2YURA

Solution structure of the ring finger of human retinoblastoma-binding protein 6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
74
structure length
74
Chain Sequence
GSSGSSGEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Ring finger of human Retinoblastoma-binding protein 6
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Retinoblastoma-binding protein 6
total genus 3
structure length 74
sequence length 74
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yurA00
5LKZA 4CCGX 4B7YC 2CSYA 3O36A 1X4IA 4A4BA 3N9MA 2QJ0A 3NG2A 5DKAA 2CKLA 4GNEA 4B86C 2YQMA 5AIUA 2E6SA 2EODA 5KH9A 2M6MA 5FB0A 4AP4A 5J3XA 5D1MB 3ZPVE 2XB1A 3KV5A 4Q6FA 1MM3A 4V3LC 1X4UA 1WEWA 1BORA 4FK5A 2KFTA 4PTBA 2L75A 4YADA 3U5MA 4YBMA 5AITA 1WESA 2ECIA 3KV6A 2RSDA 1F62A 1VD4A 4LKAA 3DPLR 4UP5A 4ZUXU 2ECWA 4AUQB 2K1JA 3LRQA 2M85A 2MNZA 5LKUA 2VJFA 2K16A 4NN2A 2KE1A 2LN0A 3O37A 3PHDA 3N9OA 2NAAA 2LGVA 4AYCA 2C2LA 4W4UA 5B8DA 2YHNA 2D8SA 2ECGA 2KWOA 2KWKA 2MT5A 2G43A 2Y1MA 3PUQA 1LDKC 2LGKA 4I7BA 3MHSA 5C11A 2VPGA 3M62A 4YC9A 1Z2QA 4X3GA 2BAYA 4N3WA 3PURA 1MM2A 5FB1A 2LV9A 5B77A 5TDWA 2KWNA 4GNGA 2LGGA 1WIMA 2I50A 2G6QA 3U5OA 5DINA 2KR4A 1K2FA 3RPGB 4I7DA 2ZETC 2LXHC 1WEQA 2VJEB 4P5OB 3RTRB 3T6RA 5D1KB 2VP7A 4AVXA 3ZVYA 5G05B 1FBVA 2LRIC 4MSXA 3MHHA 1XWHA 3O35A 4F52B 4WZ3B 2VJEA 4UI9B 2LQ6A 5B75A 2HYED 1WEEA 2JMDA 1Z6UA 2PUYA 1WEVA 2L43A 2JRJA 1WEPA 2KIZA 4CA1A 4A4CA 4WA6A 3ZTGA 1WEUA 4FIPA 2YSJA 2KGIA 2KU3A 5TRBA 5B79A 3GL6A 3LQHA 3T7LA 3ASLA 2M1RA 5KH7A 2AN6A 5B76A 1LDJB 1WENA 2VNFA 4A0CD 5H1TA 3I2DA 4YABA 2FUIA 2K17A 4ZQLA 2CSZA 2LXPC 2PNXA 5H1UA 2F42A 4MVTA 2VJFB 1RMDA 4R2YA 2YSMA 1ZBDB 4GB0A 3ZYQA 2Y43A 2CKLB 4LK9A 5LKXA 4L58A 4IC2A 2JMJA 4TKPB 3ZNIA 1U6GB 3SOXA 3KNVA 2QICA 2KGGA 4C9ZA 2UZGA 3QZVA 3C5KA 2DX8A 4GNFA 2OXQC 2YUCA 5TABA 3O33A 4FJCA 2ECVA 1VFYA 2K4DA 5I3LA 4LLBA 5LKTA 5FERA 2EA6A 1CHCA 4YBTA 4V3KC 3SOWA 3GV4A 1DVPA 4AYCB 4YATA 1N87A 4R8PK 1IYMA 2FUUA 2MUMA 3HCTA 5D1LB 4N4FA 4WZ2A 3L1XA 5FEYA 2CT2A 4L7XA 2IDAA 2VPBA 3ZPV1 3N9NA 1G25A 2ECTA 1WEMA 4O64A 2KWJA 4QF2A 5TBNA 4R7EA 4GNDA 3L11A 2LGLA 3L1ZB 3VK6A 3N9PA 2H0DB 1JOCA 2MA5A 2L0BA 1V87A 2F6JA 3O7AA 3KQIA 2ECNA 2QIZA 1Z60A 3IHPA 4PPEA 3LQJA 3M63A 3SOUA 3N9LA 2MNYA 1T1HA 2HDPA 1WGMA 4WZ0A 2KREA 3ZVZB 2Y1NA 1VYXA 5JG6A 3EB6A 2E6RA 4XI1A 4S3OC 3C6WA 4FO9A 2EGPA 3HCSA 2YT5A 1HYJA 3O70A 5EYAF 4S3OB 2XEUA 4LADB 1FP0A 5KH3A 5G0FA 2YU4A 1JM7B 4LJNA 2YURA 2L5UA 3V43A 1WE9A 2YREA 2F6NA 2MD8C 2VPDA 2YYRA 2ECJA 3HTKC 5H1VA 1WEOA 4YBSA 3HCUA 2MA6A 5C13A 5G04B 3EB5A 3M99A 3DQVR 1WFKA 4ZDTA 4I7CA 2L80A 1WILA 4QF3A 4YAXA 5B78A 2LDRA 5TDRA 4UP0A 2YW8A 3FL2A 3SHBA 3RPGC 2MIQA 3O34A 2RI7A 5LCWB 2MD7B 3LQIA 2FSAA 2YHOA 3U5NA 1HYIA 2C2VS 2G45A 3U5PA 2H0DA 4IC3A 4BHWA 3N9QA 1X4JA 4A49A 1E4UA 2YQLA 2KYUA 2VPEA 4BBQA 1JM7A 2JMIA 2M3HA 5H9MA
chains in the Genus database with same CATH superfamily
2XOZA 5LKZA 4CCGX 4B7YC 2CSYA 3O36A 1X4IA 4A4BA 2JUNA 3N9MA 2QJ0A 3NG2A 5DKAA 2CKLA 4GNEA 4B86C 2YQMA 5AIUA 4Z0RA 2E6SA 2EODA 5KH9A 2M6MA 5FB0A 4AP4A 5J3XA 5D1MB 3ZPVE 2XB1A 3KV5A 4Q6FA 1MM3A 4V3LC 1X4UA 1WEWA 1BORA 4FK5A 2E61A 2KFTA 3DWDA 4PTBA 2L75A 4YADA 3U5MA 4YBMA 5AITA 1WESA 2ECIA 3KV6A 2RSDA 1F62A 1MBMA 1VD4A 4LKAA 5SVYA 3DPLR 4Z0OA 4UP5A 4ZUXU 2ECWA 5SVIB 4AUQB 2K1JA 3LRQA 2M85A 2MNZA 3PLWA 5LKUA 2VJFA 2K16A 4NN2A 2KE1A 2LN0A 3O37A 3PHDA 3N9OA 2NAAA 3MDBC 2LGVA 4AYCA 2C2LA 2YVRA 4W4UA 5B8DA 2YHNA 2D8SA 2ECGA 2IQJA 2KWOA 2KWKA 2MT5A 2G43A 2Y1MA 3PUQA 1LDKC 2LGKA 4I7BA 3MHSA 3LVQE 5C11A 2VPGA 3M62A 4YC9A 1Z2QA 4X3GA 2BAYA 4N3WA 3PURA 1MM2A 5FB1A 2LV9A 5B77A 5TDWA 2KWNA 2D8UA 4GNGA 2LGGA 1WIMA 2I50A 2G6QA 3U5OA 3KDEC 5DINA 2KR4A 1K2FA 3RPGB 4H9DA 2LAUA 4I7DA 2ZETC 2LXHC 1WEQA 2VJEB 4P5OB 3RTRB 3T6RA 5D1KB 3E2DA 2VP7A 4AVXA 3ZVYA 5G05B 1FBVA 2LRIC 4MSXA 3MHHA 1XWHA 3O35A 4F52B 4WZ3B 2VJEA 4UI9B 3JUEA 2LQ6A 5B75A 2HYED 1WEEA 2JMDA 1Z6UA 2PUYA 1WEVA 2L43A 2JRJA 1WEPA 2KIZA 4CA1A 4A4CA 2L7PA 2FD4A 3FM8C 4WA6A 3ZTGA 1WEUA 4FIPA 2YSJA 2KGIA 2DSMA 2B0OE 5SVIA 2KU3A 5TRBA 5B79A 3GL6A 3LQHA 3T7LA 3ASLA 2M1RA 5KH7A 2AN6A 5B76A 1LDJB 1WENA 2VNFA 4A0CD 3H7HA 5H1TA 3I2DA 4YABA 2FUIA 2K17A 4ZQLA 2CSZA 2LXPC 2PNXA 2KKXA 2CSVA 5H1UA 3LJUX 2F42A 4MVTA 2VJFB 1RMDA 4OGCA 4R2YA 2YSMA 1ZBDB 4GB0A 3ZYQA 2Y43A 2CKLB 4LK9A 5LKXA 4L58A 4IC2A 4QQ4A 2JMJA 4TKPB 1DCQA 3ZNIA 1U6GB 3SOXA 3KNVA 3DDTA 2XOCA 2FFWA 2QICA 2KGGA 4C9ZA 2UZGA 3QZVA 3C5KA 2DX8A 4GNFA 2OXQC 2KKYA 2YUCA 2CRRA 5TABA 3O33A 4FJCA 2ECVA 2EGMA 1VFYA 2K4DA 5I3LA 2EXUA 4LLBA 5LKTA 5FERA 2EA6A 1CHCA 4YBTA 4V3KC 3SOWA 3GV4A 1DVPA 4AYCB 4YATA 1N87A 4R8PK 1IYMA 2FUUA 2MUMA 3HCTA 5D1LB 4N4FA 3O47A 4WZ2A 3L1XA 5FEYA 2CT2A 4L7XA 2IDAA 2VPBA 3ZPV1 3N9NA 3FJUB 1G25A 4O62A 2ECTA 1WEMA 4O64A 2KWJA 4QF2A 5TBNA 4R7EA 3SUBA 4GNDA 3L11A 2LGLA 3L1ZB 3VK6A 3N9PA 2H0DB 1JOCA 2MA5A 2L0BA 1V87A 2F6JA 3O7AA 3KQIA 2ECNA 2QIZA 1Z60A 3IHPA 4PPEA 3T9KA 3LQJA 2OWAA 3M63A 3Q1DA 3SOUA 3N9LA 2MNYA 1T1HA 2HDPA 1WGMA 4WZ0A 3M7KA 2KREA 2P57A 3ZVZB 2CONA 2Y1NA 1VYXA 2CRWA 3LVRE 5JG6A 3FEHA 3EB6A 2E6RA 4XI1A 4S3OC 3C6WA 4FO9A 2EGPA 3HCSA 2YT5A 1HYJA 3O70A 5EYAF 4S3OB 2XEUA 5SVXA 4LADB 1FP0A 5KH3A 5G0FA 2YU4A 1JM7B 4LJNA 2M13A 2YURA 2L5UA 4OGEA 3V43A 1WE9A 2YREA 2F6NA 2MD8C 2VPDA 2YYRA 2ECJA 2RR4A 3HTKC 5H1VA 1WEOA 4YBSA 3HCUA 2MA6A 5C13A 5G04B 3EB5A 3M99A 4F1PA 3DQVR 1WFKA 4ZDTA 4I7CA 2L80A 1WILA 2MKEA 4QF3A 4YAXA 3FAOA 5B78A 2LDRA 3LDYA 5TDRA 4UP0A 2YW8A 3FANA 3FL2A 3SHBA 3RPGC 2MIQA 3O34A 2RI7A 5LCWB 2MD7B 2XOYA 3LQIA 2DJAA 2FSAA 2JM3A 2XP0A 2YHOA 3U5NA 5K3QA 1HYIA 2C2VS 2G45A 3U5PA 2H0DA 4IC3A 4BHWA 3N9QA 1X4JA 4A49A 1E4UA 2YQLA 2KYUA 2VPEA 4BBQA 1JM7A 2JMIA 2M3HA 5H9MA
chains in the Genus database with same CATH topology
5LKZA 4CCGX 4B7YC 2CSYA 3O36A 1X4IA 4A4BA 3N9MA 2QJ0A 3NG2A 5DKAA 2CKLA 4GNEA 4B86C 2YQMA 5AIUA 2E6SA 2EODA 5KH9A 2M6MA 5FB0A 4AP4A 5J3XA 5D1MB 3ZPVE 2XB1A 3KV5A 4Q6FA 1MM3A 4V3LC 1X4UA 1WEWA 1BORA 4FK5A 2KFTA 4PTBA 2L75A 4YADA 3U5MA 4YBMA 5AITA 1WESA 2ECIA 3KV6A 2RSDA 1F62A 1VD4A 4LKAA 3DPLR 4UP5A 4ZUXU 2ECWA 4AUQB 2K1JA 3LRQA 2M85A 2MNZA 5LKUA 2VJFA 2K16A 4NN2A 2KE1A 2LN0A 3O37A 3PHDA 3N9OA 2NAAA 2LGVA 4AYCA 2C2LA 4W4UA 5B8DA 2YHNA 2D8SA 2ECGA 2KWOA 2KWKA 2MT5A 2G43A 2Y1MA 3PUQA 1LDKC 2LGKA 4I7BA 3MHSA 5C11A 2VPGA 3M62A 4YC9A 1Z2QA 4X3GA 2BAYA 4N3WA 3PURA 1MM2A 5FB1A 2LV9A 5B77A 5TDWA 2KWNA 4GNGA 2LGGA 1WIMA 2I50A 2G6QA 3U5OA 5DINA 2KR4A 1K2FA 3RPGB 4I7DA 2ZETC 2LXHC 1WEQA 2VJEB 4P5OB 3RTRB 3T6RA 5D1KB 2VP7A 4AVXA 3ZVYA 5G05B 1FBVA 2LRIC 4MSXA 3MHHA 1XWHA 3O35A 4F52B 4WZ3B 2VJEA 4UI9B 2LQ6A 5B75A 2HYED 1WEEA 2JMDA 1Z6UA 2PUYA 1WEVA 2L43A 2JRJA 1WEPA 2KIZA 4CA1A 4A4CA 4WA6A 3ZTGA 1WEUA 4FIPA 2YSJA 2KGIA 2KU3A 5TRBA 5B79A 3GL6A 3LQHA 3T7LA 3ASLA 2M1RA 5KH7A 2AN6A 5B76A 1LDJB 1WENA 2VNFA 4A0CD 5H1TA 3I2DA 4YABA 2FUIA 2K17A 4ZQLA 2CSZA 2LXPC 2PNXA 5H1UA 2F42A 4MVTA 2VJFB 1RMDA 4R2YA 2YSMA 1ZBDB 4GB0A 3ZYQA 2Y43A 2CKLB 4LK9A 5LKXA 4L58A 4IC2A 2JMJA 4TKPB 3ZNIA 1U6GB 3SOXA 3KNVA 2QICA 2KGGA 4C9ZA 2UZGA 3QZVA 3C5KA 2DX8A 4GNFA 2OXQC 2YUCA 5TABA 3O33A 4FJCA 2ECVA 1VFYA 2K4DA 5I3LA 4LLBA 5LKTA 5FERA 2EA6A 1CHCA 4YBTA 4V3KC 3SOWA 3GV4A 1DVPA 4AYCB 4YATA 1N87A 4R8PK 1IYMA 2FUUA 2MUMA 3HCTA 5D1LB 4N4FA 4WZ2A 3L1XA 5FEYA 2CT2A 4L7XA 2IDAA 2VPBA 3ZPV1 3N9NA 1G25A 2ECTA 1WEMA 4O64A 2KWJA 4QF2A 5TBNA 4R7EA 4GNDA 3L11A 2LGLA 3L1ZB 3VK6A 3N9PA 2H0DB 1JOCA 2MA5A 2L0BA 1V87A 2F6JA 3O7AA 3KQIA 2ECNA 2QIZA 1Z60A 3IHPA 4PPEA 3LQJA 3M63A 3SOUA 3N9LA 2MNYA 1T1HA 2HDPA 1WGMA 4WZ0A 2KREA 3ZVZB 2Y1NA 1VYXA 5JG6A 3EB6A 2E6RA 4XI1A 4S3OC 3C6WA 4FO9A 2EGPA 3HCSA 2YT5A 1HYJA 3O70A 5EYAF 4S3OB 2XEUA 4LADB 1FP0A 5KH3A 5G0FA 2YU4A 1JM7B 4LJNA 2YURA 2L5UA 3V43A 1WE9A 2YREA 2F6NA 2MD8C 2VPDA 2YYRA 2ECJA 3HTKC 5H1VA 1WEOA 4YBSA 3HCUA 2MA6A 5C13A 5G04B 3EB5A 3M99A 3DQVR 1WFKA 4ZDTA 4I7CA 2L80A 1WILA 4QF3A 4YAXA 5B78A 2LDRA 5TDRA 4UP0A 2YW8A 3FL2A 3SHBA 3RPGC 2MIQA 3O34A 2RI7A 5LCWB 2MD7B 3LQIA 2FSAA 2YHOA 3U5NA 1HYIA 2C2VS 2G45A 3U5PA 2H0DA 4IC3A 4BHWA 3N9QA 1X4JA 4A49A 1E4UA 2YQLA 2KYUA 2VPEA 4BBQA 1JM7A 2JMIA 2M3HA 5H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKZ A;  4CCG X;  4B7Y C;  2CSY A;  3O36 A;  1X4I A;  4A4B A;  3N9M A;  2QJ0 A;  3NG2 A;  5DKA A;  2CKL A;  4GNE A;  4B86 C;  2YQM A;  5AIU A;  2E6S A;  2EOD A;  5KH9 A;  2M6M A;  5FB0 A;  4AP4 A;  5J3X A;  5D1M B;  3ZPV E;  2XB1 A;  3KV5 A;  4Q6F A;  1MM3 A;  4V3L C;  1X4U A;  1WEW A;  1BOR A;  4FK5 A;  2KFT A;  4PTB A;  2L75 A;  4YAD A;  3U5M A;  4YBM A;  5AIT A;  1WES A;  2ECI A;  3KV6 A;  2RSD A;  1F62 A;  1VD4 A;  4LKA A;  3DPL R;  4UP5 A;  4ZUX U;  2ECW A;  4AUQ B;  2K1J A;  3LRQ A;  2M85 A;  2MNZ A;  5LKU A;  2VJF A;  2K16 A;  4NN2 A;  2KE1 A;  2LN0 A;  3O37 A;  3PHD A;  3N9O A;  2NAA A;  2LGV A;  4AYC A;  2C2L A;  4W4U A;  5B8D A;  2YHN A;  2D8S A;  2ECG A;  2KWO A;  2KWK A;  2MT5 A;  2G43 A;  2Y1M A;  3PUQ A;  1LDK C;  2LGK A;  4I7B A;  3MHS A;  5C11 A;  2VPG A;  3M62 A;  4YC9 A;  1Z2Q A;  4X3G A;  2BAY A;  4N3W A;  3PUR A;  1MM2 A;  5FB1 A;  2LV9 A;  5B77 A;  5TDW A;  2KWN A;  4GNG A;  2LGG A;  1WIM A;  2I50 A;  2G6Q A;  3U5O A;  5DIN A;  2KR4 A;  1K2F A;  3RPG B;  4I7D A;  2ZET C;  2LXH C;  1WEQ A;  2VJE B;  4P5O B;  3RTR B;  3T6R A;  5D1K B;  2VP7 A;  4AVX A;  3ZVY A;  5G05 B;  1FBV A;  2LRI C;  4MSX A;  3MHH A;  1XWH A;  3O35 A;  4F52 B;  4WZ3 B;  2VJE A;  4UI9 B;  2LQ6 A;  5B75 A;  2HYE D;  1WEE A;  2JMD A;  1Z6U A;  2PUY A;  1WEV A;  2L43 A;  2JRJ A;  1WEP A;  2KIZ A;  4CA1 A;  4A4C A;  4WA6 A;  3ZTG A;  1WEU A;  4FIP A;  2YSJ A;  2KGI A;  2KU3 A;  5TRB A;  5B79 A;  3GL6 A;  3LQH A;  3T7L A;  3ASL A;  2M1R A;  5KH7 A;  2AN6 A;  5B76 A;  1LDJ B;  1WEN A;  2VNF A;  4A0C D;  5H1T A;  3I2D A;  4YAB A;  2FUI A;  2K17 A;  4ZQL A;  2CSZ A;  2LXP C;  2PNX A;  5H1U A;  2F42 A;  4MVT A;  2VJF B;  1RMD A;  4R2Y A;  2YSM A;  1ZBD B;  4GB0 A;  3ZYQ A;  2Y43 A;  2CKL B;  4LK9 A;  5LKX A;  4L58 A;  4IC2 A;  2JMJ A;  4TKP B;  3ZNI A;  1U6G B;  3SOX A;  3KNV A;  2QIC A;  2KGG A;  4C9Z A;  2UZG A;  3QZV A;  3C5K A;  2DX8 A;  4GNF A;  2OXQ C;  2YUC A;  5TAB A;  3O33 A;  4FJC A;  2ECV A;  1VFY A;  2K4D A;  5I3L A;  4LLB A;  5LKT A;  5FER A;  2EA6 A;  1CHC A;  4YBT A;  4V3K C;  3SOW A;  3GV4 A;  1DVP A;  4AYC B;  4YAT A;  1N87 A;  4R8P K;  1IYM A;  2FUU A;  2MUM A;  3HCT A;  5D1L B;  4N4F A;  4WZ2 A;  3L1X A;  5FEY A;  2CT2 A;  4L7X A;  2IDA A;  2VPB A;  3ZPV 1;  3N9N A;  1G25 A;  2ECT A;  1WEM A;  4O64 A;  2KWJ A;  4QF2 A;  5TBN A;  4R7E A;  4GND A;  3L11 A;  2LGL A;  3L1Z B;  3VK6 A;  3N9P A;  2H0D B;  1JOC A;  2MA5 A;  2L0B A;  1V87 A;  2F6J A;  3O7A A;  3KQI A;  2ECN A;  2QIZ A;  1Z60 A;  3IHP A;  4PPE A;  3LQJ A;  3M63 A;  3SOU A;  3N9L A;  2MNY A;  1T1H A;  2HDP A;  1WGM A;  4WZ0 A;  2KRE A;  3ZVZ B;  2Y1N A;  1VYX A;  5JG6 A;  3EB6 A;  2E6R A;  4XI1 A;  4S3O C;  3C6W A;  4FO9 A;  2EGP A;  3HCS A;  2YT5 A;  1HYJ A;  3O70 A;  5EYA F;  4S3O B;  2XEU A;  4LAD B;  1FP0 A;  5KH3 A;  5G0F A;  2YU4 A;  1JM7 B;  4LJN A;  2YUR A;  2L5U A;  3V43 A;  1WE9 A;  2YRE A;  2F6N A;  2MD8 C;  2VPD A;  2YYR A;  2ECJ A;  3HTK C;  5H1V A;  1WEO A;  4YBS A;  3HCU A;  2MA6 A;  5C13 A;  5G04 B;  3EB5 A;  3M99 A;  3DQV R;  1WFK A;  4ZDT A;  4I7C A;  2L80 A;  1WIL A;  4QF3 A;  4YAX A;  5B78 A;  2LDR A;  5TDR A;  4UP0 A;  2YW8 A;  3FL2 A;  3SHB A;  3RPG C;  2MIQ A;  3O34 A;  2RI7 A;  5LCW B;  2MD7 B;  3LQI A;  2FSA A;  2YHO A;  3U5N A;  1HYI A;  2C2V S;  2G45 A;  3U5P A;  2H0D A;  4IC3 A;  4BHW A;  3N9Q A;  1X4J A;  4A49 A;  1E4U A;  2YQL A;  2KYU A;  2VPE A;  4BBQ A;  1JM7 A;  2JMI A;  2M3H A;  5H9M A; 
#chains in the Genus database with same CATH topology
 2XOZ A;  5LKZ A;  4CCG X;  4B7Y C;  2CSY A;  3O36 A;  1X4I A;  4A4B A;  2JUN A;  3N9M A;  2QJ0 A;  3NG2 A;  5DKA A;  2CKL A;  4GNE A;  4B86 C;  2YQM A;  5AIU A;  4Z0R A;  2E6S A;  2EOD A;  5KH9 A;  2M6M A;  5FB0 A;  4AP4 A;  5J3X A;  5D1M B;  3ZPV E;  2XB1 A;  3KV5 A;  4Q6F A;  1MM3 A;  4V3L C;  1X4U A;  1WEW A;  1BOR A;  4FK5 A;  2E61 A;  2KFT A;  3DWD A;  4PTB A;  2L75 A;  4YAD A;  3U5M A;  4YBM A;  5AIT A;  1WES A;  2ECI A;  3KV6 A;  2RSD A;  1F62 A;  1MBM A;  1VD4 A;  4LKA A;  5SVY A;  3DPL R;  4Z0O A;  4UP5 A;  4ZUX U;  2ECW A;  5SVI B;  4AUQ B;  2K1J A;  3LRQ A;  2M85 A;  2MNZ A;  3PLW A;  5LKU A;  2VJF A;  2K16 A;  4NN2 A;  2KE1 A;  2LN0 A;  3O37 A;  3PHD A;  3N9O A;  2NAA A;  3MDB C;  2LGV A;  4AYC A;  2C2L A;  2YVR A;  4W4U A;  5B8D A;  2YHN A;  2D8S A;  2ECG A;  2IQJ A;  2KWO A;  2KWK A;  2MT5 A;  2G43 A;  2Y1M A;  3PUQ A;  1LDK C;  2LGK A;  4I7B A;  3MHS A;  3LVQ E;  5C11 A;  2VPG A;  3M62 A;  4YC9 A;  1Z2Q A;  4X3G A;  2BAY A;  4N3W A;  3PUR A;  1MM2 A;  5FB1 A;  2LV9 A;  5B77 A;  5TDW A;  2KWN A;  2D8U A;  4GNG A;  2LGG A;  1WIM A;  2I50 A;  2G6Q A;  3U5O A;  3KDE C;  5DIN A;  2KR4 A;  1K2F A;  3RPG B;  4H9D A;  2LAU A;  4I7D A;  2ZET C;  2LXH C;  1WEQ A;  2VJE B;  4P5O B;  3RTR B;  3T6R A;  5D1K B;  3E2D A;  2VP7 A;  4AVX A;  3ZVY A;  5G05 B;  1FBV A;  2LRI C;  4MSX A;  3MHH A;  1XWH A;  3O35 A;  4F52 B;  4WZ3 B;  2VJE A;  4UI9 B;  3JUE A;  2LQ6 A;  5B75 A;  2HYE D;  1WEE A;  2JMD A;  1Z6U A;  2PUY A;  1WEV A;  2L43 A;  2JRJ A;  1WEP A;  2KIZ A;  4CA1 A;  4A4C A;  2L7P A;  2FD4 A;  3FM8 C;  4WA6 A;  3ZTG A;  1WEU A;  4FIP A;  2YSJ A;  2KGI A;  2DSM A;  2B0O E;  5SVI A;  2KU3 A;  5TRB A;  5B79 A;  3GL6 A;  3LQH A;  3T7L A;  3ASL A;  2M1R A;  5KH7 A;  2AN6 A;  5B76 A;  1LDJ B;  1WEN A;  2VNF A;  4A0C D;  3H7H A;  5H1T A;  3I2D A;  4YAB A;  2FUI A;  2K17 A;  4ZQL A;  2CSZ A;  2LXP C;  2PNX A;  2KKX A;  2CSV A;  5H1U A;  3LJU X;  2F42 A;  4MVT A;  2VJF B;  1RMD A;  4OGC A;  4R2Y A;  2YSM A;  1ZBD B;  4GB0 A;  3ZYQ A;  2Y43 A;  2CKL B;  4LK9 A;  5LKX A;  4L58 A;  4IC2 A;  4QQ4 A;  2JMJ A;  4TKP B;  1DCQ A;  3ZNI A;  1U6G B;  3SOX A;  3KNV A;  3DDT A;  2XOC A;  2FFW A;  2QIC A;  2KGG A;  4C9Z A;  2UZG A;  3QZV A;  3C5K A;  2DX8 A;  4GNF A;  2OXQ C;  2KKY A;  2YUC A;  2CRR A;  5TAB A;  3O33 A;  4FJC A;  2ECV A;  2EGM A;  1VFY A;  2K4D A;  5I3L A;  2EXU A;  4LLB A;  5LKT A;  5FER A;  2EA6 A;  1CHC A;  4YBT A;  4V3K C;  3SOW A;  3GV4 A;  1DVP A;  4AYC B;  4YAT A;  1N87 A;  4R8P K;  1IYM A;  2FUU A;  2MUM A;  3HCT A;  5D1L B;  4N4F A;  3O47 A;  4WZ2 A;  3L1X A;  5FEY A;  2CT2 A;  4L7X A;  2IDA A;  2VPB A;  3ZPV 1;  3N9N A;  3FJU B;  1G25 A;  4O62 A;  2ECT A;  1WEM A;  4O64 A;  2KWJ A;  4QF2 A;  5TBN A;  4R7E A;  3SUB A;  4GND A;  3L11 A;  2LGL A;  3L1Z B;  3VK6 A;  3N9P A;  2H0D B;  1JOC A;  2MA5 A;  2L0B A;  1V87 A;  2F6J A;  3O7A A;  3KQI A;  2ECN A;  2QIZ A;  1Z60 A;  3IHP A;  4PPE A;  3T9K A;  3LQJ A;  2OWA A;  3M63 A;  3Q1D A;  3SOU A;  3N9L A;  2MNY A;  1T1H A;  2HDP A;  1WGM A;  4WZ0 A;  3M7K A;  2KRE A;  2P57 A;  3ZVZ B;  2CON A;  2Y1N A;  1VYX A;  2CRW A;  3LVR E;  5JG6 A;  3FEH A;  3EB6 A;  2E6R A;  4XI1 A;  4S3O C;  3C6W A;  4FO9 A;  2EGP A;  3HCS A;  2YT5 A;  1HYJ A;  3O70 A;  5EYA F;  4S3O B;  2XEU A;  5SVX A;  4LAD B;  1FP0 A;  5KH3 A;  5G0F A;  2YU4 A;  1JM7 B;  4LJN A;  2M13 A;  2YUR A;  2L5U A;  4OGE A;  3V43 A;  1WE9 A;  2YRE A;  2F6N A;  2MD8 C;  2VPD A;  2YYR A;  2ECJ A;  2RR4 A;  3HTK C;  5H1V A;  1WEO A;  4YBS A;  3HCU A;  2MA6 A;  5C13 A;  5G04 B;  3EB5 A;  3M99 A;  4F1P A;  3DQV R;  1WFK A;  4ZDT A;  4I7C A;  2L80 A;  1WIL A;  2MKE A;  4QF3 A;  4YAX A;  3FAO A;  5B78 A;  2LDR A;  3LDY A;  5TDR A;  4UP0 A;  2YW8 A;  3FAN A;  3FL2 A;  3SHB A;  3RPG C;  2MIQ A;  3O34 A;  2RI7 A;  5LCW B;  2MD7 B;  2XOY A;  3LQI A;  2DJA A;  2FSA A;  2JM3 A;  2XP0 A;  2YHO A;  3U5N A;  5K3Q A;  1HYI A;  2C2V S;  2G45 A;  3U5P A;  2H0D A;  4IC3 A;  4BHW A;  3N9Q A;  1X4J A;  4A49 A;  1E4U A;  2YQL A;  2KYU A;  2VPE A;  4BBQ A;  1JM7 A;  2JMI A;  2M3H A;  5H9M A; 
#chains in the Genus database with same CATH homology
 5LKZ A;  4CCG X;  4B7Y C;  2CSY A;  3O36 A;  1X4I A;  4A4B A;  3N9M A;  2QJ0 A;  3NG2 A;  5DKA A;  2CKL A;  4GNE A;  4B86 C;  2YQM A;  5AIU A;  2E6S A;  2EOD A;  5KH9 A;  2M6M A;  5FB0 A;  4AP4 A;  5J3X A;  5D1M B;  3ZPV E;  2XB1 A;  3KV5 A;  4Q6F A;  1MM3 A;  4V3L C;  1X4U A;  1WEW A;  1BOR A;  4FK5 A;  2KFT A;  4PTB A;  2L75 A;  4YAD A;  3U5M A;  4YBM A;  5AIT A;  1WES A;  2ECI A;  3KV6 A;  2RSD A;  1F62 A;  1VD4 A;  4LKA A;  3DPL R;  4UP5 A;  4ZUX U;  2ECW A;  4AUQ B;  2K1J A;  3LRQ A;  2M85 A;  2MNZ A;  5LKU A;  2VJF A;  2K16 A;  4NN2 A;  2KE1 A;  2LN0 A;  3O37 A;  3PHD A;  3N9O A;  2NAA A;  2LGV A;  4AYC A;  2C2L A;  4W4U A;  5B8D A;  2YHN A;  2D8S A;  2ECG A;  2KWO A;  2KWK A;  2MT5 A;  2G43 A;  2Y1M A;  3PUQ A;  1LDK C;  2LGK A;  4I7B A;  3MHS A;  5C11 A;  2VPG A;  3M62 A;  4YC9 A;  1Z2Q A;  4X3G A;  2BAY A;  4N3W A;  3PUR A;  1MM2 A;  5FB1 A;  2LV9 A;  5B77 A;  5TDW A;  2KWN A;  4GNG A;  2LGG A;  1WIM A;  2I50 A;  2G6Q A;  3U5O A;  5DIN A;  2KR4 A;  1K2F A;  3RPG B;  4I7D A;  2ZET C;  2LXH C;  1WEQ A;  2VJE B;  4P5O B;  3RTR B;  3T6R A;  5D1K B;  2VP7 A;  4AVX A;  3ZVY A;  5G05 B;  1FBV A;  2LRI C;  4MSX A;  3MHH A;  1XWH A;  3O35 A;  4F52 B;  4WZ3 B;  2VJE A;  4UI9 B;  2LQ6 A;  5B75 A;  2HYE D;  1WEE A;  2JMD A;  1Z6U A;  2PUY A;  1WEV A;  2L43 A;  2JRJ A;  1WEP A;  2KIZ A;  4CA1 A;  4A4C A;  4WA6 A;  3ZTG A;  1WEU A;  4FIP A;  2YSJ A;  2KGI A;  2KU3 A;  5TRB A;  5B79 A;  3GL6 A;  3LQH A;  3T7L A;  3ASL A;  2M1R A;  5KH7 A;  2AN6 A;  5B76 A;  1LDJ B;  1WEN A;  2VNF A;  4A0C D;  5H1T A;  3I2D A;  4YAB A;  2FUI A;  2K17 A;  4ZQL A;  2CSZ A;  2LXP C;  2PNX A;  5H1U A;  2F42 A;  4MVT A;  2VJF B;  1RMD A;  4R2Y A;  2YSM A;  1ZBD B;  4GB0 A;  3ZYQ A;  2Y43 A;  2CKL B;  4LK9 A;  5LKX A;  4L58 A;  4IC2 A;  2JMJ A;  4TKP B;  3ZNI A;  1U6G B;  3SOX A;  3KNV A;  2QIC A;  2KGG A;  4C9Z A;  2UZG A;  3QZV A;  3C5K A;  2DX8 A;  4GNF A;  2OXQ C;  2YUC A;  5TAB A;  3O33 A;  4FJC A;  2ECV A;  1VFY A;  2K4D A;  5I3L A;  4LLB A;  5LKT A;  5FER A;  2EA6 A;  1CHC A;  4YBT A;  4V3K C;  3SOW A;  3GV4 A;  1DVP A;  4AYC B;  4YAT A;  1N87 A;  4R8P K;  1IYM A;  2FUU A;  2MUM A;  3HCT A;  5D1L B;  4N4F A;  4WZ2 A;  3L1X A;  5FEY A;  2CT2 A;  4L7X A;  2IDA A;  2VPB A;  3ZPV 1;  3N9N A;  1G25 A;  2ECT A;  1WEM A;  4O64 A;  2KWJ A;  4QF2 A;  5TBN A;  4R7E A;  4GND A;  3L11 A;  2LGL A;  3L1Z B;  3VK6 A;  3N9P A;  2H0D B;  1JOC A;  2MA5 A;  2L0B A;  1V87 A;  2F6J A;  3O7A A;  3KQI A;  2ECN A;  2QIZ A;  1Z60 A;  3IHP A;  4PPE A;  3LQJ A;  3M63 A;  3SOU A;  3N9L A;  2MNY A;  1T1H A;  2HDP A;  1WGM A;  4WZ0 A;  2KRE A;  3ZVZ B;  2Y1N A;  1VYX A;  5JG6 A;  3EB6 A;  2E6R A;  4XI1 A;  4S3O C;  3C6W A;  4FO9 A;  2EGP A;  3HCS A;  2YT5 A;  1HYJ A;  3O70 A;  5EYA F;  4S3O B;  2XEU A;  4LAD B;  1FP0 A;  5KH3 A;  5G0F A;  2YU4 A;  1JM7 B;  4LJN A;  2YUR A;  2L5U A;  3V43 A;  1WE9 A;  2YRE A;  2F6N A;  2MD8 C;  2VPD A;  2YYR A;  2ECJ A;  3HTK C;  5H1V A;  1WEO A;  4YBS A;  3HCU A;  2MA6 A;  5C13 A;  5G04 B;  3EB5 A;  3M99 A;  3DQV R;  1WFK A;  4ZDT A;  4I7C A;  2L80 A;  1WIL A;  4QF3 A;  4YAX A;  5B78 A;  2LDR A;  5TDR A;  4UP0 A;  2YW8 A;  3FL2 A;  3SHB A;  3RPG C;  2MIQ A;  3O34 A;  2RI7 A;  5LCW B;  2MD7 B;  3LQI A;  2FSA A;  2YHO A;  3U5N A;  1HYI A;  2C2V S;  2G45 A;  3U5P A;  2H0D A;  4IC3 A;  4BHW A;  3N9Q A;  1X4J A;  4A49 A;  1E4U A;  2YQL A;  2KYU A;  2VPE A;  4BBQ A;  1JM7 A;  2JMI A;  2M3H A;  5H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...