3ZTGA

Solution structure of the ring finger-like domain of retinoblastoma binding protein-6 (rbbp6)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
GPLGSEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Ring Finger-Like Domain of Retinoblastoma Binding Protein-6 (Rbbp6) Suggests It Functions as a U-Box
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RBBP6
total genus 14
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3ztgA00
3L11A 5G05B 3N9OA 2YURA 4QF3A 2LRIC 2YSJA 4B86C 4NN2A 4GNEA 4CA1A 2LXHC 2HDPA 2G45A 4XI1A 1JOCA 3O7AA 2CSZA 4P5OB 3LQIA 3LRQA 2CT2A 1XWHA 1HYJA 2KWNA 5C11A 4FK5A 4GNDA 1FP0A 2H0DB 2ECNA 2RSDA 5TABA 2L0BA 2QICA 3ZPV1 1F62A 2K4DA 2LDRA 1G25A 2NAAA 4YBSA 1FBVA 2JRJA 2CKLB 2KU3A 3O70A 2QIZA 1MM3A 2I50A 3U5MA 2C2LA 2F42A 3IHPA 2JMJA 5KH7A 3HCTA 2MT5A 5B76A 2LGLA 3U5OA 5LKUA 2VJEA 4B7YC 1WESA 4AYCB 5AITA 5H1UA 1X4IA 2G6QA 4UI9B 3O36A 3T6RA 1WEWA 2ECIA 2LXPC 5D1KB 2VJFA 3LQHA 4C9ZA 4TKPB 5LCWB 1JM7A 4LK9A 2MNYA 2LGGA 4UP5A 5B77A 3RPGC 1WEQA 3N9QA 3ZVZB 1X4UA 1WEVA 2MD8C 4O64A 4YADA 4L7XA 4WZ3B 3PHDA 2MD7B 3KNVA 3QZVA 1MM2A 2VJEB 2JMIA 3DPLR 3GV4A 3HCSA 4A4CA 5D1LB 3N9MA 1ZBDB 3T7LA 3N9NA 1JM7B 4WZ0A 4MSXA 2EGPA 1WENA 2JMDA 5TDRA 2L43A 3ASLA 1LDJB 2L75A 2G43A 1V87A 2K17A 3SHBA 4LKAA 3ZVYA 3LQJA 1LDKC 2HYED 3C6WA 1WEEA 1Z6UA 4Q6FA 3C5KA 2KFTA 4LLBA 1VD4A 2YHOA 2DX8A 1HYIA 1DVPA 4BBQA 2LGKA 5AIUA 4I7CA 2ECVA 4FIPA 1WEOA 2MUMA 4YBTA 3KQIA 5FB1A 5LKZA 1RMDA 4YC9A 3ZYQA 3RPGB 2KYUA 5LKTA 1E4UA 2PNXA 4YBMA 4WZ2A 2YREA 5H1VA 4N3WA 2KR4A 2F6NA 5D1MB 3PURA 4ZQLA 5JG6A 1WEUA 2Y43A 5LKXA 3PUQA 2VPEA 3I2DA 3MHHA 1Z2QA 4WA6A 2YYRA 2ECTA 4R8PK 5DKAA 2OXQC 4V3LC 3O33A 2LN0A 2M3HA 2H0DA 3O37A 1WGMA 4YABA 2LV9A 2PUYA 5B75A 2YQLA 4I7BA 2KREA 3NG2A 2F6JA 3ZTGA 3SOXA 4X3GA 2CKLA 2E6RA 1WEMA 2ECJA 2EODA 2VPBA 1WIMA 2L5UA 3HCUA 5G0FA 1Z60A 2ECGA 3SOWA 4L58A 2MA5A 3U5PA 2C2VS 1K2FA 5B78A 2FUIA 4AUQB 4ZDTA 5DINA 5FERA 1WILA 3M99A 3N9PA 4PTBA 4S3OB 4R2YA 5EYAF 5TBNA 5FEYA 3KV5A 2CSYA 5C13A 4FJCA 4S3OC 2LQ6A 2MIQA 3L1XA 4FO9A 2MA6A 3DQVR 4YATA 3V43A 5FB0A 1CHCA 3SOUA 3KV6A 3HTKC 3EB6A 2M1RA 2KWJA 4AYCA 2UZGA 2VPDA 4W4UA 4A49A 2Y1MA 2YT5A 5B79A 2YSMA 4CCGX 2YHNA 5KH3A 4AP4A 2IDAA 2KWOA 3N9LA 4PPEA 3FL2A 2VJFB 4UP0A 5H1TA 4IC3A 2FUUA 2MNZA 4I7DA 1T1HA 2KIZA 2EA6A 2D8SA 1VYXA 3EB5A 2KGIA 4AVXA 1IYMA 1U6GB 4GB0A 2E6SA 3U5NA 4N4FA 4GNFA 3ZPVE 4R7EA 2YU4A 3MHSA 2KWKA 2KE1A 2ZETC 2K1JA 1VFYA 4LADB 5TRBA 2RI7A 3M62A 2M6MA 2BAYA 2K16A 1WEPA 5H9MA 2XB1A 3O34A 2FSAA 5G04B 2XEUA 2KGGA 3M63A 5TDWA 1BORA 2ECWA 3GL6A 4V3KC 4F52B 4ZUXU 2LGVA 2L80A 4IC2A 4MVTA 2Y1NA 4QF2A 1WE9A 4A4BA 3VK6A 1X4JA 3ZNIA 2VPGA 1WFKA 4LJNA 2QJ0A 5B8DA 3O35A 2YQMA 3RTRB 2YUCA 5I3LA 5J3XA 5KH9A 4A0CD 4GNGA 2VP7A 2VNFA 4BHWA 2M85A 3L1ZB 1N87A 2YW8A 4YAXA 2AN6A
chains in the Genus database with same CATH superfamily
3L11A 5G05B 3N9OA 2YURA 4QF3A 2LRIC 2YSJA 4B86C 4NN2A 4GNEA 4CA1A 2LXHC 2HDPA 2G45A 4XI1A 1JOCA 3O7AA 2CSZA 4P5OB 3LQIA 3LRQA 2CT2A 1XWHA 4O62A 1HYJA 2KWNA 5C11A 4FK5A 3DWDA 4GNDA 1FP0A 2H0DB 3M7KA 2ECNA 2RSDA 5TABA 2L0BA 2QICA 3ZPV1 1F62A 2K4DA 2LDRA 1G25A 2NAAA 4YBSA 1FBVA 2JRJA 2CKLB 2XOYA 4OGCA 2KU3A 3O70A 2QIZA 1MM3A 2I50A 3U5MA 2C2LA 2F42A 3IHPA 2JMJA 5KH7A 3HCTA 2CONA 2MT5A 5B76A 2LGLA 3U5OA 5LKUA 2VJEA 4B7YC 1WESA 4AYCB 5AITA 5H1UA 1X4IA 2G6QA 2RR4A 4UI9B 3O36A 3T9KA 3T6RA 1WEWA 2ECIA 2LXPC 5D1KB 2VJFA 3LQHA 4C9ZA 4TKPB 5LCWB 1JM7A 3LVRE 4LK9A 2MNYA 2LGGA 4UP5A 5B77A 3RPGC 1WEQA 3N9QA 3ZVZB 3LJUX 1X4UA 1WEVA 2MD8C 4O64A 4YADA 4L7XA 4WZ3B 3PHDA 2LAUA 2MD7B 3FAOA 3KNVA 1MM2A 3QZVA 2VJEB 2JMIA 3DPLR 3GV4A 3HCSA 5SVYA 4A4CA 5D1LB 3N9MA 4Z0OA 1ZBDB 3T7LA 3O47A 3N9NA 1JM7B 4WZ0A 4MSXA 2EGPA 1WENA 3KDEC 2JMDA 5TDRA 2L43A 3ASLA 1LDJB 3FM8C 2EXUA 2G43A 2L75A 2MKEA 1V87A 2K17A 3SHBA 4LKAA 5K3QA 3ZVYA 3LQJA 1LDKC 2HYED 3C6WA 1WEEA 1Z6UA 4Q6FA 3C5KA 2KFTA 4LLBA 4OGEA 1VD4A 2YHOA 2DX8A 1HYIA 1DVPA 4BBQA 2LGKA 5AIUA 4I7CA 2ECVA 2CRWA 4FIPA 1WEOA 2MUMA 2FD4A 4YBTA 3KQIA 5FB1A 5LKZA 1RMDA 4YC9A 3ZYQA 3RPGB 5SVIA 2KYUA 5LKTA 1E4UA 2PNXA 4YBMA 4WZ2A 2YREA 5H1VA 4N3WA 2KR4A 2F6NA 5D1MB 3PURA 4ZQLA 5JG6A 1WEUA 2Y43A 3H7HA 5LKXA 3PUQA 2VPEA 3I2DA 3MHHA 1Z2QA 4WA6A 2YYRA 2ECTA 4R8PK 5DKAA 2OXQC 4V3LC 3O33A 2LN0A 2M3HA 2H0DA 3O37A 1WGMA 4YABA 3E2DA 2P57A 2LV9A 5SVXA 2PUYA 5B75A 2YQLA 3MDBC 2E61A 4I7BA 2KREA 3NG2A 2XOCA 2F6JA 2M13A 3ZTGA 2CRRA 3SOXA 4X3GA 2CKLA 2E6RA 1WEMA 2ECJA 2EODA 2VPBA 1WIMA 2L5UA 3HCUA 5G0FA 3FANA 1Z60A 2ECGA 3SOWA 4L58A 2MA5A 3U5PA 2C2VS 1K2FA 5B78A 2FUIA 4AUQB 4ZDTA 5DINA 5FERA 1WILA 3M99A 3N9PA 4PTBA 4S3OB 4R2YA 5EYAF 5TBNA 5FEYA 2JUNA 3KV5A 2CSYA 2IQJA 5C13A 4FJCA 3JUEA 4S3OC 2LQ6A 2DJAA 2MIQA 3L1XA 4FO9A 2MA6A 3DQVR 2XOZA 4YATA 3V43A 2D8UA 5FB0A 1CHCA 3SOUA 2CSVA 3KV6A 3HTKC 3EB6A 2M1RA 2OWAA 2KWJA 3FJUB 4AYCA 2UZGA 2VPDA 4W4UA 4A49A 2Y1MA 2YT5A 5B79A 2YSMA 4CCGX 2YHNA 5KH3A 4AP4A 4H9DA 2IDAA 2B0OE 3LDYA 2KWOA 3N9LA 4PPEA 3FL2A 2VJFB 4QQ4A 4UP0A 5H1TA 4IC3A 2FUUA 2JM3A 2DSMA 2MNZA 4I7DA 1T1HA 2KIZA 2EA6A 2D8SA 1VYXA 3EB5A 2KGIA 4AVXA 1IYMA 1U6GB 3DDTA 2EGMA 4GB0A 2E6SA 2FFWA 3U5NA 3FEHA 4N4FA 4Z0RA 4GNFA 3ZPVE 4R7EA 2YU4A 3MHSA 2KWKA 2KE1A 2KKYA 2ZETC 2K1JA 3LVQE 1VFYA 4LADB 5TRBA 2RI7A 3M62A 2M6MA 2BAYA 2K16A 2XP0A 1WEPA 5H9MA 2XB1A 3O34A 2FSAA 5G04B 1DCQA 4F1PA 2XEUA 2KGGA 3M63A 5TDWA 1BORA 5SVIB 2ECWA 3GL6A 4V3KC 4F52B 2L7PA 4ZUXU 2LGVA 2L80A 4MVTA 4IC2A 3PLWA 2Y1NA 4QF2A 1WE9A 4A4BA 3VK6A 1X4JA 3ZNIA 3SUBA 2VPGA 1WFKA 4LJNA 2QJ0A 2KKXA 5B8DA 3O35A 2YQMA 3RTRB 2YUCA 5I3LA 5J3XA 5KH9A 2YVRA 4A0CD 1MBMA 4GNGA 2VP7A 2VNFA 4BHWA 2M85A 3Q1DA 3L1ZB 1N87A 2YW8A 4YAXA 2AN6A
chains in the Genus database with same CATH topology
3L11A 5G05B 3N9OA 2YURA 4QF3A 2LRIC 2YSJA 4B86C 4NN2A 4GNEA 4CA1A 2LXHC 2HDPA 2G45A 4XI1A 1JOCA 3O7AA 2CSZA 4P5OB 3LQIA 3LRQA 2CT2A 1XWHA 1HYJA 2KWNA 5C11A 4FK5A 4GNDA 1FP0A 2H0DB 2ECNA 2RSDA 5TABA 2L0BA 2QICA 3ZPV1 1F62A 2K4DA 2LDRA 1G25A 2NAAA 4YBSA 1FBVA 2JRJA 2CKLB 2KU3A 3O70A 2QIZA 1MM3A 2I50A 3U5MA 2C2LA 2F42A 3IHPA 2JMJA 5KH7A 3HCTA 2MT5A 5B76A 2LGLA 3U5OA 5LKUA 2VJEA 4B7YC 1WESA 4AYCB 5AITA 5H1UA 1X4IA 2G6QA 4UI9B 3O36A 3T6RA 1WEWA 2ECIA 2LXPC 5D1KB 2VJFA 3LQHA 4C9ZA 4TKPB 5LCWB 1JM7A 4LK9A 2MNYA 2LGGA 4UP5A 5B77A 3RPGC 1WEQA 3N9QA 3ZVZB 1X4UA 1WEVA 2MD8C 4O64A 4YADA 4L7XA 4WZ3B 3PHDA 2MD7B 3KNVA 3QZVA 1MM2A 2VJEB 2JMIA 3DPLR 3GV4A 3HCSA 4A4CA 5D1LB 3N9MA 1ZBDB 3T7LA 3N9NA 1JM7B 4WZ0A 4MSXA 2EGPA 1WENA 2JMDA 5TDRA 2L43A 3ASLA 1LDJB 2L75A 2G43A 1V87A 2K17A 3SHBA 4LKAA 3ZVYA 3LQJA 1LDKC 2HYED 3C6WA 1WEEA 1Z6UA 4Q6FA 3C5KA 2KFTA 4LLBA 1VD4A 2YHOA 2DX8A 1HYIA 1DVPA 4BBQA 2LGKA 5AIUA 4I7CA 2ECVA 4FIPA 1WEOA 2MUMA 4YBTA 3KQIA 5FB1A 5LKZA 1RMDA 4YC9A 3ZYQA 3RPGB 2KYUA 5LKTA 1E4UA 2PNXA 4YBMA 4WZ2A 2YREA 5H1VA 4N3WA 2KR4A 2F6NA 5D1MB 3PURA 4ZQLA 5JG6A 1WEUA 2Y43A 5LKXA 3PUQA 2VPEA 3I2DA 3MHHA 1Z2QA 4WA6A 2YYRA 2ECTA 4R8PK 5DKAA 2OXQC 4V3LC 3O33A 2LN0A 2M3HA 2H0DA 3O37A 1WGMA 4YABA 2LV9A 2PUYA 5B75A 2YQLA 4I7BA 2KREA 3NG2A 2F6JA 3ZTGA 3SOXA 4X3GA 2CKLA 2E6RA 1WEMA 2ECJA 2EODA 2VPBA 1WIMA 2L5UA 3HCUA 5G0FA 1Z60A 2ECGA 3SOWA 4L58A 2MA5A 3U5PA 2C2VS 1K2FA 5B78A 2FUIA 4AUQB 4ZDTA 5DINA 5FERA 1WILA 3M99A 3N9PA 4PTBA 4S3OB 4R2YA 5EYAF 5TBNA 5FEYA 3KV5A 2CSYA 5C13A 4FJCA 4S3OC 2LQ6A 2MIQA 3L1XA 4FO9A 2MA6A 3DQVR 4YATA 3V43A 5FB0A 1CHCA 3SOUA 3KV6A 3HTKC 3EB6A 2M1RA 2KWJA 4AYCA 2UZGA 2VPDA 4W4UA 4A49A 2Y1MA 2YT5A 5B79A 2YSMA 4CCGX 2YHNA 5KH3A 4AP4A 2IDAA 2KWOA 3N9LA 4PPEA 3FL2A 2VJFB 4UP0A 5H1TA 4IC3A 2FUUA 2MNZA 4I7DA 1T1HA 2KIZA 2EA6A 2D8SA 1VYXA 3EB5A 2KGIA 4AVXA 1IYMA 1U6GB 4GB0A 2E6SA 3U5NA 4N4FA 4GNFA 3ZPVE 4R7EA 2YU4A 3MHSA 2KWKA 2KE1A 2ZETC 2K1JA 1VFYA 4LADB 5TRBA 2RI7A 3M62A 2M6MA 2BAYA 2K16A 1WEPA 5H9MA 2XB1A 3O34A 2FSAA 5G04B 2XEUA 2KGGA 3M63A 5TDWA 1BORA 2ECWA 3GL6A 4V3KC 4F52B 4ZUXU 2LGVA 2L80A 4IC2A 4MVTA 2Y1NA 4QF2A 1WE9A 4A4BA 3VK6A 1X4JA 3ZNIA 2VPGA 1WFKA 4LJNA 2QJ0A 5B8DA 3O35A 2YQMA 3RTRB 2YUCA 5I3LA 5J3XA 5KH9A 4A0CD 4GNGA 2VP7A 2VNFA 4BHWA 2M85A 3L1ZB 1N87A 2YW8A 4YAXA 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  5G05 B;  3N9O A;  2YUR A;  4QF3 A;  2LRI C;  2YSJ A;  4B86 C;  4NN2 A;  4GNE A;  4CA1 A;  2LXH C;  2HDP A;  2G45 A;  4XI1 A;  1JOC A;  3O7A A;  2CSZ A;  4P5O B;  3LQI A;  3LRQ A;  2CT2 A;  1XWH A;  1HYJ A;  2KWN A;  5C11 A;  4FK5 A;  4GND A;  1FP0 A;  2H0D B;  2ECN A;  2RSD A;  5TAB A;  2L0B A;  2QIC A;  3ZPV 1;  1F62 A;  2K4D A;  2LDR A;  1G25 A;  2NAA A;  4YBS A;  1FBV A;  2JRJ A;  2CKL B;  2KU3 A;  3O70 A;  2QIZ A;  1MM3 A;  2I50 A;  3U5M A;  2C2L A;  2F42 A;  3IHP A;  2JMJ A;  5KH7 A;  3HCT A;  2MT5 A;  5B76 A;  2LGL A;  3U5O A;  5LKU A;  2VJE A;  4B7Y C;  1WES A;  4AYC B;  5AIT A;  5H1U A;  1X4I A;  2G6Q A;  4UI9 B;  3O36 A;  3T6R A;  1WEW A;  2ECI A;  2LXP C;  5D1K B;  2VJF A;  3LQH A;  4C9Z A;  4TKP B;  5LCW B;  1JM7 A;  4LK9 A;  2MNY A;  2LGG A;  4UP5 A;  5B77 A;  3RPG C;  1WEQ A;  3N9Q A;  3ZVZ B;  1X4U A;  1WEV A;  2MD8 C;  4O64 A;  4YAD A;  4L7X A;  4WZ3 B;  3PHD A;  2MD7 B;  3KNV A;  3QZV A;  1MM2 A;  2VJE B;  2JMI A;  3DPL R;  3GV4 A;  3HCS A;  4A4C A;  5D1L B;  3N9M A;  1ZBD B;  3T7L A;  3N9N A;  1JM7 B;  4WZ0 A;  4MSX A;  2EGP A;  1WEN A;  2JMD A;  5TDR A;  2L43 A;  3ASL A;  1LDJ B;  2L75 A;  2G43 A;  1V87 A;  2K17 A;  3SHB A;  4LKA A;  3ZVY A;  3LQJ A;  1LDK C;  2HYE D;  3C6W A;  1WEE A;  1Z6U A;  4Q6F A;  3C5K A;  2KFT A;  4LLB A;  1VD4 A;  2YHO A;  2DX8 A;  1HYI A;  1DVP A;  4BBQ A;  2LGK A;  5AIU A;  4I7C A;  2ECV A;  4FIP A;  1WEO A;  2MUM A;  4YBT A;  3KQI A;  5FB1 A;  5LKZ A;  1RMD A;  4YC9 A;  3ZYQ A;  3RPG B;  2KYU A;  5LKT A;  1E4U A;  2PNX A;  4YBM A;  4WZ2 A;  2YRE A;  5H1V A;  4N3W A;  2KR4 A;  2F6N A;  5D1M B;  3PUR A;  4ZQL A;  5JG6 A;  1WEU A;  2Y43 A;  5LKX A;  3PUQ A;  2VPE A;  3I2D A;  3MHH A;  1Z2Q A;  4WA6 A;  2YYR A;  2ECT A;  4R8P K;  5DKA A;  2OXQ C;  4V3L C;  3O33 A;  2LN0 A;  2M3H A;  2H0D A;  3O37 A;  1WGM A;  4YAB A;  2LV9 A;  2PUY A;  5B75 A;  2YQL A;  4I7B A;  2KRE A;  3NG2 A;  2F6J A;  3ZTG A;  3SOX A;  4X3G A;  2CKL A;  2E6R A;  1WEM A;  2ECJ A;  2EOD A;  2VPB A;  1WIM A;  2L5U A;  3HCU A;  5G0F A;  1Z60 A;  2ECG A;  3SOW A;  4L58 A;  2MA5 A;  3U5P A;  2C2V S;  1K2F A;  5B78 A;  2FUI A;  4AUQ B;  4ZDT A;  5DIN A;  5FER A;  1WIL A;  3M99 A;  3N9P A;  4PTB A;  4S3O B;  4R2Y A;  5EYA F;  5TBN A;  5FEY A;  3KV5 A;  2CSY A;  5C13 A;  4FJC A;  4S3O C;  2LQ6 A;  2MIQ A;  3L1X A;  4FO9 A;  2MA6 A;  3DQV R;  4YAT A;  3V43 A;  5FB0 A;  1CHC A;  3SOU A;  3KV6 A;  3HTK C;  3EB6 A;  2M1R A;  2KWJ A;  4AYC A;  2UZG A;  2VPD A;  4W4U A;  4A49 A;  2Y1M A;  2YT5 A;  5B79 A;  2YSM A;  4CCG X;  2YHN A;  5KH3 A;  4AP4 A;  2IDA A;  2KWO A;  3N9L A;  4PPE A;  3FL2 A;  2VJF B;  4UP0 A;  5H1T A;  4IC3 A;  2FUU A;  2MNZ A;  4I7D A;  1T1H A;  2KIZ A;  2EA6 A;  2D8S A;  1VYX A;  3EB5 A;  2KGI A;  4AVX A;  1IYM A;  1U6G B;  4GB0 A;  2E6S A;  3U5N A;  4N4F A;  4GNF A;  3ZPV E;  4R7E A;  2YU4 A;  3MHS A;  2KWK A;  2KE1 A;  2ZET C;  2K1J A;  1VFY A;  4LAD B;  5TRB A;  2RI7 A;  3M62 A;  2M6M A;  2BAY A;  2K16 A;  1WEP A;  5H9M A;  2XB1 A;  3O34 A;  2FSA A;  5G04 B;  2XEU A;  2KGG A;  3M63 A;  5TDW A;  1BOR A;  2ECW A;  3GL6 A;  4V3K C;  4F52 B;  4ZUX U;  2LGV A;  2L80 A;  4IC2 A;  4MVT A;  2Y1N A;  4QF2 A;  1WE9 A;  4A4B A;  3VK6 A;  1X4J A;  3ZNI A;  2VPG A;  1WFK A;  4LJN A;  2QJ0 A;  5B8D A;  3O35 A;  2YQM A;  3RTR B;  2YUC A;  5I3L A;  5J3X A;  5KH9 A;  4A0C D;  4GNG A;  2VP7 A;  2VNF A;  4BHW A;  2M85 A;  3L1Z B;  1N87 A;  2YW8 A;  4YAX A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 3L11 A;  5G05 B;  3N9O A;  2YUR A;  4QF3 A;  2LRI C;  2YSJ A;  4B86 C;  4NN2 A;  4GNE A;  4CA1 A;  2LXH C;  2HDP A;  2G45 A;  4XI1 A;  1JOC A;  3O7A A;  2CSZ A;  4P5O B;  3LQI A;  3LRQ A;  2CT2 A;  1XWH A;  4O62 A;  1HYJ A;  2KWN A;  5C11 A;  4FK5 A;  3DWD A;  4GND A;  1FP0 A;  2H0D B;  3M7K A;  2ECN A;  2RSD A;  5TAB A;  2L0B A;  2QIC A;  3ZPV 1;  1F62 A;  2K4D A;  2LDR A;  1G25 A;  2NAA A;  4YBS A;  1FBV A;  2JRJ A;  2CKL B;  2XOY A;  4OGC A;  2KU3 A;  3O70 A;  2QIZ A;  1MM3 A;  2I50 A;  3U5M A;  2C2L A;  2F42 A;  3IHP A;  2JMJ A;  5KH7 A;  3HCT A;  2CON A;  2MT5 A;  5B76 A;  2LGL A;  3U5O A;  5LKU A;  2VJE A;  4B7Y C;  1WES A;  4AYC B;  5AIT A;  5H1U A;  1X4I A;  2G6Q A;  2RR4 A;  4UI9 B;  3O36 A;  3T9K A;  3T6R A;  1WEW A;  2ECI A;  2LXP C;  5D1K B;  2VJF A;  3LQH A;  4C9Z A;  4TKP B;  5LCW B;  1JM7 A;  3LVR E;  4LK9 A;  2MNY A;  2LGG A;  4UP5 A;  5B77 A;  3RPG C;  1WEQ A;  3N9Q A;  3ZVZ B;  3LJU X;  1X4U A;  1WEV A;  2MD8 C;  4O64 A;  4YAD A;  4L7X A;  4WZ3 B;  3PHD A;  2LAU A;  2MD7 B;  3FAO A;  3KNV A;  1MM2 A;  3QZV A;  2VJE B;  2JMI A;  3DPL R;  3GV4 A;  3HCS A;  5SVY A;  4A4C A;  5D1L B;  3N9M A;  4Z0O A;  1ZBD B;  3T7L A;  3O47 A;  3N9N A;  1JM7 B;  4WZ0 A;  4MSX A;  2EGP A;  1WEN A;  3KDE C;  2JMD A;  5TDR A;  2L43 A;  3ASL A;  1LDJ B;  3FM8 C;  2EXU A;  2G43 A;  2L75 A;  2MKE A;  1V87 A;  2K17 A;  3SHB A;  4LKA A;  5K3Q A;  3ZVY A;  3LQJ A;  1LDK C;  2HYE D;  3C6W A;  1WEE A;  1Z6U A;  4Q6F A;  3C5K A;  2KFT A;  4LLB A;  4OGE A;  1VD4 A;  2YHO A;  2DX8 A;  1HYI A;  1DVP A;  4BBQ A;  2LGK A;  5AIU A;  4I7C A;  2ECV A;  2CRW A;  4FIP A;  1WEO A;  2MUM A;  2FD4 A;  4YBT A;  3KQI A;  5FB1 A;  5LKZ A;  1RMD A;  4YC9 A;  3ZYQ A;  3RPG B;  5SVI A;  2KYU A;  5LKT A;  1E4U A;  2PNX A;  4YBM A;  4WZ2 A;  2YRE A;  5H1V A;  4N3W A;  2KR4 A;  2F6N A;  5D1M B;  3PUR A;  4ZQL A;  5JG6 A;  1WEU A;  2Y43 A;  3H7H A;  5LKX A;  3PUQ A;  2VPE A;  3I2D A;  3MHH A;  1Z2Q A;  4WA6 A;  2YYR A;  2ECT A;  4R8P K;  5DKA A;  2OXQ C;  4V3L C;  3O33 A;  2LN0 A;  2M3H A;  2H0D A;  3O37 A;  1WGM A;  4YAB A;  3E2D A;  2P57 A;  2LV9 A;  5SVX A;  2PUY A;  5B75 A;  2YQL A;  3MDB C;  2E61 A;  4I7B A;  2KRE A;  3NG2 A;  2XOC A;  2F6J A;  2M13 A;  3ZTG A;  2CRR A;  3SOX A;  4X3G A;  2CKL A;  2E6R A;  1WEM A;  2ECJ A;  2EOD A;  2VPB A;  1WIM A;  2L5U A;  3HCU A;  5G0F A;  3FAN A;  1Z60 A;  2ECG A;  3SOW A;  4L58 A;  2MA5 A;  3U5P A;  2C2V S;  1K2F A;  5B78 A;  2FUI A;  4AUQ B;  4ZDT A;  5DIN A;  5FER A;  1WIL A;  3M99 A;  3N9P A;  4PTB A;  4S3O B;  4R2Y A;  5EYA F;  5TBN A;  5FEY A;  2JUN A;  3KV5 A;  2CSY A;  2IQJ A;  5C13 A;  4FJC A;  3JUE A;  4S3O C;  2LQ6 A;  2DJA A;  2MIQ A;  3L1X A;  4FO9 A;  2MA6 A;  3DQV R;  2XOZ A;  4YAT A;  3V43 A;  2D8U A;  5FB0 A;  1CHC A;  3SOU A;  2CSV A;  3KV6 A;  3HTK C;  3EB6 A;  2M1R A;  2OWA A;  2KWJ A;  3FJU B;  4AYC A;  2UZG A;  2VPD A;  4W4U A;  4A49 A;  2Y1M A;  2YT5 A;  5B79 A;  2YSM A;  4CCG X;  2YHN A;  5KH3 A;  4AP4 A;  4H9D A;  2IDA A;  2B0O E;  3LDY A;  2KWO A;  3N9L A;  4PPE A;  3FL2 A;  2VJF B;  4QQ4 A;  4UP0 A;  5H1T A;  4IC3 A;  2FUU A;  2JM3 A;  2DSM A;  2MNZ A;  4I7D A;  1T1H A;  2KIZ A;  2EA6 A;  2D8S A;  1VYX A;  3EB5 A;  2KGI A;  4AVX A;  1IYM A;  1U6G B;  3DDT A;  2EGM A;  4GB0 A;  2E6S A;  2FFW A;  3U5N A;  3FEH A;  4N4F A;  4Z0R A;  4GNF A;  3ZPV E;  4R7E A;  2YU4 A;  3MHS A;  2KWK A;  2KE1 A;  2KKY A;  2ZET C;  2K1J A;  3LVQ E;  1VFY A;  4LAD B;  5TRB A;  2RI7 A;  3M62 A;  2M6M A;  2BAY A;  2K16 A;  2XP0 A;  1WEP A;  5H9M A;  2XB1 A;  3O34 A;  2FSA A;  5G04 B;  1DCQ A;  4F1P A;  2XEU A;  2KGG A;  3M63 A;  5TDW A;  1BOR A;  5SVI B;  2ECW A;  3GL6 A;  4V3K C;  4F52 B;  2L7P A;  4ZUX U;  2LGV A;  2L80 A;  4MVT A;  4IC2 A;  3PLW A;  2Y1N A;  4QF2 A;  1WE9 A;  4A4B A;  3VK6 A;  1X4J A;  3ZNI A;  3SUB A;  2VPG A;  1WFK A;  4LJN A;  2QJ0 A;  2KKX A;  5B8D A;  3O35 A;  2YQM A;  3RTR B;  2YUC A;  5I3L A;  5J3X A;  5KH9 A;  2YVR A;  4A0C D;  1MBM A;  4GNG A;  2VP7 A;  2VNF A;  4BHW A;  2M85 A;  3Q1D A;  3L1Z B;  1N87 A;  2YW8 A;  4YAX A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 3L11 A;  5G05 B;  3N9O A;  2YUR A;  4QF3 A;  2LRI C;  2YSJ A;  4B86 C;  4NN2 A;  4GNE A;  4CA1 A;  2LXH C;  2HDP A;  2G45 A;  4XI1 A;  1JOC A;  3O7A A;  2CSZ A;  4P5O B;  3LQI A;  3LRQ A;  2CT2 A;  1XWH A;  1HYJ A;  2KWN A;  5C11 A;  4FK5 A;  4GND A;  1FP0 A;  2H0D B;  2ECN A;  2RSD A;  5TAB A;  2L0B A;  2QIC A;  3ZPV 1;  1F62 A;  2K4D A;  2LDR A;  1G25 A;  2NAA A;  4YBS A;  1FBV A;  2JRJ A;  2CKL B;  2KU3 A;  3O70 A;  2QIZ A;  1MM3 A;  2I50 A;  3U5M A;  2C2L A;  2F42 A;  3IHP A;  2JMJ A;  5KH7 A;  3HCT A;  2MT5 A;  5B76 A;  2LGL A;  3U5O A;  5LKU A;  2VJE A;  4B7Y C;  1WES A;  4AYC B;  5AIT A;  5H1U A;  1X4I A;  2G6Q A;  4UI9 B;  3O36 A;  3T6R A;  1WEW A;  2ECI A;  2LXP C;  5D1K B;  2VJF A;  3LQH A;  4C9Z A;  4TKP B;  5LCW B;  1JM7 A;  4LK9 A;  2MNY A;  2LGG A;  4UP5 A;  5B77 A;  3RPG C;  1WEQ A;  3N9Q A;  3ZVZ B;  1X4U A;  1WEV A;  2MD8 C;  4O64 A;  4YAD A;  4L7X A;  4WZ3 B;  3PHD A;  2MD7 B;  3KNV A;  3QZV A;  1MM2 A;  2VJE B;  2JMI A;  3DPL R;  3GV4 A;  3HCS A;  4A4C A;  5D1L B;  3N9M A;  1ZBD B;  3T7L A;  3N9N A;  1JM7 B;  4WZ0 A;  4MSX A;  2EGP A;  1WEN A;  2JMD A;  5TDR A;  2L43 A;  3ASL A;  1LDJ B;  2L75 A;  2G43 A;  1V87 A;  2K17 A;  3SHB A;  4LKA A;  3ZVY A;  3LQJ A;  1LDK C;  2HYE D;  3C6W A;  1WEE A;  1Z6U A;  4Q6F A;  3C5K A;  2KFT A;  4LLB A;  1VD4 A;  2YHO A;  2DX8 A;  1HYI A;  1DVP A;  4BBQ A;  2LGK A;  5AIU A;  4I7C A;  2ECV A;  4FIP A;  1WEO A;  2MUM A;  4YBT A;  3KQI A;  5FB1 A;  5LKZ A;  1RMD A;  4YC9 A;  3ZYQ A;  3RPG B;  2KYU A;  5LKT A;  1E4U A;  2PNX A;  4YBM A;  4WZ2 A;  2YRE A;  5H1V A;  4N3W A;  2KR4 A;  2F6N A;  5D1M B;  3PUR A;  4ZQL A;  5JG6 A;  1WEU A;  2Y43 A;  5LKX A;  3PUQ A;  2VPE A;  3I2D A;  3MHH A;  1Z2Q A;  4WA6 A;  2YYR A;  2ECT A;  4R8P K;  5DKA A;  2OXQ C;  4V3L C;  3O33 A;  2LN0 A;  2M3H A;  2H0D A;  3O37 A;  1WGM A;  4YAB A;  2LV9 A;  2PUY A;  5B75 A;  2YQL A;  4I7B A;  2KRE A;  3NG2 A;  2F6J A;  3ZTG A;  3SOX A;  4X3G A;  2CKL A;  2E6R A;  1WEM A;  2ECJ A;  2EOD A;  2VPB A;  1WIM A;  2L5U A;  3HCU A;  5G0F A;  1Z60 A;  2ECG A;  3SOW A;  4L58 A;  2MA5 A;  3U5P A;  2C2V S;  1K2F A;  5B78 A;  2FUI A;  4AUQ B;  4ZDT A;  5DIN A;  5FER A;  1WIL A;  3M99 A;  3N9P A;  4PTB A;  4S3O B;  4R2Y A;  5EYA F;  5TBN A;  5FEY A;  3KV5 A;  2CSY A;  5C13 A;  4FJC A;  4S3O C;  2LQ6 A;  2MIQ A;  3L1X A;  4FO9 A;  2MA6 A;  3DQV R;  4YAT A;  3V43 A;  5FB0 A;  1CHC A;  3SOU A;  3KV6 A;  3HTK C;  3EB6 A;  2M1R A;  2KWJ A;  4AYC A;  2UZG A;  2VPD A;  4W4U A;  4A49 A;  2Y1M A;  2YT5 A;  5B79 A;  2YSM A;  4CCG X;  2YHN A;  5KH3 A;  4AP4 A;  2IDA A;  2KWO A;  3N9L A;  4PPE A;  3FL2 A;  2VJF B;  4UP0 A;  5H1T A;  4IC3 A;  2FUU A;  2MNZ A;  4I7D A;  1T1H A;  2KIZ A;  2EA6 A;  2D8S A;  1VYX A;  3EB5 A;  2KGI A;  4AVX A;  1IYM A;  1U6G B;  4GB0 A;  2E6S A;  3U5N A;  4N4F A;  4GNF A;  3ZPV E;  4R7E A;  2YU4 A;  3MHS A;  2KWK A;  2KE1 A;  2ZET C;  2K1J A;  1VFY A;  4LAD B;  5TRB A;  2RI7 A;  3M62 A;  2M6M A;  2BAY A;  2K16 A;  1WEP A;  5H9M A;  2XB1 A;  3O34 A;  2FSA A;  5G04 B;  2XEU A;  2KGG A;  3M63 A;  5TDW A;  1BOR A;  2ECW A;  3GL6 A;  4V3K C;  4F52 B;  4ZUX U;  2LGV A;  2L80 A;  4IC2 A;  4MVT A;  2Y1N A;  4QF2 A;  1WE9 A;  4A4B A;  3VK6 A;  1X4J A;  3ZNI A;  2VPG A;  1WFK A;  4LJN A;  2QJ0 A;  5B8D A;  3O35 A;  2YQM A;  3RTR B;  2YUC A;  5I3L A;  5J3X A;  5KH9 A;  4A0C D;  4GNG A;  2VP7 A;  2VNF A;  4BHW A;  2M85 A;  3L1Z B;  1N87 A;  2YW8 A;  4YAX A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...