2L80A

Solution structure of the zinc finger domain of usp13
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
VSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
publication title Biochemical Characterization of the Ubiquitin Receptors in USP13 Reveals Different Catalytic Activation of Deubiquitination from Its Analogue USP5
rcsb
source organism Homo sapiens
total genus 18
structure length 114
sequence length 114
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l80A01
5TABA 3L1ZB 2KR4A 5DKAA 4IC2A 5B77A 1E4UA 1FP0A 2FUIA 3N9LA 1CHCA 2ECJA 3PUQA 3ZYQA 1WILA 2LQ6A 4LLBA 3ZVZB 4I7CA 3DPLR 1HYJA 2PUYA 4W4UA 4GNFA 1LDJB 3ASLA 3HCTA 1WEUA 3LRQA 1V87A 4AYCA 2LDRA 2VP7A 5TDRA 4LKAA 3GL6A 5AIUA 1VD4A 5B78A 2LRIC 5LKZA 3SOUA 2XB1A 4P5OB 2LGVA 2L43A 3FL2A 3SOXA 4GNEA 4B7YC 5LKXA 5H9MA 3EB5A 1WEMA 2VPBA 2YHNA 5B76A 5D1MB 1WEPA 3O7AA 4LJNA 1WEEA 3RPGB 4A4BA 4LADB 2LXPC 3ZPV1 3M62A 4AUQB 3LQIA 4GNDA 5G05B 2IDAA 4ZUXU 2QJ0A 4A49A 4N3WA 5H1TA 5H1VA 1F62A 1WEQA 2F6NA 2JRJA 1WESA 4AVXA 2EA6A 2LGKA 4R8PK 4R7EA 2MA5A 2YQMA 3LQHA 4AYCB 3N9QA 5D1KB 4XI1A 3M63A 4X3GA 2MT5A 4Q6FA 4YBMA 3MHHA 4YC9A 4PPEA 4A0CD 2CSZA 3SHBA 3ZVYA 4FJCA 2MNYA 2LGGA 1ZBDB 2DX8A 4B86C 2C2VS 3N9OA 3KV5A 2ECGA 2RI7A 3QZVA 4MSXA 3U5OA 2E6SA 1WEOA 2KE1A 2M85A 1X4JA 4AP4A 2KGGA 4IC3A 2KREA 2KWOA 2H0DA 3ZPVE 4R2YA 2KFTA 3VK6A 2PNXA 2YURA 2MA6A 2KU3A 4L58A 3M99A 1T1HA 4O64A 2F6JA 2HDPA 3HTKC 4LK9A 2EODA 2CT2A 1Z6UA 2KWJA 4CA1A 4YAXA 4YBSA 2E6RA 1BORA 2K16A 4WA6A 3PURA 3HCSA 2ECWA 2JMDA 5TBNA 5LKTA 2Y43A 1LDKC 1Z2QA 3L1XA 1WEVA 2KWKA 5H1UA 2OXQC 3HCUA 2LGLA 4C9ZA 3KNVA 2JMIA 3N9MA 3RTRB 2YHOA 4UI9B 2EGPA 2NAAA 3KV6A 4QF2A 2CSYA 1U6GB 4N4FA 2ECVA 2H0DB 2VPEA 4S3OC 4WZ2A 2MIQA 2ECNA 2CKLA 4BHWA 3N9NA 1WGMA 5FEYA 3MHSA 5AITA 3O33A 4FO9A 1Z60A 2ECIA 2VPGA 3O70A 1WEWA 5JG6A 2FSAA 2YQLA 2VJEA 3C5KA 4A4CA 1XWHA 2I50A 4I7DA 2G43A 3T6RA 5B79A 3DQVR 3O35A 2QIZA 3N9PA 5LCWB 2FUUA 5TDWA 2KIZA 3O36A 5I3LA 2M6MA 2MD7B 3SOWA 2G45A 4V3LC 4BBQA 2CKLB 2YSMA 2YYRA 2JMJA 1IYMA 2Y1NA 2G6QA 2VJFA 2KWNA 2MUMA 4WZ0A 4ZQLA 1MM3A 1WE9A 3U5PA 2YW8A 5J3XA 2Y1MA 2YT5A 2M1RA 3KQIA 4NN2A 3O34A 4QF3A 2D8SA 3EB6A 5LKUA 2AN6A 2VJEB 2M3HA 5TRBA 2LV9A 3T7LA 5B8DA 2LN0A 1G25A 2KYUA 4ZDTA 4YABA 4GB0A 2YU4A 3U5NA 3C6WA 1K2FA 4YBTA 1X4UA 1DVPA 1X4IA 4FK5A 2K17A 2YREA 4UP5A 4UP0A 4S3OB 3U5MA 5FB0A 3PHDA 5D1LB 1JOCA 5KH9A 3ZTGA 5EYAF 2C2LA 3L11A 2BAYA 1JM7A 3GV4A 3I2DA 1VYXA 2VNFA 2VJFB 2K4DA 4CCGX 2L80A 2L0BA 2VPDA 3LQJA 2XEUA 1VFYA 4I7BA 5DINA 2YSJA 3RPGC 4WZ3B 2MD8C 5FERA 4FIPA 5FB1A 4TKPB 2QICA 4F52B 4YADA 1HYIA 5C13A 5G0FA 2K1JA 2L5UA 2L75A 5KH7A 1MM2A 2KGIA 2UZGA 5G04B 1RMDA 2ECTA 2LXHC 4PTBA 5C11A 5KH3A 1WENA 1FBVA 2YUCA 2F42A 3ZNIA 4YATA 4MVTA 1WFKA 3NG2A 3V43A 2ZETC 1JM7B 4L7XA 2HYED 1N87A 3IHPA 4V3KC 2MNZA 4GNGA 3O37A 1WIMA 2RSDA 5B75A
chains in the Genus database with same CATH superfamily
4OGCA 5TABA 3L1ZB 2KR4A 5DKAA 4IC2A 5B77A 1E4UA 1FP0A 2FUIA 3N9LA 1CHCA 2ECJA 3PUQA 3ZYQA 1WILA 2LQ6A 3FAOA 4LLBA 3ZVZB 4I7CA 3DPLR 1HYJA 2PUYA 4W4UA 4GNFA 2JUNA 1LDJB 3ASLA 3HCTA 1WEUA 3LRQA 1V87A 4AYCA 2LDRA 2VP7A 3MDBC 5TDRA 4LKAA 3GL6A 5AIUA 1VD4A 5B78A 2LRIC 5LKZA 4OGEA 3SOUA 2XB1A 4P5OB 2P57A 2LGVA 2L43A 2XOYA 3FL2A 3SOXA 4GNEA 4B7YC 5LKXA 5H9MA 2M13A 3EB5A 1WEMA 2VPBA 2YHNA 5B76A 5D1MB 1WEPA 3O7AA 4LJNA 1WEEA 3RPGB 4A4BA 4LADB 2LXPC 3ZPV1 3M62A 4AUQB 3LQIA 4GNDA 2KKYA 5G05B 2IDAA 4ZUXU 2QJ0A 4A49A 4N3WA 5H1TA 5H1VA 1F62A 1WEQA 2MKEA 2F6NA 2JRJA 4Z0RA 1WESA 4AVXA 2EA6A 2LGKA 4R8PK 4R7EA 2MA5A 2YQMA 3LQHA 4AYCB 3N9QA 2KKXA 5D1KB 4XI1A 5SVIA 3M63A 2FFWA 4X3GA 2MT5A 2YVRA 4Q6FA 4YBMA 3MHHA 4YC9A 4PPEA 4A0CD 2CSZA 3SHBA 3ZVYA 4FJCA 1MBMA 2MNYA 2LGGA 1ZBDB 2DX8A 5K3QA 4B86C 2C2VS 3N9OA 3KV5A 2ECGA 2RI7A 3T9KA 3QZVA 2L7PA 4MSXA 3U5OA 2E6SA 1WEOA 2D8UA 2KE1A 2M85A 1X4JA 4AP4A 4QQ4A 2KGGA 4IC3A 3H7HA 2KREA 2KWOA 3Q1DA 2H0DA 3ZPVE 4R2YA 2LAUA 2KFTA 5SVIB 3VK6A 2PNXA 2YURA 2MA6A 2KU3A 4L58A 3M99A 3PLWA 3M7KA 1T1HA 4O64A 2F6JA 2HDPA 3LDYA 3HTKC 4LK9A 3DDTA 2EODA 2CT2A 1Z6UA 2KWJA 4CA1A 4YAXA 4YBSA 2E6RA 1BORA 2K16A 4WA6A 3PURA 4Z0OA 3HCSA 2ECWA 2JMDA 5TBNA 5LKTA 2Y43A 1LDKC 2CRRA 3KDEC 1Z2QA 3L1XA 1WEVA 2KWKA 5H1UA 2OXQC 3HCUA 2LGLA 4C9ZA 3KNVA 2JMIA 3SUBA 3N9MA 3RTRB 2YHOA 4UI9B 2EGPA 2NAAA 3KV6A 4QF2A 2CSYA 1U6GB 4N4FA 2ECVA 2H0DB 2VPEA 4S3OC 4WZ2A 2MIQA 2ECNA 5SVYA 2CKLA 4BHWA 3N9NA 1WGMA 5FEYA 3MHSA 5AITA 3O33A 4FO9A 2DSMA 3LVQE 1Z60A 2ECIA 2VPGA 3O70A 1WEWA 5JG6A 2FSAA 2YQLA 2VJEA 3LVRE 3C5KA 3JUEA 4A4CA 3LJUX 1XWHA 3FJUB 4F1PA 2I50A 4I7DA 2G43A 3T6RA 5B79A 3DQVR 3O35A 2QIZA 3N9PA 5LCWB 2FUUA 5TDWA 2KIZA 3O36A 5I3LA 2M6MA 2MD7B 2B0OE 3SOWA 2G45A 4V3LC 2CONA 4BBQA 2CKLB 2YSMA 2YYRA 2JMJA 1IYMA 2Y1NA 2G6QA 2VJFA 2KWNA 2MUMA 4WZ0A 2JM3A 2CSVA 4ZQLA 1MM3A 1WE9A 3U5PA 2YW8A 5J3XA 2Y1MA 2YT5A 2M1RA 3KQIA 4NN2A 3O34A 4QF3A 2D8SA 3EB6A 5LKUA 2AN6A 2EXUA 2VJEB 2M3HA 5TRBA 2LV9A 4H9DA 3T7LA 5B8DA 2LN0A 2FD4A 1G25A 2KYUA 4ZDTA 4YABA 4GB0A 2YU4A 3U5NA 3C6WA 1K2FA 2DJAA 4YBTA 1X4UA 1DVPA 1X4IA 4FK5A 2IQJA 2K17A 2YREA 4UP5A 2RR4A 4UP0A 2XOZA 4S3OB 3U5MA 5FB0A 3PHDA 5D1LB 1JOCA 5KH9A 3ZTGA 1DCQA 3FEHA 5EYAF 2C2LA 3L11A 2BAYA 1JM7A 3FANA 3GV4A 3I2DA 1VYXA 2VNFA 2VJFB 2K4DA 2E61A 4CCGX 3E2DA 2L80A 2L0BA 2VPDA 3LQJA 2XEUA 1VFYA 2OWAA 4I7BA 5DINA 2YSJA 3O47A 3RPGC 4WZ3B 2EGMA 2MD8C 2XOCA 2XP0A 5FERA 4FIPA 5FB1A 4TKPB 2QICA 4F52B 4YADA 1HYIA 5C13A 5G0FA 3DWDA 2K1JA 2L5UA 2L75A 5KH7A 1MM2A 2KGIA 2UZGA 5G04B 1RMDA 5SVXA 2ECTA 2LXHC 4PTBA 5C11A 5KH3A 1WENA 1FBVA 2YUCA 2F42A 3ZNIA 4YATA 4MVTA 1WFKA 3NG2A 3V43A 2ZETC 2CRWA 1JM7B 4L7XA 2HYED 1N87A 3FM8C 3IHPA 4V3KC 2MNZA 4GNGA 3O37A 4O62A 1WIMA 2RSDA 5B75A
chains in the Genus database with same CATH topology
5TABA 3L1ZB 2KR4A 5DKAA 4IC2A 5B77A 1E4UA 1FP0A 2FUIA 3N9LA 1CHCA 2ECJA 3PUQA 3ZYQA 1WILA 2LQ6A 4LLBA 3ZVZB 4I7CA 3DPLR 1HYJA 2PUYA 4W4UA 4GNFA 1LDJB 3ASLA 3HCTA 1WEUA 3LRQA 1V87A 4AYCA 2LDRA 2VP7A 5TDRA 4LKAA 3GL6A 5AIUA 1VD4A 5B78A 2LRIC 5LKZA 3SOUA 2XB1A 4P5OB 2LGVA 2L43A 3FL2A 3SOXA 4GNEA 4B7YC 5LKXA 5H9MA 3EB5A 1WEMA 2VPBA 2YHNA 5B76A 5D1MB 1WEPA 3O7AA 4LJNA 1WEEA 3RPGB 4A4BA 4LADB 2LXPC 3ZPV1 3M62A 4AUQB 3LQIA 4GNDA 5G05B 2IDAA 4ZUXU 2QJ0A 4A49A 4N3WA 5H1TA 5H1VA 1F62A 1WEQA 2F6NA 2JRJA 1WESA 4AVXA 2EA6A 2LGKA 4R8PK 4R7EA 2MA5A 2YQMA 3LQHA 4AYCB 3N9QA 5D1KB 4XI1A 3M63A 4X3GA 2MT5A 4Q6FA 4YBMA 3MHHA 4YC9A 4PPEA 4A0CD 2CSZA 3SHBA 3ZVYA 4FJCA 2MNYA 2LGGA 1ZBDB 2DX8A 4B86C 2C2VS 3N9OA 3KV5A 2ECGA 2RI7A 3QZVA 4MSXA 3U5OA 2E6SA 1WEOA 2KE1A 2M85A 1X4JA 4AP4A 2KGGA 4IC3A 2KREA 2KWOA 2H0DA 3ZPVE 4R2YA 2KFTA 3VK6A 2PNXA 2YURA 2MA6A 2KU3A 4L58A 3M99A 1T1HA 4O64A 2F6JA 2HDPA 3HTKC 4LK9A 2EODA 2CT2A 1Z6UA 2KWJA 4CA1A 4YAXA 4YBSA 2E6RA 1BORA 2K16A 4WA6A 3PURA 3HCSA 2ECWA 2JMDA 5TBNA 5LKTA 2Y43A 1LDKC 1Z2QA 3L1XA 1WEVA 2KWKA 5H1UA 2OXQC 3HCUA 2LGLA 4C9ZA 3KNVA 2JMIA 3N9MA 3RTRB 2YHOA 4UI9B 2EGPA 2NAAA 3KV6A 4QF2A 2CSYA 1U6GB 4N4FA 2ECVA 2H0DB 2VPEA 4S3OC 4WZ2A 2MIQA 2ECNA 2CKLA 4BHWA 3N9NA 1WGMA 5FEYA 3MHSA 5AITA 3O33A 4FO9A 1Z60A 2ECIA 2VPGA 3O70A 1WEWA 5JG6A 2FSAA 2YQLA 2VJEA 3C5KA 4A4CA 1XWHA 2I50A 4I7DA 2G43A 3T6RA 5B79A 3DQVR 3O35A 2QIZA 3N9PA 5LCWB 2FUUA 5TDWA 2KIZA 3O36A 5I3LA 2M6MA 2MD7B 3SOWA 2G45A 4V3LC 4BBQA 2CKLB 2YSMA 2YYRA 2JMJA 1IYMA 2Y1NA 2G6QA 2VJFA 2KWNA 2MUMA 4WZ0A 4ZQLA 1MM3A 1WE9A 3U5PA 2YW8A 5J3XA 2Y1MA 2YT5A 2M1RA 3KQIA 4NN2A 3O34A 4QF3A 2D8SA 3EB6A 5LKUA 2AN6A 2VJEB 2M3HA 5TRBA 2LV9A 3T7LA 5B8DA 2LN0A 1G25A 2KYUA 4ZDTA 4YABA 4GB0A 2YU4A 3U5NA 3C6WA 1K2FA 4YBTA 1X4UA 1DVPA 1X4IA 4FK5A 2K17A 2YREA 4UP5A 4UP0A 4S3OB 3U5MA 5FB0A 3PHDA 5D1LB 1JOCA 5KH9A 3ZTGA 5EYAF 2C2LA 3L11A 2BAYA 1JM7A 3GV4A 3I2DA 1VYXA 2VNFA 2VJFB 2K4DA 4CCGX 2L80A 2L0BA 2VPDA 3LQJA 2XEUA 1VFYA 4I7BA 5DINA 2YSJA 3RPGC 4WZ3B 2MD8C 5FERA 4FIPA 5FB1A 4TKPB 2QICA 4F52B 4YADA 1HYIA 5C13A 5G0FA 2K1JA 2L5UA 2L75A 5KH7A 1MM2A 2KGIA 2UZGA 5G04B 1RMDA 2ECTA 2LXHC 4PTBA 5C11A 5KH3A 1WENA 1FBVA 2YUCA 2F42A 3ZNIA 4YATA 4MVTA 1WFKA 3NG2A 3V43A 2ZETC 1JM7B 4L7XA 2HYED 1N87A 3IHPA 4V3KC 2MNZA 4GNGA 3O37A 1WIMA 2RSDA 5B75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TAB A;  3L1Z B;  2KR4 A;  5DKA A;  4IC2 A;  5B77 A;  1E4U A;  1FP0 A;  2FUI A;  3N9L A;  1CHC A;  2ECJ A;  3PUQ A;  3ZYQ A;  1WIL A;  2LQ6 A;  4LLB A;  3ZVZ B;  4I7C A;  3DPL R;  1HYJ A;  2PUY A;  4W4U A;  4GNF A;  1LDJ B;  3ASL A;  3HCT A;  1WEU A;  3LRQ A;  1V87 A;  4AYC A;  2LDR A;  2VP7 A;  5TDR A;  4LKA A;  3GL6 A;  5AIU A;  1VD4 A;  5B78 A;  2LRI C;  5LKZ A;  3SOU A;  2XB1 A;  4P5O B;  2LGV A;  2L43 A;  3FL2 A;  3SOX A;  4GNE A;  4B7Y C;  5LKX A;  5H9M A;  3EB5 A;  1WEM A;  2VPB A;  2YHN A;  5B76 A;  5D1M B;  1WEP A;  3O7A A;  4LJN A;  1WEE A;  3RPG B;  4A4B A;  4LAD B;  2LXP C;  3ZPV 1;  3M62 A;  4AUQ B;  3LQI A;  4GND A;  5G05 B;  2IDA A;  4ZUX U;  2QJ0 A;  4A49 A;  4N3W A;  5H1T A;  5H1V A;  1F62 A;  1WEQ A;  2F6N A;  2JRJ A;  1WES A;  4AVX A;  2EA6 A;  2LGK A;  4R8P K;  4R7E A;  2MA5 A;  2YQM A;  3LQH A;  4AYC B;  3N9Q A;  5D1K B;  4XI1 A;  3M63 A;  4X3G A;  2MT5 A;  4Q6F A;  4YBM A;  3MHH A;  4YC9 A;  4PPE A;  4A0C D;  2CSZ A;  3SHB A;  3ZVY A;  4FJC A;  2MNY A;  2LGG A;  1ZBD B;  2DX8 A;  4B86 C;  2C2V S;  3N9O A;  3KV5 A;  2ECG A;  2RI7 A;  3QZV A;  4MSX A;  3U5O A;  2E6S A;  1WEO A;  2KE1 A;  2M85 A;  1X4J A;  4AP4 A;  2KGG A;  4IC3 A;  2KRE A;  2KWO A;  2H0D A;  3ZPV E;  4R2Y A;  2KFT A;  3VK6 A;  2PNX A;  2YUR A;  2MA6 A;  2KU3 A;  4L58 A;  3M99 A;  1T1H A;  4O64 A;  2F6J A;  2HDP A;  3HTK C;  4LK9 A;  2EOD A;  2CT2 A;  1Z6U A;  2KWJ A;  4CA1 A;  4YAX A;  4YBS A;  2E6R A;  1BOR A;  2K16 A;  4WA6 A;  3PUR A;  3HCS A;  2ECW A;  2JMD A;  5TBN A;  5LKT A;  2Y43 A;  1LDK C;  1Z2Q A;  3L1X A;  1WEV A;  2KWK A;  5H1U A;  2OXQ C;  3HCU A;  2LGL A;  4C9Z A;  3KNV A;  2JMI A;  3N9M A;  3RTR B;  2YHO A;  4UI9 B;  2EGP A;  2NAA A;  3KV6 A;  4QF2 A;  2CSY A;  1U6G B;  4N4F A;  2ECV A;  2H0D B;  2VPE A;  4S3O C;  4WZ2 A;  2MIQ A;  2ECN A;  2CKL A;  4BHW A;  3N9N A;  1WGM A;  5FEY A;  3MHS A;  5AIT A;  3O33 A;  4FO9 A;  1Z60 A;  2ECI A;  2VPG A;  3O70 A;  1WEW A;  5JG6 A;  2FSA A;  2YQL A;  2VJE A;  3C5K A;  4A4C A;  1XWH A;  2I50 A;  4I7D A;  2G43 A;  3T6R A;  5B79 A;  3DQV R;  3O35 A;  2QIZ A;  3N9P A;  5LCW B;  2FUU A;  5TDW A;  2KIZ A;  3O36 A;  5I3L A;  2M6M A;  2MD7 B;  3SOW A;  2G45 A;  4V3L C;  4BBQ A;  2CKL B;  2YSM A;  2YYR A;  2JMJ A;  1IYM A;  2Y1N A;  2G6Q A;  2VJF A;  2KWN A;  2MUM A;  4WZ0 A;  4ZQL A;  1MM3 A;  1WE9 A;  3U5P A;  2YW8 A;  5J3X A;  2Y1M A;  2YT5 A;  2M1R A;  3KQI A;  4NN2 A;  3O34 A;  4QF3 A;  2D8S A;  3EB6 A;  5LKU A;  2AN6 A;  2VJE B;  2M3H A;  5TRB A;  2LV9 A;  3T7L A;  5B8D A;  2LN0 A;  1G25 A;  2KYU A;  4ZDT A;  4YAB A;  4GB0 A;  2YU4 A;  3U5N A;  3C6W A;  1K2F A;  4YBT A;  1X4U A;  1DVP A;  1X4I A;  4FK5 A;  2K17 A;  2YRE A;  4UP5 A;  4UP0 A;  4S3O B;  3U5M A;  5FB0 A;  3PHD A;  5D1L B;  1JOC A;  5KH9 A;  3ZTG A;  5EYA F;  2C2L A;  3L11 A;  2BAY A;  1JM7 A;  3GV4 A;  3I2D A;  1VYX A;  2VNF A;  2VJF B;  2K4D A;  4CCG X;  2L80 A;  2L0B A;  2VPD A;  3LQJ A;  2XEU A;  1VFY A;  4I7B A;  5DIN A;  2YSJ A;  3RPG C;  4WZ3 B;  2MD8 C;  5FER A;  4FIP A;  5FB1 A;  4TKP B;  2QIC A;  4F52 B;  4YAD A;  1HYI A;  5C13 A;  5G0F A;  2K1J A;  2L5U A;  2L75 A;  5KH7 A;  1MM2 A;  2KGI A;  2UZG A;  5G04 B;  1RMD A;  2ECT A;  2LXH C;  4PTB A;  5C11 A;  5KH3 A;  1WEN A;  1FBV A;  2YUC A;  2F42 A;  3ZNI A;  4YAT A;  4MVT A;  1WFK A;  3NG2 A;  3V43 A;  2ZET C;  1JM7 B;  4L7X A;  2HYE D;  1N87 A;  3IHP A;  4V3K C;  2MNZ A;  4GNG A;  3O37 A;  1WIM A;  2RSD A;  5B75 A; 
#chains in the Genus database with same CATH topology
 4OGC A;  5TAB A;  3L1Z B;  2KR4 A;  5DKA A;  4IC2 A;  5B77 A;  1E4U A;  1FP0 A;  2FUI A;  3N9L A;  1CHC A;  2ECJ A;  3PUQ A;  3ZYQ A;  1WIL A;  2LQ6 A;  3FAO A;  4LLB A;  3ZVZ B;  4I7C A;  3DPL R;  1HYJ A;  2PUY A;  4W4U A;  4GNF A;  2JUN A;  1LDJ B;  3ASL A;  3HCT A;  1WEU A;  3LRQ A;  1V87 A;  4AYC A;  2LDR A;  2VP7 A;  3MDB C;  5TDR A;  4LKA A;  3GL6 A;  5AIU A;  1VD4 A;  5B78 A;  2LRI C;  5LKZ A;  4OGE A;  3SOU A;  2XB1 A;  4P5O B;  2P57 A;  2LGV A;  2L43 A;  2XOY A;  3FL2 A;  3SOX A;  4GNE A;  4B7Y C;  5LKX A;  5H9M A;  2M13 A;  3EB5 A;  1WEM A;  2VPB A;  2YHN A;  5B76 A;  5D1M B;  1WEP A;  3O7A A;  4LJN A;  1WEE A;  3RPG B;  4A4B A;  4LAD B;  2LXP C;  3ZPV 1;  3M62 A;  4AUQ B;  3LQI A;  4GND A;  2KKY A;  5G05 B;  2IDA A;  4ZUX U;  2QJ0 A;  4A49 A;  4N3W A;  5H1T A;  5H1V A;  1F62 A;  1WEQ A;  2MKE A;  2F6N A;  2JRJ A;  4Z0R A;  1WES A;  4AVX A;  2EA6 A;  2LGK A;  4R8P K;  4R7E A;  2MA5 A;  2YQM A;  3LQH A;  4AYC B;  3N9Q A;  2KKX A;  5D1K B;  4XI1 A;  5SVI A;  3M63 A;  2FFW A;  4X3G A;  2MT5 A;  2YVR A;  4Q6F A;  4YBM A;  3MHH A;  4YC9 A;  4PPE A;  4A0C D;  2CSZ A;  3SHB A;  3ZVY A;  4FJC A;  1MBM A;  2MNY A;  2LGG A;  1ZBD B;  2DX8 A;  5K3Q A;  4B86 C;  2C2V S;  3N9O A;  3KV5 A;  2ECG A;  2RI7 A;  3T9K A;  3QZV A;  2L7P A;  4MSX A;  3U5O A;  2E6S A;  1WEO A;  2D8U A;  2KE1 A;  2M85 A;  1X4J A;  4AP4 A;  4QQ4 A;  2KGG A;  4IC3 A;  3H7H A;  2KRE A;  2KWO A;  3Q1D A;  2H0D A;  3ZPV E;  4R2Y A;  2LAU A;  2KFT A;  5SVI B;  3VK6 A;  2PNX A;  2YUR A;  2MA6 A;  2KU3 A;  4L58 A;  3M99 A;  3PLW A;  3M7K A;  1T1H A;  4O64 A;  2F6J A;  2HDP A;  3LDY A;  3HTK C;  4LK9 A;  3DDT A;  2EOD A;  2CT2 A;  1Z6U A;  2KWJ A;  4CA1 A;  4YAX A;  4YBS A;  2E6R A;  1BOR A;  2K16 A;  4WA6 A;  3PUR A;  4Z0O A;  3HCS A;  2ECW A;  2JMD A;  5TBN A;  5LKT A;  2Y43 A;  1LDK C;  2CRR A;  3KDE C;  1Z2Q A;  3L1X A;  1WEV A;  2KWK A;  5H1U A;  2OXQ C;  3HCU A;  2LGL A;  4C9Z A;  3KNV A;  2JMI A;  3SUB A;  3N9M A;  3RTR B;  2YHO A;  4UI9 B;  2EGP A;  2NAA A;  3KV6 A;  4QF2 A;  2CSY A;  1U6G B;  4N4F A;  2ECV A;  2H0D B;  2VPE A;  4S3O C;  4WZ2 A;  2MIQ A;  2ECN A;  5SVY A;  2CKL A;  4BHW A;  3N9N A;  1WGM A;  5FEY A;  3MHS A;  5AIT A;  3O33 A;  4FO9 A;  2DSM A;  3LVQ E;  1Z60 A;  2ECI A;  2VPG A;  3O70 A;  1WEW A;  5JG6 A;  2FSA A;  2YQL A;  2VJE A;  3LVR E;  3C5K A;  3JUE A;  4A4C A;  3LJU X;  1XWH A;  3FJU B;  4F1P A;  2I50 A;  4I7D A;  2G43 A;  3T6R A;  5B79 A;  3DQV R;  3O35 A;  2QIZ A;  3N9P A;  5LCW B;  2FUU A;  5TDW A;  2KIZ A;  3O36 A;  5I3L A;  2M6M A;  2MD7 B;  2B0O E;  3SOW A;  2G45 A;  4V3L C;  2CON A;  4BBQ A;  2CKL B;  2YSM A;  2YYR A;  2JMJ A;  1IYM A;  2Y1N A;  2G6Q A;  2VJF A;  2KWN A;  2MUM A;  4WZ0 A;  2JM3 A;  2CSV A;  4ZQL A;  1MM3 A;  1WE9 A;  3U5P A;  2YW8 A;  5J3X A;  2Y1M A;  2YT5 A;  2M1R A;  3KQI A;  4NN2 A;  3O34 A;  4QF3 A;  2D8S A;  3EB6 A;  5LKU A;  2AN6 A;  2EXU A;  2VJE B;  2M3H A;  5TRB A;  2LV9 A;  4H9D A;  3T7L A;  5B8D A;  2LN0 A;  2FD4 A;  1G25 A;  2KYU A;  4ZDT A;  4YAB A;  4GB0 A;  2YU4 A;  3U5N A;  3C6W A;  1K2F A;  2DJA A;  4YBT A;  1X4U A;  1DVP A;  1X4I A;  4FK5 A;  2IQJ A;  2K17 A;  2YRE A;  4UP5 A;  2RR4 A;  4UP0 A;  2XOZ A;  4S3O B;  3U5M A;  5FB0 A;  3PHD A;  5D1L B;  1JOC A;  5KH9 A;  3ZTG A;  1DCQ A;  3FEH A;  5EYA F;  2C2L A;  3L11 A;  2BAY A;  1JM7 A;  3FAN A;  3GV4 A;  3I2D A;  1VYX A;  2VNF A;  2VJF B;  2K4D A;  2E61 A;  4CCG X;  3E2D A;  2L80 A;  2L0B A;  2VPD A;  3LQJ A;  2XEU A;  1VFY A;  2OWA A;  4I7B A;  5DIN A;  2YSJ A;  3O47 A;  3RPG C;  4WZ3 B;  2EGM A;  2MD8 C;  2XOC A;  2XP0 A;  5FER A;  4FIP A;  5FB1 A;  4TKP B;  2QIC A;  4F52 B;  4YAD A;  1HYI A;  5C13 A;  5G0F A;  3DWD A;  2K1J A;  2L5U A;  2L75 A;  5KH7 A;  1MM2 A;  2KGI A;  2UZG A;  5G04 B;  1RMD A;  5SVX A;  2ECT A;  2LXH C;  4PTB A;  5C11 A;  5KH3 A;  1WEN A;  1FBV A;  2YUC A;  2F42 A;  3ZNI A;  4YAT A;  4MVT A;  1WFK A;  3NG2 A;  3V43 A;  2ZET C;  2CRW A;  1JM7 B;  4L7X A;  2HYE D;  1N87 A;  3FM8 C;  3IHP A;  4V3K C;  2MNZ A;  4GNG A;  3O37 A;  4O62 A;  1WIM A;  2RSD A;  5B75 A; 
#chains in the Genus database with same CATH homology
 5TAB A;  3L1Z B;  2KR4 A;  5DKA A;  4IC2 A;  5B77 A;  1E4U A;  1FP0 A;  2FUI A;  3N9L A;  1CHC A;  2ECJ A;  3PUQ A;  3ZYQ A;  1WIL A;  2LQ6 A;  4LLB A;  3ZVZ B;  4I7C A;  3DPL R;  1HYJ A;  2PUY A;  4W4U A;  4GNF A;  1LDJ B;  3ASL A;  3HCT A;  1WEU A;  3LRQ A;  1V87 A;  4AYC A;  2LDR A;  2VP7 A;  5TDR A;  4LKA A;  3GL6 A;  5AIU A;  1VD4 A;  5B78 A;  2LRI C;  5LKZ A;  3SOU A;  2XB1 A;  4P5O B;  2LGV A;  2L43 A;  3FL2 A;  3SOX A;  4GNE A;  4B7Y C;  5LKX A;  5H9M A;  3EB5 A;  1WEM A;  2VPB A;  2YHN A;  5B76 A;  5D1M B;  1WEP A;  3O7A A;  4LJN A;  1WEE A;  3RPG B;  4A4B A;  4LAD B;  2LXP C;  3ZPV 1;  3M62 A;  4AUQ B;  3LQI A;  4GND A;  5G05 B;  2IDA A;  4ZUX U;  2QJ0 A;  4A49 A;  4N3W A;  5H1T A;  5H1V A;  1F62 A;  1WEQ A;  2F6N A;  2JRJ A;  1WES A;  4AVX A;  2EA6 A;  2LGK A;  4R8P K;  4R7E A;  2MA5 A;  2YQM A;  3LQH A;  4AYC B;  3N9Q A;  5D1K B;  4XI1 A;  3M63 A;  4X3G A;  2MT5 A;  4Q6F A;  4YBM A;  3MHH A;  4YC9 A;  4PPE A;  4A0C D;  2CSZ A;  3SHB A;  3ZVY A;  4FJC A;  2MNY A;  2LGG A;  1ZBD B;  2DX8 A;  4B86 C;  2C2V S;  3N9O A;  3KV5 A;  2ECG A;  2RI7 A;  3QZV A;  4MSX A;  3U5O A;  2E6S A;  1WEO A;  2KE1 A;  2M85 A;  1X4J A;  4AP4 A;  2KGG A;  4IC3 A;  2KRE A;  2KWO A;  2H0D A;  3ZPV E;  4R2Y A;  2KFT A;  3VK6 A;  2PNX A;  2YUR A;  2MA6 A;  2KU3 A;  4L58 A;  3M99 A;  1T1H A;  4O64 A;  2F6J A;  2HDP A;  3HTK C;  4LK9 A;  2EOD A;  2CT2 A;  1Z6U A;  2KWJ A;  4CA1 A;  4YAX A;  4YBS A;  2E6R A;  1BOR A;  2K16 A;  4WA6 A;  3PUR A;  3HCS A;  2ECW A;  2JMD A;  5TBN A;  5LKT A;  2Y43 A;  1LDK C;  1Z2Q A;  3L1X A;  1WEV A;  2KWK A;  5H1U A;  2OXQ C;  3HCU A;  2LGL A;  4C9Z A;  3KNV A;  2JMI A;  3N9M A;  3RTR B;  2YHO A;  4UI9 B;  2EGP A;  2NAA A;  3KV6 A;  4QF2 A;  2CSY A;  1U6G B;  4N4F A;  2ECV A;  2H0D B;  2VPE A;  4S3O C;  4WZ2 A;  2MIQ A;  2ECN A;  2CKL A;  4BHW A;  3N9N A;  1WGM A;  5FEY A;  3MHS A;  5AIT A;  3O33 A;  4FO9 A;  1Z60 A;  2ECI A;  2VPG A;  3O70 A;  1WEW A;  5JG6 A;  2FSA A;  2YQL A;  2VJE A;  3C5K A;  4A4C A;  1XWH A;  2I50 A;  4I7D A;  2G43 A;  3T6R A;  5B79 A;  3DQV R;  3O35 A;  2QIZ A;  3N9P A;  5LCW B;  2FUU A;  5TDW A;  2KIZ A;  3O36 A;  5I3L A;  2M6M A;  2MD7 B;  3SOW A;  2G45 A;  4V3L C;  4BBQ A;  2CKL B;  2YSM A;  2YYR A;  2JMJ A;  1IYM A;  2Y1N A;  2G6Q A;  2VJF A;  2KWN A;  2MUM A;  4WZ0 A;  4ZQL A;  1MM3 A;  1WE9 A;  3U5P A;  2YW8 A;  5J3X A;  2Y1M A;  2YT5 A;  2M1R A;  3KQI A;  4NN2 A;  3O34 A;  4QF3 A;  2D8S A;  3EB6 A;  5LKU A;  2AN6 A;  2VJE B;  2M3H A;  5TRB A;  2LV9 A;  3T7L A;  5B8D A;  2LN0 A;  1G25 A;  2KYU A;  4ZDT A;  4YAB A;  4GB0 A;  2YU4 A;  3U5N A;  3C6W A;  1K2F A;  4YBT A;  1X4U A;  1DVP A;  1X4I A;  4FK5 A;  2K17 A;  2YRE A;  4UP5 A;  4UP0 A;  4S3O B;  3U5M A;  5FB0 A;  3PHD A;  5D1L B;  1JOC A;  5KH9 A;  3ZTG A;  5EYA F;  2C2L A;  3L11 A;  2BAY A;  1JM7 A;  3GV4 A;  3I2D A;  1VYX A;  2VNF A;  2VJF B;  2K4D A;  4CCG X;  2L80 A;  2L0B A;  2VPD A;  3LQJ A;  2XEU A;  1VFY A;  4I7B A;  5DIN A;  2YSJ A;  3RPG C;  4WZ3 B;  2MD8 C;  5FER A;  4FIP A;  5FB1 A;  4TKP B;  2QIC A;  4F52 B;  4YAD A;  1HYI A;  5C13 A;  5G0F A;  2K1J A;  2L5U A;  2L75 A;  5KH7 A;  1MM2 A;  2KGI A;  2UZG A;  5G04 B;  1RMD A;  2ECT A;  2LXH C;  4PTB A;  5C11 A;  5KH3 A;  1WEN A;  1FBV A;  2YUC A;  2F42 A;  3ZNI A;  4YAT A;  4MVT A;  1WFK A;  3NG2 A;  3V43 A;  2ZET C;  1JM7 B;  4L7X A;  2HYE D;  1N87 A;  3IHP A;  4V3K C;  2MNZ A;  4GNG A;  3O37 A;  1WIM A;  2RSD A;  5B75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...