2YURA

Solution structure of the ring finger of human retinoblastoma-binding protein 6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
74
structure length
74
Chain Sequence
GSSGSSGEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinoblastoma-binding protein 6
publication title Solution structure of the Ring finger of human Retinoblastoma-binding protein 6
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 3
structure length 74
sequence length 74
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yurA00
4WZ2A 2XEUA 3I2DA 4S3OC 5JG6A 2L0BA 1N87A 5KH3A 2YSJA 5B79A 2YHOA 4S3OB 2NAAA 2ECTA 3O34A 3HCSA 4GB0A 2LGKA 4UP0A 2VJFA 1WFKA 2LXHC 3O33A 4L58A 3M99A 1WEPA 3NG2A 4MVTA 4LK9A 4LKAA 2KR4A 1T1HA 5G04B 4A0CD 3O37A 4YADA 4FIPA 3MHHA 3N9PA 2EODA 3SOWA 3PHDA 2DX8A 2KFTA 4A49A 5H9MA 2Y1MA 3L11A 3L1XA 3SOUA 2ECJA 1G25A 2G45A 2LDRA 3T6RA 2L75A 5LKZA 3EB5A 2YREA 2F6NA 4GNGA 1BORA 3FL2A 1MM3A 1FBVA 1Z2QA 3VK6A 2BAYA 2H0DA 2K16A 2L80A 2M85A 5KH7A 2RI7A 4WA6A 2MD8C 4AYCB 2CKLA 4CCGX 2VPDA 4V3LC 1U6GB 5TABA 3DQVR 2XB1A 4ZQLA 2KREA 4CA1A 1HYJA 2LRIC 2G6QA 2CSYA 1LDKC 2EGPA 1K2FA 4I7CA 5DKAA 1LDJB 2LGLA 2M3HA 4QF3A 2VP7A 4YBTA 4FO9A 3U5NA 4B7YC 4X3GA 2VJEA 5LCWB 5D1KB 4YAXA 3GL6A 5B78A 1WIMA 2KWKA 2MNZA 4YBMA 5G05B 2L5UA 5TBNA 2LGGA 2YUCA 2KE1A 4Q6FA 5D1LB 3LRQA 2UZGA 3LQJA 3N9LA 1DVPA 4I7BA 5I3LA 2HDPA 3ZTGA 4LLBA 4ZUXU 1JOCA 2MIQA 5AITA 4V3KC 2K4DA 5TDRA 3SOXA 2YSMA 4LJNA 4AVXA 1MM2A 1Z6UA 1WILA 2MNYA 4B86C 4W4UA 3GV4A 3ASLA 4GNEA 2YW8A 2VPEA 2KU3A 2HYED 5B75A 2KWNA 3M63A 3QZVA 1XWHA 2ECVA 2YURA 2L43A 1WEOA 2YHNA 2I50A 2AN6A 1JM7A 2MA5A 1HYIA 1WESA 2EA6A 5FB0A 3KQIA 2LXPC 5LKXA 4R7EA 3N9OA 3KV6A 2YYRA 2Y1NA 1WEWA 2D8SA 2ECGA 5B76A 5G0FA 2E6SA 2ZETC 1VYXA 1WEMA 3KNVA 4PPEA 2E6RA 5FERA 2PNXA 2YQMA 5J3XA 4F52B 5AIUA 4NN2A 4N3WA 2C2LA 1WE9A 3ZNIA 3O7AA 2VPGA 3HCTA 3M62A 2ECWA 3ZPVE 3KV5A 2C2VS 5D1MB 1FP0A 2VJFB 1X4UA 2LQ6A 2MT5A 3L1ZB 4P5OB 5LKTA 4FJCA 4XI1A 1RMDA 3N9NA 2FUUA 4IC2A 4MSXA 4YC9A 2KIZA 5KH9A 2KYUA 2QIZA 3O70A 1WGMA 4UI9B 3U5OA 5TRBA 4C9ZA 2FSAA 3IHPA 4R2YA 2KWOA 1ZBDB 3DPLR 2ECIA 2VPBA 3ZYQA 3C6WA 3HTKC 1E4UA 1V87A 4R8PK 4IC3A 5B77A 5H1VA 3HCUA 2H0DB 5H1UA 2Y43A 4AYCA 2FUIA 2KGIA 4WZ0A 4GNDA 4BHWA 3LQIA 2LV9A 1F62A 2CKLB 4YBSA 2KGGA 2JMIA 4YATA 3C5KA 4UP5A 5B8DA 4LADB 2YQLA 2ECNA 5DINA 2JMJA 4WZ3B 2F42A 2OXQC 4A4BA 2JRJA 5FEYA 4N4FA 1WEEA 2VJEB 3N9MA 2LGVA 2IDAA 3O35A 4ZDTA 2RSDA 5EYAF 3N9QA 3SHBA 1CHCA 1WEUA 5TDWA 2PUYA 4YABA 4O64A 2JMDA 5FB1A 3RPGC 3ZVYA 2VNFA 1X4IA 4PTBA 3RTRB 2LN0A 2KWJA 2CSZA 2MD7B 2M6MA 5C11A 1VD4A 3ZPV1 3O36A 3RPGB 3PURA 4AP4A 4I7DA 3U5PA 2MUMA 4GNFA 2QICA 1IYMA 3LQHA 4BBQA 3PUQA 5H1TA 1X4JA 4A4CA 2G43A 4TKPB 2K17A 2K1JA 2QJ0A 3T7LA 2CT2A 1WENA 5LKUA 2MA6A 5C13A 1JM7B 3V43A 4AUQB 2YT5A 2F6JA 1WEQA 2M1RA 4FK5A 2YU4A 4QF2A 4L7XA 3ZVZB 1VFYA 3MHSA 3U5MA 1Z60A 3EB6A 1WEVA
chains in the Genus database with same CATH superfamily
4WZ2A 2XEUA 3I2DA 4S3OC 4Z0RA 5JG6A 2L0BA 1N87A 5KH3A 2YSJA 5B79A 2YHOA 4S3OB 3KDEC 1DCQA 2NAAA 2KKYA 2ECTA 3O34A 3HCSA 4GB0A 2LGKA 4UP0A 2VJFA 1WFKA 2LXHC 3O33A 2JUNA 4L58A 3M99A 1WEPA 3NG2A 4MVTA 4LK9A 4LKAA 3M7KA 2KR4A 1T1HA 5G04B 4A0CD 3O37A 4YADA 4FIPA 3MHHA 3N9PA 2DSMA 2EODA 3SOWA 3PHDA 2DX8A 2KFTA 4A49A 5SVIB 5H9MA 2Y1MA 3L11A 3L1XA 3SOUA 2ECJA 1G25A 2G45A 2LDRA 3T6RA 2L75A 3Q1DA 5LKZA 3EB5A 2YREA 2F6NA 4GNGA 1BORA 3JUEA 3FL2A 2KKXA 1MM3A 1FBVA 1Z2QA 3VK6A 2BAYA 2H0DA 2K16A 2L80A 2M85A 5KH7A 2RI7A 2XP0A 4WA6A 2EXUA 2MD8C 2RR4A 4AYCB 2CKLA 4CCGX 2VPDA 4V3LC 1U6GB 5TABA 2CSVA 3DQVR 2XB1A 4ZQLA 3MDBC 2KREA 4CA1A 1HYJA 2LRIC 2G6QA 2CSYA 1LDKC 2EGPA 1K2FA 4I7CA 5DKAA 1LDJB 2LGLA 2M3HA 4QF3A 4OGCA 2VP7A 4YBTA 4FO9A 3U5NA 4B7YC 4X3GA 2VJEA 5LCWB 5D1KB 2JM3A 4YAXA 3GL6A 5B78A 1WIMA 2KWKA 2MNZA 4YBMA 5G05B 2OWAA 2L5UA 5TBNA 2LGGA 2YUCA 2KE1A 4Q6FA 5D1LB 3LRQA 2UZGA 3LQJA 3LVRE 3N9LA 1DVPA 4I7BA 5I3LA 3H7HA 2HDPA 3ZTGA 4LLBA 4ZUXU 1JOCA 2MIQA 5AITA 3O47A 4V3KC 2K4DA 5TDRA 3SOXA 2YSMA 4LJNA 4O62A 4AVXA 1MM2A 1Z6UA 1WILA 2MNYA 4B86C 4W4UA 3GV4A 3ASLA 4GNEA 2YW8A 3DDTA 2VPEA 2KU3A 2HYED 5B75A 2YVRA 2KWNA 3M63A 2FFWA 3QZVA 1XWHA 2ECVA 2YURA 2L43A 2B0OE 1WEOA 2YHNA 2I50A 2AN6A 1JM7A 2MA5A 1HYIA 1WESA 3LDYA 4F1PA 2EA6A 5FB0A 3KQIA 2LXPC 5LKXA 4R7EA 3N9OA 3KV6A 2YYRA 2Y1NA 1WEWA 2D8SA 2ECGA 4H9DA 5G0FA 2E6SA 5B76A 2ZETC 3FJUB 1VYXA 1WEMA 3KNVA 4PPEA 2E6RA 5FERA 2PNXA 2YQMA 5J3XA 2E61A 5SVYA 4F52B 5AIUA 4NN2A 4N3WA 2C2LA 3DWDA 1WE9A 3ZNIA 3O7AA 2VPGA 3HCTA 2MKEA 3M62A 2ECWA 3ZPVE 2CRRA 3KV5A 2C2VS 5D1MB 1FP0A 3FAOA 2VJFB 1X4UA 2LQ6A 2MT5A 3L1ZB 4P5OB 5LKTA 4FJCA 4XI1A 1RMDA 3N9NA 2FUUA 4IC2A 5SVXA 4MSXA 4YC9A 2KIZA 5KH9A 3PLWA 2KYUA 2QIZA 4Z0OA 3O70A 1WGMA 2XOCA 3FM8C 3FANA 5SVIA 4UI9B 3U5OA 5TRBA 4C9ZA 2FSAA 3IHPA 4R2YA 2KWOA 1ZBDB 3DPLR 2ECIA 2VPBA 3T9KA 3ZYQA 3C6WA 3HTKC 1E4UA 2P57A 1V87A 4R8PK 4IC3A 5B77A 5H1VA 3HCUA 2H0DB 5H1UA 2Y43A 4AYCA 2FUIA 2KGIA 4WZ0A 4GNDA 4BHWA 3LQIA 2LV9A 1F62A 2CKLB 3LVQE 4YBSA 2KGGA 2JMIA 2FD4A 4YATA 3C5KA 4UP5A 5B8DA 4LADB 2YQLA 2ECNA 5DINA 2JMJA 4WZ3B 2XOZA 2LAUA 2F42A 2OXQC 4A4BA 2JRJA 5FEYA 4N4FA 1WEEA 2VJEB 3N9MA 2LGVA 2IDAA 4OGEA 3O35A 2M13A 4ZDTA 2RSDA 5EYAF 3LJUX 3N9QA 3SHBA 2EGMA 1CHCA 1WEUA 5TDWA 2PUYA 4YABA 4O64A 2JMDA 5FB1A 3RPGC 3ZVYA 2VNFA 1X4IA 4PTBA 3RTRB 2LN0A 2KWJA 2D8UA 2CSZA 2MD7B 2M6MA 5C11A 1VD4A 3ZPV1 3O36A 2DJAA 3RPGB 3PURA 4AP4A 4I7DA 2CRWA 3U5PA 2MUMA 4GNFA 2IQJA 2QICA 1IYMA 3LQHA 4BBQA 3PUQA 5H1TA 1X4JA 4A4CA 2G43A 4TKPB 5K3QA 2K17A 2K1JA 2QJ0A 3T7LA 2CT2A 1WENA 5LKUA 2MA6A 3FEHA 5C13A 1JM7B 3V43A 4AUQB 2YT5A 2F6JA 1WEQA 2M1RA 4FK5A 3SUBA 2YU4A 4QF2A 4L7XA 4QQ4A 3E2DA 3ZVZB 2CONA 1MBMA 1VFYA 2L7PA 3MHSA 3U5MA 1Z60A 3EB6A 2XOYA 1WEVA
chains in the Genus database with same CATH topology
4WZ2A 2XEUA 3I2DA 4S3OC 5JG6A 2L0BA 1N87A 5KH3A 2YSJA 5B79A 2YHOA 4S3OB 2NAAA 2ECTA 3O34A 3HCSA 4GB0A 2LGKA 4UP0A 2VJFA 1WFKA 2LXHC 3O33A 4L58A 3M99A 1WEPA 3NG2A 4MVTA 4LK9A 4LKAA 2KR4A 1T1HA 5G04B 4A0CD 3O37A 4YADA 4FIPA 3MHHA 3N9PA 2EODA 3SOWA 3PHDA 2DX8A 2KFTA 4A49A 5H9MA 2Y1MA 3L11A 3L1XA 3SOUA 2ECJA 1G25A 2G45A 2LDRA 3T6RA 2L75A 5LKZA 3EB5A 2YREA 2F6NA 4GNGA 1BORA 3FL2A 1MM3A 1FBVA 1Z2QA 3VK6A 2BAYA 2H0DA 2K16A 2L80A 2M85A 5KH7A 2RI7A 4WA6A 2MD8C 4AYCB 2CKLA 4CCGX 2VPDA 4V3LC 1U6GB 5TABA 3DQVR 2XB1A 4ZQLA 2KREA 4CA1A 1HYJA 2LRIC 2G6QA 2CSYA 1LDKC 2EGPA 1K2FA 4I7CA 5DKAA 1LDJB 2LGLA 2M3HA 4QF3A 2VP7A 4YBTA 4FO9A 3U5NA 4B7YC 4X3GA 2VJEA 5LCWB 5D1KB 4YAXA 3GL6A 5B78A 1WIMA 2KWKA 2MNZA 4YBMA 5G05B 2L5UA 5TBNA 2LGGA 2YUCA 2KE1A 4Q6FA 5D1LB 3LRQA 2UZGA 3LQJA 3N9LA 1DVPA 4I7BA 5I3LA 2HDPA 3ZTGA 4LLBA 4ZUXU 1JOCA 2MIQA 5AITA 4V3KC 2K4DA 5TDRA 3SOXA 2YSMA 4LJNA 4AVXA 1MM2A 1Z6UA 1WILA 2MNYA 4B86C 4W4UA 3GV4A 3ASLA 4GNEA 2YW8A 2VPEA 2KU3A 2HYED 5B75A 2KWNA 3M63A 3QZVA 1XWHA 2ECVA 2YURA 2L43A 1WEOA 2YHNA 2I50A 2AN6A 1JM7A 2MA5A 1HYIA 1WESA 2EA6A 5FB0A 3KQIA 2LXPC 5LKXA 4R7EA 3N9OA 3KV6A 2YYRA 2Y1NA 1WEWA 2D8SA 2ECGA 5B76A 5G0FA 2E6SA 2ZETC 1VYXA 1WEMA 3KNVA 4PPEA 2E6RA 5FERA 2PNXA 2YQMA 5J3XA 4F52B 5AIUA 4NN2A 4N3WA 2C2LA 1WE9A 3ZNIA 3O7AA 2VPGA 3HCTA 3M62A 2ECWA 3ZPVE 3KV5A 2C2VS 5D1MB 1FP0A 2VJFB 1X4UA 2LQ6A 2MT5A 3L1ZB 4P5OB 5LKTA 4FJCA 4XI1A 1RMDA 3N9NA 2FUUA 4IC2A 4MSXA 4YC9A 2KIZA 5KH9A 2KYUA 2QIZA 3O70A 1WGMA 4UI9B 3U5OA 5TRBA 4C9ZA 2FSAA 3IHPA 4R2YA 2KWOA 1ZBDB 3DPLR 2ECIA 2VPBA 3ZYQA 3C6WA 3HTKC 1E4UA 1V87A 4R8PK 4IC3A 5B77A 5H1VA 3HCUA 2H0DB 5H1UA 2Y43A 4AYCA 2FUIA 2KGIA 4WZ0A 4GNDA 4BHWA 3LQIA 2LV9A 1F62A 2CKLB 4YBSA 2KGGA 2JMIA 4YATA 3C5KA 4UP5A 5B8DA 4LADB 2YQLA 2ECNA 5DINA 2JMJA 4WZ3B 2F42A 2OXQC 4A4BA 2JRJA 5FEYA 4N4FA 1WEEA 2VJEB 3N9MA 2LGVA 2IDAA 3O35A 4ZDTA 2RSDA 5EYAF 3N9QA 3SHBA 1CHCA 1WEUA 5TDWA 2PUYA 4YABA 4O64A 2JMDA 5FB1A 3RPGC 3ZVYA 2VNFA 1X4IA 4PTBA 3RTRB 2LN0A 2KWJA 2CSZA 2MD7B 2M6MA 5C11A 1VD4A 3ZPV1 3O36A 3RPGB 3PURA 4AP4A 4I7DA 3U5PA 2MUMA 4GNFA 2QICA 1IYMA 3LQHA 4BBQA 3PUQA 5H1TA 1X4JA 4A4CA 2G43A 4TKPB 2K17A 2K1JA 2QJ0A 3T7LA 2CT2A 1WENA 5LKUA 2MA6A 5C13A 1JM7B 3V43A 4AUQB 2YT5A 2F6JA 1WEQA 2M1RA 4FK5A 2YU4A 4QF2A 4L7XA 3ZVZB 1VFYA 3MHSA 3U5MA 1Z60A 3EB6A 1WEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ2 A;  2XEU A;  3I2D A;  4S3O C;  5JG6 A;  2L0B A;  1N87 A;  5KH3 A;  2YSJ A;  5B79 A;  2YHO A;  4S3O B;  2NAA A;  2ECT A;  3O34 A;  3HCS A;  4GB0 A;  2LGK A;  4UP0 A;  2VJF A;  1WFK A;  2LXH C;  3O33 A;  4L58 A;  3M99 A;  1WEP A;  3NG2 A;  4MVT A;  4LK9 A;  4LKA A;  2KR4 A;  1T1H A;  5G04 B;  4A0C D;  3O37 A;  4YAD A;  4FIP A;  3MHH A;  3N9P A;  2EOD A;  3SOW A;  3PHD A;  2DX8 A;  2KFT A;  4A49 A;  5H9M A;  2Y1M A;  3L11 A;  3L1X A;  3SOU A;  2ECJ A;  1G25 A;  2G45 A;  2LDR A;  3T6R A;  2L75 A;  5LKZ A;  3EB5 A;  2YRE A;  2F6N A;  4GNG A;  1BOR A;  3FL2 A;  1MM3 A;  1FBV A;  1Z2Q A;  3VK6 A;  2BAY A;  2H0D A;  2K16 A;  2L80 A;  2M85 A;  5KH7 A;  2RI7 A;  4WA6 A;  2MD8 C;  4AYC B;  2CKL A;  4CCG X;  2VPD A;  4V3L C;  1U6G B;  5TAB A;  3DQV R;  2XB1 A;  4ZQL A;  2KRE A;  4CA1 A;  1HYJ A;  2LRI C;  2G6Q A;  2CSY A;  1LDK C;  2EGP A;  1K2F A;  4I7C A;  5DKA A;  1LDJ B;  2LGL A;  2M3H A;  4QF3 A;  2VP7 A;  4YBT A;  4FO9 A;  3U5N A;  4B7Y C;  4X3G A;  2VJE A;  5LCW B;  5D1K B;  4YAX A;  3GL6 A;  5B78 A;  1WIM A;  2KWK A;  2MNZ A;  4YBM A;  5G05 B;  2L5U A;  5TBN A;  2LGG A;  2YUC A;  2KE1 A;  4Q6F A;  5D1L B;  3LRQ A;  2UZG A;  3LQJ A;  3N9L A;  1DVP A;  4I7B A;  5I3L A;  2HDP A;  3ZTG A;  4LLB A;  4ZUX U;  1JOC A;  2MIQ A;  5AIT A;  4V3K C;  2K4D A;  5TDR A;  3SOX A;  2YSM A;  4LJN A;  4AVX A;  1MM2 A;  1Z6U A;  1WIL A;  2MNY A;  4B86 C;  4W4U A;  3GV4 A;  3ASL A;  4GNE A;  2YW8 A;  2VPE A;  2KU3 A;  2HYE D;  5B75 A;  2KWN A;  3M63 A;  3QZV A;  1XWH A;  2ECV A;  2YUR A;  2L43 A;  1WEO A;  2YHN A;  2I50 A;  2AN6 A;  1JM7 A;  2MA5 A;  1HYI A;  1WES A;  2EA6 A;  5FB0 A;  3KQI A;  2LXP C;  5LKX A;  4R7E A;  3N9O A;  3KV6 A;  2YYR A;  2Y1N A;  1WEW A;  2D8S A;  2ECG A;  5B76 A;  5G0F A;  2E6S A;  2ZET C;  1VYX A;  1WEM A;  3KNV A;  4PPE A;  2E6R A;  5FER A;  2PNX A;  2YQM A;  5J3X A;  4F52 B;  5AIU A;  4NN2 A;  4N3W A;  2C2L A;  1WE9 A;  3ZNI A;  3O7A A;  2VPG A;  3HCT A;  3M62 A;  2ECW A;  3ZPV E;  3KV5 A;  2C2V S;  5D1M B;  1FP0 A;  2VJF B;  1X4U A;  2LQ6 A;  2MT5 A;  3L1Z B;  4P5O B;  5LKT A;  4FJC A;  4XI1 A;  1RMD A;  3N9N A;  2FUU A;  4IC2 A;  4MSX A;  4YC9 A;  2KIZ A;  5KH9 A;  2KYU A;  2QIZ A;  3O70 A;  1WGM A;  4UI9 B;  3U5O A;  5TRB A;  4C9Z A;  2FSA A;  3IHP A;  4R2Y A;  2KWO A;  1ZBD B;  3DPL R;  2ECI A;  2VPB A;  3ZYQ A;  3C6W A;  3HTK C;  1E4U A;  1V87 A;  4R8P K;  4IC3 A;  5B77 A;  5H1V A;  3HCU A;  2H0D B;  5H1U A;  2Y43 A;  4AYC A;  2FUI A;  2KGI A;  4WZ0 A;  4GND A;  4BHW A;  3LQI A;  2LV9 A;  1F62 A;  2CKL B;  4YBS A;  2KGG A;  2JMI A;  4YAT A;  3C5K A;  4UP5 A;  5B8D A;  4LAD B;  2YQL A;  2ECN A;  5DIN A;  2JMJ A;  4WZ3 B;  2F42 A;  2OXQ C;  4A4B A;  2JRJ A;  5FEY A;  4N4F A;  1WEE A;  2VJE B;  3N9M A;  2LGV A;  2IDA A;  3O35 A;  4ZDT A;  2RSD A;  5EYA F;  3N9Q A;  3SHB A;  1CHC A;  1WEU A;  5TDW A;  2PUY A;  4YAB A;  4O64 A;  2JMD A;  5FB1 A;  3RPG C;  3ZVY A;  2VNF A;  1X4I A;  4PTB A;  3RTR B;  2LN0 A;  2KWJ A;  2CSZ A;  2MD7 B;  2M6M A;  5C11 A;  1VD4 A;  3ZPV 1;  3O36 A;  3RPG B;  3PUR A;  4AP4 A;  4I7D A;  3U5P A;  2MUM A;  4GNF A;  2QIC A;  1IYM A;  3LQH A;  4BBQ A;  3PUQ A;  5H1T A;  1X4J A;  4A4C A;  2G43 A;  4TKP B;  2K17 A;  2K1J A;  2QJ0 A;  3T7L A;  2CT2 A;  1WEN A;  5LKU A;  2MA6 A;  5C13 A;  1JM7 B;  3V43 A;  4AUQ B;  2YT5 A;  2F6J A;  1WEQ A;  2M1R A;  4FK5 A;  2YU4 A;  4QF2 A;  4L7X A;  3ZVZ B;  1VFY A;  3MHS A;  3U5M A;  1Z60 A;  3EB6 A;  1WEV A; 
#chains in the Genus database with same CATH topology
 4WZ2 A;  2XEU A;  3I2D A;  4S3O C;  4Z0R A;  5JG6 A;  2L0B A;  1N87 A;  5KH3 A;  2YSJ A;  5B79 A;  2YHO A;  4S3O B;  3KDE C;  1DCQ A;  2NAA A;  2KKY A;  2ECT A;  3O34 A;  3HCS A;  4GB0 A;  2LGK A;  4UP0 A;  2VJF A;  1WFK A;  2LXH C;  3O33 A;  2JUN A;  4L58 A;  3M99 A;  1WEP A;  3NG2 A;  4MVT A;  4LK9 A;  4LKA A;  3M7K A;  2KR4 A;  1T1H A;  5G04 B;  4A0C D;  3O37 A;  4YAD A;  4FIP A;  3MHH A;  3N9P A;  2DSM A;  2EOD A;  3SOW A;  3PHD A;  2DX8 A;  2KFT A;  4A49 A;  5SVI B;  5H9M A;  2Y1M A;  3L11 A;  3L1X A;  3SOU A;  2ECJ A;  1G25 A;  2G45 A;  2LDR A;  3T6R A;  2L75 A;  3Q1D A;  5LKZ A;  3EB5 A;  2YRE A;  2F6N A;  4GNG A;  1BOR A;  3JUE A;  3FL2 A;  2KKX A;  1MM3 A;  1FBV A;  1Z2Q A;  3VK6 A;  2BAY A;  2H0D A;  2K16 A;  2L80 A;  2M85 A;  5KH7 A;  2RI7 A;  2XP0 A;  4WA6 A;  2EXU A;  2MD8 C;  2RR4 A;  4AYC B;  2CKL A;  4CCG X;  2VPD A;  4V3L C;  1U6G B;  5TAB A;  2CSV A;  3DQV R;  2XB1 A;  4ZQL A;  3MDB C;  2KRE A;  4CA1 A;  1HYJ A;  2LRI C;  2G6Q A;  2CSY A;  1LDK C;  2EGP A;  1K2F A;  4I7C A;  5DKA A;  1LDJ B;  2LGL A;  2M3H A;  4QF3 A;  4OGC A;  2VP7 A;  4YBT A;  4FO9 A;  3U5N A;  4B7Y C;  4X3G A;  2VJE A;  5LCW B;  5D1K B;  2JM3 A;  4YAX A;  3GL6 A;  5B78 A;  1WIM A;  2KWK A;  2MNZ A;  4YBM A;  5G05 B;  2OWA A;  2L5U A;  5TBN A;  2LGG A;  2YUC A;  2KE1 A;  4Q6F A;  5D1L B;  3LRQ A;  2UZG A;  3LQJ A;  3LVR E;  3N9L A;  1DVP A;  4I7B A;  5I3L A;  3H7H A;  2HDP A;  3ZTG A;  4LLB A;  4ZUX U;  1JOC A;  2MIQ A;  5AIT A;  3O47 A;  4V3K C;  2K4D A;  5TDR A;  3SOX A;  2YSM A;  4LJN A;  4O62 A;  4AVX A;  1MM2 A;  1Z6U A;  1WIL A;  2MNY A;  4B86 C;  4W4U A;  3GV4 A;  3ASL A;  4GNE A;  2YW8 A;  3DDT A;  2VPE A;  2KU3 A;  2HYE D;  5B75 A;  2YVR A;  2KWN A;  3M63 A;  2FFW A;  3QZV A;  1XWH A;  2ECV A;  2YUR A;  2L43 A;  2B0O E;  1WEO A;  2YHN A;  2I50 A;  2AN6 A;  1JM7 A;  2MA5 A;  1HYI A;  1WES A;  3LDY A;  4F1P A;  2EA6 A;  5FB0 A;  3KQI A;  2LXP C;  5LKX A;  4R7E A;  3N9O A;  3KV6 A;  2YYR A;  2Y1N A;  1WEW A;  2D8S A;  2ECG A;  4H9D A;  5G0F A;  2E6S A;  5B76 A;  2ZET C;  3FJU B;  1VYX A;  1WEM A;  3KNV A;  4PPE A;  2E6R A;  5FER A;  2PNX A;  2YQM A;  5J3X A;  2E61 A;  5SVY A;  4F52 B;  5AIU A;  4NN2 A;  4N3W A;  2C2L A;  3DWD A;  1WE9 A;  3ZNI A;  3O7A A;  2VPG A;  3HCT A;  2MKE A;  3M62 A;  2ECW A;  3ZPV E;  2CRR A;  3KV5 A;  2C2V S;  5D1M B;  1FP0 A;  3FAO A;  2VJF B;  1X4U A;  2LQ6 A;  2MT5 A;  3L1Z B;  4P5O B;  5LKT A;  4FJC A;  4XI1 A;  1RMD A;  3N9N A;  2FUU A;  4IC2 A;  5SVX A;  4MSX A;  4YC9 A;  2KIZ A;  5KH9 A;  3PLW A;  2KYU A;  2QIZ A;  4Z0O A;  3O70 A;  1WGM A;  2XOC A;  3FM8 C;  3FAN A;  5SVI A;  4UI9 B;  3U5O A;  5TRB A;  4C9Z A;  2FSA A;  3IHP A;  4R2Y A;  2KWO A;  1ZBD B;  3DPL R;  2ECI A;  2VPB A;  3T9K A;  3ZYQ A;  3C6W A;  3HTK C;  1E4U A;  2P57 A;  1V87 A;  4R8P K;  4IC3 A;  5B77 A;  5H1V A;  3HCU A;  2H0D B;  5H1U A;  2Y43 A;  4AYC A;  2FUI A;  2KGI A;  4WZ0 A;  4GND A;  4BHW A;  3LQI A;  2LV9 A;  1F62 A;  2CKL B;  3LVQ E;  4YBS A;  2KGG A;  2JMI A;  2FD4 A;  4YAT A;  3C5K A;  4UP5 A;  5B8D A;  4LAD B;  2YQL A;  2ECN A;  5DIN A;  2JMJ A;  4WZ3 B;  2XOZ A;  2LAU A;  2F42 A;  2OXQ C;  4A4B A;  2JRJ A;  5FEY A;  4N4F A;  1WEE A;  2VJE B;  3N9M A;  2LGV A;  2IDA A;  4OGE A;  3O35 A;  2M13 A;  4ZDT A;  2RSD A;  5EYA F;  3LJU X;  3N9Q A;  3SHB A;  2EGM A;  1CHC A;  1WEU A;  5TDW A;  2PUY A;  4YAB A;  4O64 A;  2JMD A;  5FB1 A;  3RPG C;  3ZVY A;  2VNF A;  1X4I A;  4PTB A;  3RTR B;  2LN0 A;  2KWJ A;  2D8U A;  2CSZ A;  2MD7 B;  2M6M A;  5C11 A;  1VD4 A;  3ZPV 1;  3O36 A;  2DJA A;  3RPG B;  3PUR A;  4AP4 A;  4I7D A;  2CRW A;  3U5P A;  2MUM A;  4GNF A;  2IQJ A;  2QIC A;  1IYM A;  3LQH A;  4BBQ A;  3PUQ A;  5H1T A;  1X4J A;  4A4C A;  2G43 A;  4TKP B;  5K3Q A;  2K17 A;  2K1J A;  2QJ0 A;  3T7L A;  2CT2 A;  1WEN A;  5LKU A;  2MA6 A;  3FEH A;  5C13 A;  1JM7 B;  3V43 A;  4AUQ B;  2YT5 A;  2F6J A;  1WEQ A;  2M1R A;  4FK5 A;  3SUB A;  2YU4 A;  4QF2 A;  4L7X A;  4QQ4 A;  3E2D A;  3ZVZ B;  2CON A;  1MBM A;  1VFY A;  2L7P A;  3MHS A;  3U5M A;  1Z60 A;  3EB6 A;  2XOY A;  1WEV A; 
#chains in the Genus database with same CATH homology
 4WZ2 A;  2XEU A;  3I2D A;  4S3O C;  5JG6 A;  2L0B A;  1N87 A;  5KH3 A;  2YSJ A;  5B79 A;  2YHO A;  4S3O B;  2NAA A;  2ECT A;  3O34 A;  3HCS A;  4GB0 A;  2LGK A;  4UP0 A;  2VJF A;  1WFK A;  2LXH C;  3O33 A;  4L58 A;  3M99 A;  1WEP A;  3NG2 A;  4MVT A;  4LK9 A;  4LKA A;  2KR4 A;  1T1H A;  5G04 B;  4A0C D;  3O37 A;  4YAD A;  4FIP A;  3MHH A;  3N9P A;  2EOD A;  3SOW A;  3PHD A;  2DX8 A;  2KFT A;  4A49 A;  5H9M A;  2Y1M A;  3L11 A;  3L1X A;  3SOU A;  2ECJ A;  1G25 A;  2G45 A;  2LDR A;  3T6R A;  2L75 A;  5LKZ A;  3EB5 A;  2YRE A;  2F6N A;  4GNG A;  1BOR A;  3FL2 A;  1MM3 A;  1FBV A;  1Z2Q A;  3VK6 A;  2BAY A;  2H0D A;  2K16 A;  2L80 A;  2M85 A;  5KH7 A;  2RI7 A;  4WA6 A;  2MD8 C;  4AYC B;  2CKL A;  4CCG X;  2VPD A;  4V3L C;  1U6G B;  5TAB A;  3DQV R;  2XB1 A;  4ZQL A;  2KRE A;  4CA1 A;  1HYJ A;  2LRI C;  2G6Q A;  2CSY A;  1LDK C;  2EGP A;  1K2F A;  4I7C A;  5DKA A;  1LDJ B;  2LGL A;  2M3H A;  4QF3 A;  2VP7 A;  4YBT A;  4FO9 A;  3U5N A;  4B7Y C;  4X3G A;  2VJE A;  5LCW B;  5D1K B;  4YAX A;  3GL6 A;  5B78 A;  1WIM A;  2KWK A;  2MNZ A;  4YBM A;  5G05 B;  2L5U A;  5TBN A;  2LGG A;  2YUC A;  2KE1 A;  4Q6F A;  5D1L B;  3LRQ A;  2UZG A;  3LQJ A;  3N9L A;  1DVP A;  4I7B A;  5I3L A;  2HDP A;  3ZTG A;  4LLB A;  4ZUX U;  1JOC A;  2MIQ A;  5AIT A;  4V3K C;  2K4D A;  5TDR A;  3SOX A;  2YSM A;  4LJN A;  4AVX A;  1MM2 A;  1Z6U A;  1WIL A;  2MNY A;  4B86 C;  4W4U A;  3GV4 A;  3ASL A;  4GNE A;  2YW8 A;  2VPE A;  2KU3 A;  2HYE D;  5B75 A;  2KWN A;  3M63 A;  3QZV A;  1XWH A;  2ECV A;  2YUR A;  2L43 A;  1WEO A;  2YHN A;  2I50 A;  2AN6 A;  1JM7 A;  2MA5 A;  1HYI A;  1WES A;  2EA6 A;  5FB0 A;  3KQI A;  2LXP C;  5LKX A;  4R7E A;  3N9O A;  3KV6 A;  2YYR A;  2Y1N A;  1WEW A;  2D8S A;  2ECG A;  5B76 A;  5G0F A;  2E6S A;  2ZET C;  1VYX A;  1WEM A;  3KNV A;  4PPE A;  2E6R A;  5FER A;  2PNX A;  2YQM A;  5J3X A;  4F52 B;  5AIU A;  4NN2 A;  4N3W A;  2C2L A;  1WE9 A;  3ZNI A;  3O7A A;  2VPG A;  3HCT A;  3M62 A;  2ECW A;  3ZPV E;  3KV5 A;  2C2V S;  5D1M B;  1FP0 A;  2VJF B;  1X4U A;  2LQ6 A;  2MT5 A;  3L1Z B;  4P5O B;  5LKT A;  4FJC A;  4XI1 A;  1RMD A;  3N9N A;  2FUU A;  4IC2 A;  4MSX A;  4YC9 A;  2KIZ A;  5KH9 A;  2KYU A;  2QIZ A;  3O70 A;  1WGM A;  4UI9 B;  3U5O A;  5TRB A;  4C9Z A;  2FSA A;  3IHP A;  4R2Y A;  2KWO A;  1ZBD B;  3DPL R;  2ECI A;  2VPB A;  3ZYQ A;  3C6W A;  3HTK C;  1E4U A;  1V87 A;  4R8P K;  4IC3 A;  5B77 A;  5H1V A;  3HCU A;  2H0D B;  5H1U A;  2Y43 A;  4AYC A;  2FUI A;  2KGI A;  4WZ0 A;  4GND A;  4BHW A;  3LQI A;  2LV9 A;  1F62 A;  2CKL B;  4YBS A;  2KGG A;  2JMI A;  4YAT A;  3C5K A;  4UP5 A;  5B8D A;  4LAD B;  2YQL A;  2ECN A;  5DIN A;  2JMJ A;  4WZ3 B;  2F42 A;  2OXQ C;  4A4B A;  2JRJ A;  5FEY A;  4N4F A;  1WEE A;  2VJE B;  3N9M A;  2LGV A;  2IDA A;  3O35 A;  4ZDT A;  2RSD A;  5EYA F;  3N9Q A;  3SHB A;  1CHC A;  1WEU A;  5TDW A;  2PUY A;  4YAB A;  4O64 A;  2JMD A;  5FB1 A;  3RPG C;  3ZVY A;  2VNF A;  1X4I A;  4PTB A;  3RTR B;  2LN0 A;  2KWJ A;  2CSZ A;  2MD7 B;  2M6M A;  5C11 A;  1VD4 A;  3ZPV 1;  3O36 A;  3RPG B;  3PUR A;  4AP4 A;  4I7D A;  3U5P A;  2MUM A;  4GNF A;  2QIC A;  1IYM A;  3LQH A;  4BBQ A;  3PUQ A;  5H1T A;  1X4J A;  4A4C A;  2G43 A;  4TKP B;  2K17 A;  2K1J A;  2QJ0 A;  3T7L A;  2CT2 A;  1WEN A;  5LKU A;  2MA6 A;  5C13 A;  1JM7 B;  3V43 A;  4AUQ B;  2YT5 A;  2F6J A;  1WEQ A;  2M1R A;  4FK5 A;  2YU4 A;  4QF2 A;  4L7X A;  3ZVZ B;  1VFY A;  3MHS A;  3U5M A;  1Z60 A;  3EB6 A;  1WEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...