2YURA

Solution structure of the ring finger of human retinoblastoma-binding protein 6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
74
structure length
74
Chain Sequence
GSSGSSGEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Retinoblastoma-binding protein 6
publication title Solution structure of the Ring finger of human Retinoblastoma-binding protein 6
rcsb
source organism Homo sapiens
total genus 3
structure length 74
sequence length 74
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yurA00
3O35A 2MIQA 5DINA 2YW8A 3U5NA 3LRQA 3ZPV1 3QZVA 5H9MA 4PPEA 2RI7A 3HCTA 3ZYQA 2OXQC 4AYCA 3L11A 4YBTA 4GNFA 4FO9A 4IC3A 5KH7A 3O34A 4F52B 5AITA 2FSAA 1Z60A 3EB5A 1N87A 2DX8A 3GL6A 2C2VS 2VJFA 2VPGA 4UP5A 2QICA 5C13A 5D1KB 1ZBDB 5TBNA 1WEWA 2FUUA 4FK5A 2KE1A 4A4CA 1LDJB 5G04B 1Z6UA 3ZVZB 2YURA 4QF3A 2KYUA 5C11A 3PUQA 5D1MB 2M6MA 2VJFB 4X3GA 2YYRA 2LXHC 3L1XA 3RPGB 4V3KC 1WEEA 4XI1A 1VD4A 4YADA 2MUMA 1X4IA 2VJEA 5EYAF 2ECNA 2F6NA 3VK6A 4S3OC 2ECGA 1E4UA 2C2LA 4QF2A 4UP0A 1WILA 2G45A 2KWKA 3EB6A 5TABA 2L0BA 2ECWA 3N9MA 5B8DA 3PHDA 2KREA 3SHBA 4LADB 4ZUXU 2UZGA 3U5PA 3O33A 2JMJA 1WEVA 2XB1A 3T6RA 5LKZA 1V87A 2LV9A 2PUYA 3N9OA 1X4UA 1WIMA 1WE9A 2QJ0A 1Z2QA 2H0DB 2M85A 2Y1NA 3ZTGA 2D8SA 3ASLA 2YQLA 5D1LB 1WEOA 1FBVA 2MD7B 3SOXA 1IYMA 4N3WA 4WA6A 2Y43A 4AP4A 3NG2A 2YUCA 3O7AA 4C9ZA 2E6RA 3L1ZB 1CHCA 3T7LA 3N9NA 2JRJA 2JMIA 4YC9A 4P5OB 2YHNA 4WZ3B 2CSYA 5FB1A 5B78A 3HTKC 2VP7A 1K2FA 1RMDA 4IC2A 3O37A 2VPBA 4I7CA 2K1JA 2IDAA 4LLBA 4MSXA 3KV5A 4AVXA 2M3HA 4LKAA 2MNYA 4I7DA 4R8PK 1DVPA 3M99A 2VNFA 4B86C 3KV6A 4R7EA 2EA6A 2KU3A 2E6SA 3O70A 3U5OA 4V3LC 2YT5A 3KQIA 5FB0A 5LKTA 2JMDA 2MA5A 2L75A 3MHSA 3KNVA 3DQVR 2MD8C 2K16A 5B77A 3U5MA 3RPGC 4B7YC 2KWOA 2KGGA 3M63A 3M62A 2K17A 5I3LA 2NAAA 1HYJA 4AUQB 5B79A 2H0DA 2VPDA 3N9QA 4LJNA 2YU4A 1WESA 2QIZA 2ECIA 4Q6FA 2VPEA 1BORA 1JOCA 3HCSA 3ZVYA 3IHPA 5TDWA 4WZ0A 1WEUA 1VFYA 2G6QA 4CA1A 1WGMA 3ZNIA 2BAYA 2EODA 2LN0A 2LGLA 4R2YA 2Y1MA 3N9PA 1G25A 3GV4A 5LKUA 4FIPA 4FJCA 2PNXA 1WEQA 5FEYA 4GB0A 2ECJA 2YQMA 4PTBA 3SOWA 5B75A 5AIUA 4O64A 4GNGA 1T1HA 4UI9B 1X4JA 3C6WA 2LGGA 5H1VA 3LQIA 4YAXA 2ECTA 3V43A 4TKPB 1MM3A 1JM7B 3FL2A 5TDRA 5LKXA 4NN2A 4ZQLA 4L58A 2YREA 4BHWA 2FUIA 2YHOA 2ECVA 2HDPA 5KH9A 3C5KA 3LQJA 3O36A 3RTRB 4YBMA 4BBQA 3HCUA 2LDRA 1F62A 5JG6A 2EGPA 2XEUA 1VYXA 4AYCB 5FERA 1WFKA 3LQHA 2KGIA 2KFTA 5G05B 4L7XA 2CT2A 4YBSA 1U6GB 2LGKA 3SOUA 2L5UA 2L43A 4YATA 4LK9A 2YSJA 2KWNA 4ZDTA 4I7BA 3I2DA 2MT5A 4WZ2A 3N9LA 4S3OB 4YABA 4A0CD 2LGVA 3PURA 4GNDA 2AN6A 2CKLA 2RSDA 3DPLR 5B76A 2KIZA 3MHHA 2MA6A 4N4FA 1XWHA 5TRBA 2I50A 4CCGX 2F6JA 5KH3A 1WEPA 2G43A 5DKAA 1LDKC 5LCWB 1MM2A 2M1RA 2LRIC 4W4UA 2LQ6A 2VJEB 5H1UA 4MVTA 4GNEA 2ZETC 2CKLB 2F42A 1JM7A 2K4DA 4A49A 1FP0A 2YSMA 1WEMA 5G0FA 1HYIA 2KR4A 3ZPVE 2KWJA 2L80A 2CSZA 2LXPC 5J3XA 2MNZA 2HYED 1WENA 5H1TA 4A4BA
chains in the Genus database with same CATH superfamily
3O35A 2MIQA 5DINA 2YW8A 3U5NA 3LRQA 3ZPV1 3QZVA 5H9MA 4PPEA 2RI7A 3HCTA 3ZYQA 2OXQC 4AYCA 2RR4A 3L11A 4QQ4A 4YBTA 4GNFA 4FO9A 4IC3A 5KH7A 3O34A 4F52B 5AITA 2FSAA 2KKXA 1Z60A 3E2DA 3FM8C 3EB5A 2CONA 1N87A 2DX8A 3GL6A 2C2VS 2VJFA 2VPGA 4UP5A 2QICA 5C13A 5D1KB 1ZBDB 3DDTA 5TBNA 3SUBA 2P57A 1WEWA 2FUUA 4FK5A 2KE1A 4A4CA 1LDJB 2XP0A 5G04B 5SVXA 1Z6UA 3ZVZB 2YURA 4QF3A 2KYUA 5C11A 4F1PA 3PUQA 5D1MB 2M6MA 2VJFB 4X3GA 2YYRA 2LXHC 3L1XA 2CRWA 3RPGB 4V3KC 1WEEA 4XI1A 1VD4A 4YADA 2MUMA 1X4IA 2VJEA 5EYAF 2ECNA 3JUEA 2DJAA 2F6NA 3VK6A 4S3OC 2ECGA 1E4UA 2C2LA 3KDEC 4QF2A 2EGMA 4UP0A 1WILA 2XOZA 2G45A 2KWKA 3EB6A 5TABA 2L0BA 2ECWA 3N9MA 5B8DA 3PHDA 4Z0RA 2KREA 2B0OE 3SHBA 4LADB 4ZUXU 2L7PA 2UZGA 3LVRE 3U5PA 3O33A 2JMJA 1WEVA 2XB1A 3T6RA 5LKZA 1V87A 2LV9A 2PUYA 3N9OA 5SVIB 1X4UA 1WIMA 1WE9A 2QJ0A 1Z2QA 2H0DB 2M85A 2Y1NA 3ZTGA 2D8SA 3ASLA 2YQLA 5D1LB 1WEOA 1FBVA 2MD7B 3SOXA 1IYMA 2JUNA 4N3WA 4WA6A 2Y43A 4AP4A 3NG2A 2OWAA 2YUCA 3O7AA 3PLWA 4C9ZA 2E6RA 2EXUA 3L1ZB 1CHCA 3T7LA 4OGCA 3FEHA 3N9NA 2JRJA 2JMIA 4YC9A 4P5OB 2YHNA 4WZ3B 2E61A 2CSYA 5FB1A 5B78A 3T9KA 3HTKC 2VP7A 1K2FA 1RMDA 4IC2A 3O37A 2VPBA 4I7CA 2K1JA 4Z0OA 3DWDA 5K3QA 2IDAA 4OGEA 4LLBA 4MSXA 3KV5A 4AVXA 2M3HA 4LKAA 2LAUA 3H7HA 2MNYA 4I7DA 4R8PK 1DVPA 3M99A 2VNFA 4B86C 3KV6A 4R7EA 2CRRA 2EA6A 2KU3A 2E6SA 3O70A 3U5OA 3LVQE 4V3LC 2YT5A 3KQIA 5FB0A 5LKTA 2JMDA 2MA5A 2L75A 2FD4A 3MHSA 3KNVA 3DQVR 2MD8C 2K16A 5B77A 3U5MA 3RPGC 4B7YC 2KWOA 2KGGA 3M63A 3M62A 2K17A 5I3LA 2NAAA 1HYJA 4AUQB 5B79A 5SVIA 2H0DA 2VPDA 3FJUB 3N9QA 4LJNA 2YU4A 1WESA 2QIZA 2YVRA 1MBMA 2ECIA 4Q6FA 2VPEA 1BORA 1JOCA 3HCSA 3ZVYA 3IHPA 5TDWA 4WZ0A 1WEUA 2KKYA 1VFYA 2CSVA 2G6QA 4CA1A 1WGMA 3ZNIA 2BAYA 2EODA 2D8UA 2LN0A 2LGLA 4R2YA 2Y1MA 3N9PA 1G25A 3GV4A 5LKUA 3MDBC 4FIPA 4FJCA 2PNXA 1WEQA 5FEYA 4GB0A 2ECJA 2YQMA 4PTBA 3SOWA 5B75A 5AIUA 4O64A 4GNGA 1T1HA 4UI9B 1X4JA 2M13A 3C6WA 2LGGA 3M7KA 5H1VA 3LQIA 4YAXA 2ECTA 3V43A 3FANA 2XOCA 4TKPB 1MM3A 1JM7B 2MKEA 3FL2A 5TDRA 3LJUX 5LKXA 4NN2A 4ZQLA 3Q1DA 4L58A 2YREA 4BHWA 2FUIA 2YHOA 2ECVA 2HDPA 5KH9A 3C5KA 3LQJA 3O36A 3RTRB 4YBMA 4BBQA 3HCUA 2LDRA 2DSMA 4O62A 1F62A 5JG6A 2EGPA 2XEUA 1VYXA 4AYCB 5FERA 1WFKA 3LQHA 2KGIA 2KFTA 5G05B 4L7XA 2CT2A 3O47A 4YBSA 2FFWA 1U6GB 3FAOA 2LGKA 3SOUA 3LDYA 2L5UA 2L43A 4YATA 4LK9A 2YSJA 2KWNA 4ZDTA 4I7BA 3I2DA 2MT5A 4WZ2A 3N9LA 4S3OB 4YABA 4A0CD 4H9DA 2LGVA 3PURA 4GNDA 2AN6A 2CKLA 2RSDA 3DPLR 2JM3A 5B76A 2KIZA 3MHHA 2MA6A 4N4FA 1DCQA 1XWHA 5TRBA 2I50A 4CCGX 2F6JA 5KH3A 1WEPA 2G43A 5DKAA 1LDKC 5LCWB 1MM2A 2M1RA 2LRIC 4W4UA 2LQ6A 2VJEB 5H1UA 4MVTA 4GNEA 2ZETC 2CKLB 2F42A 1JM7A 2K4DA 4A49A 1FP0A 2YSMA 1WEMA 5G0FA 2XOYA 1HYIA 2KR4A 3ZPVE 2KWJA 2L80A 2CSZA 2LXPC 5J3XA 2MNZA 5SVYA 2IQJA 2HYED 1WENA 5H1TA 4A4BA
chains in the Genus database with same CATH topology
3O35A 2MIQA 5DINA 2YW8A 3U5NA 3LRQA 3ZPV1 3QZVA 5H9MA 4PPEA 2RI7A 3HCTA 3ZYQA 2OXQC 4AYCA 3L11A 4YBTA 4GNFA 4FO9A 4IC3A 5KH7A 3O34A 4F52B 5AITA 2FSAA 1Z60A 3EB5A 1N87A 2DX8A 3GL6A 2C2VS 2VJFA 2VPGA 4UP5A 2QICA 5C13A 5D1KB 1ZBDB 5TBNA 1WEWA 2FUUA 4FK5A 2KE1A 4A4CA 1LDJB 5G04B 1Z6UA 3ZVZB 2YURA 4QF3A 2KYUA 5C11A 3PUQA 5D1MB 2M6MA 2VJFB 4X3GA 2YYRA 2LXHC 3L1XA 3RPGB 4V3KC 1WEEA 4XI1A 1VD4A 4YADA 2MUMA 1X4IA 2VJEA 5EYAF 2ECNA 2F6NA 3VK6A 4S3OC 2ECGA 1E4UA 2C2LA 4QF2A 4UP0A 1WILA 2G45A 2KWKA 3EB6A 5TABA 2L0BA 2ECWA 3N9MA 5B8DA 3PHDA 2KREA 3SHBA 4LADB 4ZUXU 2UZGA 3U5PA 3O33A 2JMJA 1WEVA 2XB1A 3T6RA 5LKZA 1V87A 2LV9A 2PUYA 3N9OA 1X4UA 1WIMA 1WE9A 2QJ0A 1Z2QA 2H0DB 2M85A 2Y1NA 3ZTGA 2D8SA 3ASLA 2YQLA 5D1LB 1WEOA 1FBVA 2MD7B 3SOXA 1IYMA 4N3WA 4WA6A 2Y43A 4AP4A 3NG2A 2YUCA 3O7AA 4C9ZA 2E6RA 3L1ZB 1CHCA 3T7LA 3N9NA 2JRJA 2JMIA 4YC9A 4P5OB 2YHNA 4WZ3B 2CSYA 5FB1A 5B78A 3HTKC 2VP7A 1K2FA 1RMDA 4IC2A 3O37A 2VPBA 4I7CA 2K1JA 2IDAA 4LLBA 4MSXA 3KV5A 4AVXA 2M3HA 4LKAA 2MNYA 4I7DA 4R8PK 1DVPA 3M99A 2VNFA 4B86C 3KV6A 4R7EA 2EA6A 2KU3A 2E6SA 3O70A 3U5OA 4V3LC 2YT5A 3KQIA 5FB0A 5LKTA 2JMDA 2MA5A 2L75A 3MHSA 3KNVA 3DQVR 2MD8C 2K16A 5B77A 3U5MA 3RPGC 4B7YC 2KWOA 2KGGA 3M63A 3M62A 2K17A 5I3LA 2NAAA 1HYJA 4AUQB 5B79A 2H0DA 2VPDA 3N9QA 4LJNA 2YU4A 1WESA 2QIZA 2ECIA 4Q6FA 2VPEA 1BORA 1JOCA 3HCSA 3ZVYA 3IHPA 5TDWA 4WZ0A 1WEUA 1VFYA 2G6QA 4CA1A 1WGMA 3ZNIA 2BAYA 2EODA 2LN0A 2LGLA 4R2YA 2Y1MA 3N9PA 1G25A 3GV4A 5LKUA 4FIPA 4FJCA 2PNXA 1WEQA 5FEYA 4GB0A 2ECJA 2YQMA 4PTBA 3SOWA 5B75A 5AIUA 4O64A 4GNGA 1T1HA 4UI9B 1X4JA 3C6WA 2LGGA 5H1VA 3LQIA 4YAXA 2ECTA 3V43A 4TKPB 1MM3A 1JM7B 3FL2A 5TDRA 5LKXA 4NN2A 4ZQLA 4L58A 2YREA 4BHWA 2FUIA 2YHOA 2ECVA 2HDPA 5KH9A 3C5KA 3LQJA 3O36A 3RTRB 4YBMA 4BBQA 3HCUA 2LDRA 1F62A 5JG6A 2EGPA 2XEUA 1VYXA 4AYCB 5FERA 1WFKA 3LQHA 2KGIA 2KFTA 5G05B 4L7XA 2CT2A 4YBSA 1U6GB 2LGKA 3SOUA 2L5UA 2L43A 4YATA 4LK9A 2YSJA 2KWNA 4ZDTA 4I7BA 3I2DA 2MT5A 4WZ2A 3N9LA 4S3OB 4YABA 4A0CD 2LGVA 3PURA 4GNDA 2AN6A 2CKLA 2RSDA 3DPLR 5B76A 2KIZA 3MHHA 2MA6A 4N4FA 1XWHA 5TRBA 2I50A 4CCGX 2F6JA 5KH3A 1WEPA 2G43A 5DKAA 1LDKC 5LCWB 1MM2A 2M1RA 2LRIC 4W4UA 2LQ6A 2VJEB 5H1UA 4MVTA 4GNEA 2ZETC 2CKLB 2F42A 1JM7A 2K4DA 4A49A 1FP0A 2YSMA 1WEMA 5G0FA 1HYIA 2KR4A 3ZPVE 2KWJA 2L80A 2CSZA 2LXPC 5J3XA 2MNZA 2HYED 1WENA 5H1TA 4A4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O35 A;  2MIQ A;  5DIN A;  2YW8 A;  3U5N A;  3LRQ A;  3ZPV 1;  3QZV A;  5H9M A;  4PPE A;  2RI7 A;  3HCT A;  3ZYQ A;  2OXQ C;  4AYC A;  3L11 A;  4YBT A;  4GNF A;  4FO9 A;  4IC3 A;  5KH7 A;  3O34 A;  4F52 B;  5AIT A;  2FSA A;  1Z60 A;  3EB5 A;  1N87 A;  2DX8 A;  3GL6 A;  2C2V S;  2VJF A;  2VPG A;  4UP5 A;  2QIC A;  5C13 A;  5D1K B;  1ZBD B;  5TBN A;  1WEW A;  2FUU A;  4FK5 A;  2KE1 A;  4A4C A;  1LDJ B;  5G04 B;  1Z6U A;  3ZVZ B;  2YUR A;  4QF3 A;  2KYU A;  5C11 A;  3PUQ A;  5D1M B;  2M6M A;  2VJF B;  4X3G A;  2YYR A;  2LXH C;  3L1X A;  3RPG B;  4V3K C;  1WEE A;  4XI1 A;  1VD4 A;  4YAD A;  2MUM A;  1X4I A;  2VJE A;  5EYA F;  2ECN A;  2F6N A;  3VK6 A;  4S3O C;  2ECG A;  1E4U A;  2C2L A;  4QF2 A;  4UP0 A;  1WIL A;  2G45 A;  2KWK A;  3EB6 A;  5TAB A;  2L0B A;  2ECW A;  3N9M A;  5B8D A;  3PHD A;  2KRE A;  3SHB A;  4LAD B;  4ZUX U;  2UZG A;  3U5P A;  3O33 A;  2JMJ A;  1WEV A;  2XB1 A;  3T6R A;  5LKZ A;  1V87 A;  2LV9 A;  2PUY A;  3N9O A;  1X4U A;  1WIM A;  1WE9 A;  2QJ0 A;  1Z2Q A;  2H0D B;  2M85 A;  2Y1N A;  3ZTG A;  2D8S A;  3ASL A;  2YQL A;  5D1L B;  1WEO A;  1FBV A;  2MD7 B;  3SOX A;  1IYM A;  4N3W A;  4WA6 A;  2Y43 A;  4AP4 A;  3NG2 A;  2YUC A;  3O7A A;  4C9Z A;  2E6R A;  3L1Z B;  1CHC A;  3T7L A;  3N9N A;  2JRJ A;  2JMI A;  4YC9 A;  4P5O B;  2YHN A;  4WZ3 B;  2CSY A;  5FB1 A;  5B78 A;  3HTK C;  2VP7 A;  1K2F A;  1RMD A;  4IC2 A;  3O37 A;  2VPB A;  4I7C A;  2K1J A;  2IDA A;  4LLB A;  4MSX A;  3KV5 A;  4AVX A;  2M3H A;  4LKA A;  2MNY A;  4I7D A;  4R8P K;  1DVP A;  3M99 A;  2VNF A;  4B86 C;  3KV6 A;  4R7E A;  2EA6 A;  2KU3 A;  2E6S A;  3O70 A;  3U5O A;  4V3L C;  2YT5 A;  3KQI A;  5FB0 A;  5LKT A;  2JMD A;  2MA5 A;  2L75 A;  3MHS A;  3KNV A;  3DQV R;  2MD8 C;  2K16 A;  5B77 A;  3U5M A;  3RPG C;  4B7Y C;  2KWO A;  2KGG A;  3M63 A;  3M62 A;  2K17 A;  5I3L A;  2NAA A;  1HYJ A;  4AUQ B;  5B79 A;  2H0D A;  2VPD A;  3N9Q A;  4LJN A;  2YU4 A;  1WES A;  2QIZ A;  2ECI A;  4Q6F A;  2VPE A;  1BOR A;  1JOC A;  3HCS A;  3ZVY A;  3IHP A;  5TDW A;  4WZ0 A;  1WEU A;  1VFY A;  2G6Q A;  4CA1 A;  1WGM A;  3ZNI A;  2BAY A;  2EOD A;  2LN0 A;  2LGL A;  4R2Y A;  2Y1M A;  3N9P A;  1G25 A;  3GV4 A;  5LKU A;  4FIP A;  4FJC A;  2PNX A;  1WEQ A;  5FEY A;  4GB0 A;  2ECJ A;  2YQM A;  4PTB A;  3SOW A;  5B75 A;  5AIU A;  4O64 A;  4GNG A;  1T1H A;  4UI9 B;  1X4J A;  3C6W A;  2LGG A;  5H1V A;  3LQI A;  4YAX A;  2ECT A;  3V43 A;  4TKP B;  1MM3 A;  1JM7 B;  3FL2 A;  5TDR A;  5LKX A;  4NN2 A;  4ZQL A;  4L58 A;  2YRE A;  4BHW A;  2FUI A;  2YHO A;  2ECV A;  2HDP A;  5KH9 A;  3C5K A;  3LQJ A;  3O36 A;  3RTR B;  4YBM A;  4BBQ A;  3HCU A;  2LDR A;  1F62 A;  5JG6 A;  2EGP A;  2XEU A;  1VYX A;  4AYC B;  5FER A;  1WFK A;  3LQH A;  2KGI A;  2KFT A;  5G05 B;  4L7X A;  2CT2 A;  4YBS A;  1U6G B;  2LGK A;  3SOU A;  2L5U A;  2L43 A;  4YAT A;  4LK9 A;  2YSJ A;  2KWN A;  4ZDT A;  4I7B A;  3I2D A;  2MT5 A;  4WZ2 A;  3N9L A;  4S3O B;  4YAB A;  4A0C D;  2LGV A;  3PUR A;  4GND A;  2AN6 A;  2CKL A;  2RSD A;  3DPL R;  5B76 A;  2KIZ A;  3MHH A;  2MA6 A;  4N4F A;  1XWH A;  5TRB A;  2I50 A;  4CCG X;  2F6J A;  5KH3 A;  1WEP A;  2G43 A;  5DKA A;  1LDK C;  5LCW B;  1MM2 A;  2M1R A;  2LRI C;  4W4U A;  2LQ6 A;  2VJE B;  5H1U A;  4MVT A;  4GNE A;  2ZET C;  2CKL B;  2F42 A;  1JM7 A;  2K4D A;  4A49 A;  1FP0 A;  2YSM A;  1WEM A;  5G0F A;  1HYI A;  2KR4 A;  3ZPV E;  2KWJ A;  2L80 A;  2CSZ A;  2LXP C;  5J3X A;  2MNZ A;  2HYE D;  1WEN A;  5H1T A;  4A4B A; 
#chains in the Genus database with same CATH topology
 3O35 A;  2MIQ A;  5DIN A;  2YW8 A;  3U5N A;  3LRQ A;  3ZPV 1;  3QZV A;  5H9M A;  4PPE A;  2RI7 A;  3HCT A;  3ZYQ A;  2OXQ C;  4AYC A;  2RR4 A;  3L11 A;  4QQ4 A;  4YBT A;  4GNF A;  4FO9 A;  4IC3 A;  5KH7 A;  3O34 A;  4F52 B;  5AIT A;  2FSA A;  2KKX A;  1Z60 A;  3E2D A;  3FM8 C;  3EB5 A;  2CON A;  1N87 A;  2DX8 A;  3GL6 A;  2C2V S;  2VJF A;  2VPG A;  4UP5 A;  2QIC A;  5C13 A;  5D1K B;  1ZBD B;  3DDT A;  5TBN A;  3SUB A;  2P57 A;  1WEW A;  2FUU A;  4FK5 A;  2KE1 A;  4A4C A;  1LDJ B;  2XP0 A;  5G04 B;  5SVX A;  1Z6U A;  3ZVZ B;  2YUR A;  4QF3 A;  2KYU A;  5C11 A;  4F1P A;  3PUQ A;  5D1M B;  2M6M A;  2VJF B;  4X3G A;  2YYR A;  2LXH C;  3L1X A;  2CRW A;  3RPG B;  4V3K C;  1WEE A;  4XI1 A;  1VD4 A;  4YAD A;  2MUM A;  1X4I A;  2VJE A;  5EYA F;  2ECN A;  3JUE A;  2DJA A;  2F6N A;  3VK6 A;  4S3O C;  2ECG A;  1E4U A;  2C2L A;  3KDE C;  4QF2 A;  2EGM A;  4UP0 A;  1WIL A;  2XOZ A;  2G45 A;  2KWK A;  3EB6 A;  5TAB A;  2L0B A;  2ECW A;  3N9M A;  5B8D A;  3PHD A;  4Z0R A;  2KRE A;  2B0O E;  3SHB A;  4LAD B;  4ZUX U;  2L7P A;  2UZG A;  3LVR E;  3U5P A;  3O33 A;  2JMJ A;  1WEV A;  2XB1 A;  3T6R A;  5LKZ A;  1V87 A;  2LV9 A;  2PUY A;  3N9O A;  5SVI B;  1X4U A;  1WIM A;  1WE9 A;  2QJ0 A;  1Z2Q A;  2H0D B;  2M85 A;  2Y1N A;  3ZTG A;  2D8S A;  3ASL A;  2YQL A;  5D1L B;  1WEO A;  1FBV A;  2MD7 B;  3SOX A;  1IYM A;  2JUN A;  4N3W A;  4WA6 A;  2Y43 A;  4AP4 A;  3NG2 A;  2OWA A;  2YUC A;  3O7A A;  3PLW A;  4C9Z A;  2E6R A;  2EXU A;  3L1Z B;  1CHC A;  3T7L A;  4OGC A;  3FEH A;  3N9N A;  2JRJ A;  2JMI A;  4YC9 A;  4P5O B;  2YHN A;  4WZ3 B;  2E61 A;  2CSY A;  5FB1 A;  5B78 A;  3T9K A;  3HTK C;  2VP7 A;  1K2F A;  1RMD A;  4IC2 A;  3O37 A;  2VPB A;  4I7C A;  2K1J A;  4Z0O A;  3DWD A;  5K3Q A;  2IDA A;  4OGE A;  4LLB A;  4MSX A;  3KV5 A;  4AVX A;  2M3H A;  4LKA A;  2LAU A;  3H7H A;  2MNY A;  4I7D A;  4R8P K;  1DVP A;  3M99 A;  2VNF A;  4B86 C;  3KV6 A;  4R7E A;  2CRR A;  2EA6 A;  2KU3 A;  2E6S A;  3O70 A;  3U5O A;  3LVQ E;  4V3L C;  2YT5 A;  3KQI A;  5FB0 A;  5LKT A;  2JMD A;  2MA5 A;  2L75 A;  2FD4 A;  3MHS A;  3KNV A;  3DQV R;  2MD8 C;  2K16 A;  5B77 A;  3U5M A;  3RPG C;  4B7Y C;  2KWO A;  2KGG A;  3M63 A;  3M62 A;  2K17 A;  5I3L A;  2NAA A;  1HYJ A;  4AUQ B;  5B79 A;  5SVI A;  2H0D A;  2VPD A;  3FJU B;  3N9Q A;  4LJN A;  2YU4 A;  1WES A;  2QIZ A;  2YVR A;  1MBM A;  2ECI A;  4Q6F A;  2VPE A;  1BOR A;  1JOC A;  3HCS A;  3ZVY A;  3IHP A;  5TDW A;  4WZ0 A;  1WEU A;  2KKY A;  1VFY A;  2CSV A;  2G6Q A;  4CA1 A;  1WGM A;  3ZNI A;  2BAY A;  2EOD A;  2D8U A;  2LN0 A;  2LGL A;  4R2Y A;  2Y1M A;  3N9P A;  1G25 A;  3GV4 A;  5LKU A;  3MDB C;  4FIP A;  4FJC A;  2PNX A;  1WEQ A;  5FEY A;  4GB0 A;  2ECJ A;  2YQM A;  4PTB A;  3SOW A;  5B75 A;  5AIU A;  4O64 A;  4GNG A;  1T1H A;  4UI9 B;  1X4J A;  2M13 A;  3C6W A;  2LGG A;  3M7K A;  5H1V A;  3LQI A;  4YAX A;  2ECT A;  3V43 A;  3FAN A;  2XOC A;  4TKP B;  1MM3 A;  1JM7 B;  2MKE A;  3FL2 A;  5TDR A;  3LJU X;  5LKX A;  4NN2 A;  4ZQL A;  3Q1D A;  4L58 A;  2YRE A;  4BHW A;  2FUI A;  2YHO A;  2ECV A;  2HDP A;  5KH9 A;  3C5K A;  3LQJ A;  3O36 A;  3RTR B;  4YBM A;  4BBQ A;  3HCU A;  2LDR A;  2DSM A;  4O62 A;  1F62 A;  5JG6 A;  2EGP A;  2XEU A;  1VYX A;  4AYC B;  5FER A;  1WFK A;  3LQH A;  2KGI A;  2KFT A;  5G05 B;  4L7X A;  2CT2 A;  3O47 A;  4YBS A;  2FFW A;  1U6G B;  3FAO A;  2LGK A;  3SOU A;  3LDY A;  2L5U A;  2L43 A;  4YAT A;  4LK9 A;  2YSJ A;  2KWN A;  4ZDT A;  4I7B A;  3I2D A;  2MT5 A;  4WZ2 A;  3N9L A;  4S3O B;  4YAB A;  4A0C D;  4H9D A;  2LGV A;  3PUR A;  4GND A;  2AN6 A;  2CKL A;  2RSD A;  3DPL R;  2JM3 A;  5B76 A;  2KIZ A;  3MHH A;  2MA6 A;  4N4F A;  1DCQ A;  1XWH A;  5TRB A;  2I50 A;  4CCG X;  2F6J A;  5KH3 A;  1WEP A;  2G43 A;  5DKA A;  1LDK C;  5LCW B;  1MM2 A;  2M1R A;  2LRI C;  4W4U A;  2LQ6 A;  2VJE B;  5H1U A;  4MVT A;  4GNE A;  2ZET C;  2CKL B;  2F42 A;  1JM7 A;  2K4D A;  4A49 A;  1FP0 A;  2YSM A;  1WEM A;  5G0F A;  2XOY A;  1HYI A;  2KR4 A;  3ZPV E;  2KWJ A;  2L80 A;  2CSZ A;  2LXP C;  5J3X A;  2MNZ A;  5SVY A;  2IQJ A;  2HYE D;  1WEN A;  5H1T A;  4A4B A; 
#chains in the Genus database with same CATH homology
 3O35 A;  2MIQ A;  5DIN A;  2YW8 A;  3U5N A;  3LRQ A;  3ZPV 1;  3QZV A;  5H9M A;  4PPE A;  2RI7 A;  3HCT A;  3ZYQ A;  2OXQ C;  4AYC A;  3L11 A;  4YBT A;  4GNF A;  4FO9 A;  4IC3 A;  5KH7 A;  3O34 A;  4F52 B;  5AIT A;  2FSA A;  1Z60 A;  3EB5 A;  1N87 A;  2DX8 A;  3GL6 A;  2C2V S;  2VJF A;  2VPG A;  4UP5 A;  2QIC A;  5C13 A;  5D1K B;  1ZBD B;  5TBN A;  1WEW A;  2FUU A;  4FK5 A;  2KE1 A;  4A4C A;  1LDJ B;  5G04 B;  1Z6U A;  3ZVZ B;  2YUR A;  4QF3 A;  2KYU A;  5C11 A;  3PUQ A;  5D1M B;  2M6M A;  2VJF B;  4X3G A;  2YYR A;  2LXH C;  3L1X A;  3RPG B;  4V3K C;  1WEE A;  4XI1 A;  1VD4 A;  4YAD A;  2MUM A;  1X4I A;  2VJE A;  5EYA F;  2ECN A;  2F6N A;  3VK6 A;  4S3O C;  2ECG A;  1E4U A;  2C2L A;  4QF2 A;  4UP0 A;  1WIL A;  2G45 A;  2KWK A;  3EB6 A;  5TAB A;  2L0B A;  2ECW A;  3N9M A;  5B8D A;  3PHD A;  2KRE A;  3SHB A;  4LAD B;  4ZUX U;  2UZG A;  3U5P A;  3O33 A;  2JMJ A;  1WEV A;  2XB1 A;  3T6R A;  5LKZ A;  1V87 A;  2LV9 A;  2PUY A;  3N9O A;  1X4U A;  1WIM A;  1WE9 A;  2QJ0 A;  1Z2Q A;  2H0D B;  2M85 A;  2Y1N A;  3ZTG A;  2D8S A;  3ASL A;  2YQL A;  5D1L B;  1WEO A;  1FBV A;  2MD7 B;  3SOX A;  1IYM A;  4N3W A;  4WA6 A;  2Y43 A;  4AP4 A;  3NG2 A;  2YUC A;  3O7A A;  4C9Z A;  2E6R A;  3L1Z B;  1CHC A;  3T7L A;  3N9N A;  2JRJ A;  2JMI A;  4YC9 A;  4P5O B;  2YHN A;  4WZ3 B;  2CSY A;  5FB1 A;  5B78 A;  3HTK C;  2VP7 A;  1K2F A;  1RMD A;  4IC2 A;  3O37 A;  2VPB A;  4I7C A;  2K1J A;  2IDA A;  4LLB A;  4MSX A;  3KV5 A;  4AVX A;  2M3H A;  4LKA A;  2MNY A;  4I7D A;  4R8P K;  1DVP A;  3M99 A;  2VNF A;  4B86 C;  3KV6 A;  4R7E A;  2EA6 A;  2KU3 A;  2E6S A;  3O70 A;  3U5O A;  4V3L C;  2YT5 A;  3KQI A;  5FB0 A;  5LKT A;  2JMD A;  2MA5 A;  2L75 A;  3MHS A;  3KNV A;  3DQV R;  2MD8 C;  2K16 A;  5B77 A;  3U5M A;  3RPG C;  4B7Y C;  2KWO A;  2KGG A;  3M63 A;  3M62 A;  2K17 A;  5I3L A;  2NAA A;  1HYJ A;  4AUQ B;  5B79 A;  2H0D A;  2VPD A;  3N9Q A;  4LJN A;  2YU4 A;  1WES A;  2QIZ A;  2ECI A;  4Q6F A;  2VPE A;  1BOR A;  1JOC A;  3HCS A;  3ZVY A;  3IHP A;  5TDW A;  4WZ0 A;  1WEU A;  1VFY A;  2G6Q A;  4CA1 A;  1WGM A;  3ZNI A;  2BAY A;  2EOD A;  2LN0 A;  2LGL A;  4R2Y A;  2Y1M A;  3N9P A;  1G25 A;  3GV4 A;  5LKU A;  4FIP A;  4FJC A;  2PNX A;  1WEQ A;  5FEY A;  4GB0 A;  2ECJ A;  2YQM A;  4PTB A;  3SOW A;  5B75 A;  5AIU A;  4O64 A;  4GNG A;  1T1H A;  4UI9 B;  1X4J A;  3C6W A;  2LGG A;  5H1V A;  3LQI A;  4YAX A;  2ECT A;  3V43 A;  4TKP B;  1MM3 A;  1JM7 B;  3FL2 A;  5TDR A;  5LKX A;  4NN2 A;  4ZQL A;  4L58 A;  2YRE A;  4BHW A;  2FUI A;  2YHO A;  2ECV A;  2HDP A;  5KH9 A;  3C5K A;  3LQJ A;  3O36 A;  3RTR B;  4YBM A;  4BBQ A;  3HCU A;  2LDR A;  1F62 A;  5JG6 A;  2EGP A;  2XEU A;  1VYX A;  4AYC B;  5FER A;  1WFK A;  3LQH A;  2KGI A;  2KFT A;  5G05 B;  4L7X A;  2CT2 A;  4YBS A;  1U6G B;  2LGK A;  3SOU A;  2L5U A;  2L43 A;  4YAT A;  4LK9 A;  2YSJ A;  2KWN A;  4ZDT A;  4I7B A;  3I2D A;  2MT5 A;  4WZ2 A;  3N9L A;  4S3O B;  4YAB A;  4A0C D;  2LGV A;  3PUR A;  4GND A;  2AN6 A;  2CKL A;  2RSD A;  3DPL R;  5B76 A;  2KIZ A;  3MHH A;  2MA6 A;  4N4F A;  1XWH A;  5TRB A;  2I50 A;  4CCG X;  2F6J A;  5KH3 A;  1WEP A;  2G43 A;  5DKA A;  1LDK C;  5LCW B;  1MM2 A;  2M1R A;  2LRI C;  4W4U A;  2LQ6 A;  2VJE B;  5H1U A;  4MVT A;  4GNE A;  2ZET C;  2CKL B;  2F42 A;  1JM7 A;  2K4D A;  4A49 A;  1FP0 A;  2YSM A;  1WEM A;  5G0F A;  1HYI A;  2KR4 A;  3ZPV E;  2KWJ A;  2L80 A;  2CSZ A;  2LXP C;  5J3X A;  2MNZ A;  2HYE D;  1WEN A;  5H1T A;  4A4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...