0D A;  4P5O B;  5H9M A;  3LQH A;  2K4D A;  4WZ0 A;  2KGI A;  2ECJ A;  5B77 A;  3LRQ A;  2VPE A;  2YHN A;  3MHS A;  2MIQ A;  3N9M A;  3RPG B;  4YAD A;  4R2Y A;  5DKA A;  2ECN A;  2MNZ A;  2YHO A;  2HYE D;  1T1H A;  4WA6 A;  2YRE A;  5D1L B;  4YC9 A;  4WZ3 B;  3T6R A;  1X4U A;  4Q6F A;  5G0F A;  2KRE A;  3ZPV E;  2IDA A;  1JM7 B;  1WEU A;  4MVT A;  2FUI A;  4YBT A;  4UP0 A;  1Z60 A;  5KH3 A;  3VK6 A;  3HCS A;  2VJF A;  5H1T A;  2G6Q A;  2LQ6 A;  4BHW A;  1WEP A;  3ZVY A;  3LQJ A;  5G05 B;  1IYM A;  2VP7 A;  4GNE A;  4NN2 A;  4UP5 A;  1VYX A;  1G25 A;  1LDK C;  2Y1M A;  2G45 A;  4V3L C;  2YYR A;  2ECT A;  4FJC A;  3FL2 A;  2M3H A;  4PPE A;  2RSD A;  1WEN A;  3U5P A;  1HYI A;  3NG2 A;  3O35 A;  2BAY A;  2K16 A;  2YU4 A;  2YUC A;  2XB1 A;  4FK5 A;  5J3X A;  4XI1 A;  1FBV A;  4B86 C;  5KH7 A;  3O33 A;  4LKA A;  1XWH A;  2LXP C;  2KIZ A;  3RPG C;  2ECV A;  3ZVZ B;  4YAB A;  4YBS A;  5AIT A;  1CHC A;  3N9P A;  3N9O A;  2YSM A;  2VNF A;  2D8S A;  5TBN A;  5D1K B;  5B8D A;  2M1R A;  5FEY A;  4AUQ B;  1E4U A;  1JOC A;  3O34 A;  3M62 A;  1JM7 A;  4IC3 A;  4S3O B;  2FSA A;  2KR4 A;  2OXQ C;  4GNG A;  3L1X A;  5FB1 A;  4GB0 A;  3HCU A;  2JMD A;  2RI7 A;  4ZQL A;  2JMJ A;  3ZTG A;  1V87 A;  2LGV A;  2UZG A;  1WEW A;  5D1M B;  4CCG X;  4AVX A;  4O64 A;  4V3K C;  2Y43 A;  3O70 A;  4A0C D;  4AYC B;  3HTK C;  2DX8 A;  4GNF A;  4UI9 B;  3EB6 A;  2KWK A;  3O36 A;  1X4I A;  2EA6 A;  2LRI C;  2JRJ A;  3PHD A;  3HCT A;  2L75 A;  5TAB A;  5TDW A;  5LKX A;  2VPB A;  1WEQ A;  2CKL B;  4YAT A;  2YT5 A;  4X3G A;  4YBM A;  4TKP B;  2LXH C;  3EB5 A;  1WEE A;  3N9N A;  1Z2Q A;  5FER A;  4N3W A;  4B7Y C;  4C9Z A;  5DIN A;  3LQI A;  2FUU A;  2VJE B;  4A49 A;  3ZYQ A;  1MM2 A;  3O7A A;  3KNV A;  2F42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...