2L80A

Solution structure of the zinc finger domain of usp13
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
VSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
publication title Biochemical Characterization of the Ubiquitin Receptors in USP13 Reveals Different Catalytic Activation of Deubiquitination from Its Analogue USP5
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 114
sequence length 114
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l80A01
3QZVA 2MT5A 4WA6A 2YUCA 2ZETC 2VPDA 4AYCB 2XB1A 4B7YC 3KV6A 1HYJA 1VD4A 2YQLA 3M63A 1N87A 4UI9B 4V3LC 4WZ3B 2G6QA 3ASLA 3KNVA 4UP0A 2M85A 1WILA 4WZ2A 4N3WA 5LKUA 3MHHA 2MNZA 2LGVA 3KV5A 1JM7B 2LGKA 5B8DA 1FBVA 1Z2QA 5KH9A 4QF3A 2CSZA 4YBSA 2ECVA 2VJFA 2KGIA 2RSDA 2LDRA 5TABA 3LQHA 2H0DB 4FJCA 5JG6A 1VFYA 4I7BA 3N9QA 1IYMA 2CKLB 3I2DA 3VK6A 4CCGX 2VP7A 4Q6FA 2PUYA 3O37A 1WEQA 3MHSA 2L75A 2KWJA 1WFKA 4IC3A 2NAAA 2VNFA 4R7EA 2VPGA 3PURA 1V87A 3GV4A 3ZPV1 4MSXA 2AN6A 2UZGA 3ZVZB 4GB0A 2JMIA 4CA1A 2K1JA 4X3GA 1XWHA 2K16A 1HYIA 2PNXA 5LKZA 1T1HA 1Z60A 3U5OA 5B79A 3N9OA 2VJEA 2LV9A 4GNDA 2F6NA 5AIUA 3SHBA 3N9NA 5H1UA 3O34A 5DKAA 5C11A 4GNFA 3SOXA 1F62A 2MNYA 3ZNIA 4ZDTA 3HTKC 2OXQC 4ZQLA 2YURA 2ECWA 2HYED 3PHDA 1WEVA 5D1KB 4FIPA 3O33A 3RPGC 2YHNA 4YABA 5G05B 2EA6A 4XI1A 2HDPA 2FUIA 2LN0A 4ZUXU 2Y1MA 1ZBDB 2F42A 2DX8A 5D1MB 3ZTGA 5G04B 4YBMA 5G0FA 5H1VA 2KREA 2C2LA 2K4DA 2FUUA 3N9PA 4FO9A 1LDJB 3DQVR 5FB1A 3C5KA 4R8PK 2VJFB 2ECNA 4L58A 1WEWA 3EB5A 1Z6UA 3KQIA 3N9LA 4MVTA 2YU4A 5D1LB 2MD7B 2JMJA 3ZPVE 2KE1A 4GNEA 5KH3A 2BAYA 4I7CA 1WE9A 4P5OB 4S3OC 3NG2A 1WGMA 4FK5A 4O64A 2C2VS 4YATA 1WESA 5FB0A 4L7XA 2CT2A 2QIZA 2RI7A 4W4UA 3O70A 2MUMA 5TDRA 2YW8A 2L80A 4PTBA 4GNGA 3C6WA 2LXPC 2F6JA 3T6RA 4BHWA 4LKAA 2KU3A 4A49A 5DINA 4NN2A 4YBTA 3N9MA 2JMDA 1WIMA 1WEPA 3U5MA 4LADB 3ZVYA 2MA5A 2VPBA 2EGPA 1G25A 5TRBA 4V3KC 3PUQA 1DVPA 5H1TA 2LQ6A 2Y1NA 4LK9A 1LDKC 2ECTA 4R2YA 5TDWA 3GL6A 2I50A 4YC9A 3U5NA 2YREA 3HCUA 1K2FA 2YSJA 4PPEA 3L1XA 2MIQA 1BORA 2E6RA 4AUQB 3O7AA 3V43A 5B78A 2D8SA 3RPGB 1MM2A 4A4CA 5J3XA 2YYRA 2YT5A 3L1ZB 2YHOA 4YADA 3SOWA 4AVXA 4LJNA 3IHPA 2M3HA 3HCSA 2M6MA 4A0CD 1WEUA 5B75A 2KWOA 1JOCA 3M99A 3O35A 5LKTA 3O36A 4I7DA 4LLBA 3EB6A 1MM3A 5LKXA 2LXHC 1X4IA 4AYCA 3SOUA 1X4JA 2ECIA 5FEYA 5AITA 5B76A 2YQMA 5B77A 4N4FA 3RTRB 2ECGA 4WZ0A 2IDAA 2VPEA 3L11A 1JM7A 1WEOA 2G43A 3LRQA 5C13A 1X4UA 5H9MA 1WEEA 2VJEB 4S3OB 2G45A 5I3LA 1CHCA 2H0DA 2CKLA 5FERA 2QICA 2LGLA 1VYXA 4UP5A 2QJ0A 1RMDA 5TBNA 2L43A 2KWNA 2Y43A 5LCWB 4C9ZA 1WEMA 2CSYA 4QF2A 3HCTA 1WENA 1E4UA 2JRJA 4IC2A 4A4BA 3ZYQA 4AP4A 5EYAF 4YAXA 2KR4A 2M1RA 2ECJA 5KH7A 2E6SA 2YSMA 3FL2A 2KFTA 2KIZA 2L5UA 4BBQA 3U5PA 2EODA 2KYUA 2LGGA 3LQJA 3DPLR 3M62A 2MD8C 2KGGA 4TKPB 2FSAA 2XEUA 4F52B 2KWKA 1FP0A 2K17A 2LRIC 4B86C 2L0BA 2MA6A 3LQIA 1U6GB 3T7LA
chains in the Genus database with same CATH superfamily
3QZVA 2MT5A 4WA6A 2YUCA 2ZETC 2VPDA 2JM3A 4AYCB 2XB1A 4B7YC 3KV6A 1HYJA 3DDTA 1VD4A 2FFWA 2YQLA 2XOCA 1N87A 3M63A 4UI9B 1DCQA 4V3LC 2G6QA 4WZ3B 3ASLA 3KNVA 4UP0A 2M85A 1WILA 4WZ2A 4N3WA 5LKUA 3MHHA 2MNZA 2B0OE 2LGVA 2EGMA 3KV5A 3LJUX 1JM7B 2LGKA 5B8DA 1FBVA 2CONA 1Z2QA 4H9DA 5KH9A 4QF3A 2CSZA 4YBSA 2ECVA 2VJFA 2KGIA 2RSDA 2LDRA 5TABA 3LQHA 2H0DB 4FJCA 5JG6A 1VFYA 4I7BA 3N9QA 1IYMA 2CKLB 3I2DA 3VK6A 4CCGX 2VP7A 4Q6FA 2PUYA 2L7PA 3O37A 1WEQA 2CRRA 2L75A 3MHSA 2KWJA 1WFKA 4IC3A 2NAAA 2VNFA 4R7EA 2VPGA 3PURA 1V87A 3GV4A 3ZPV1 4MSXA 2AN6A 2LAUA 2UZGA 3ZVZB 4GB0A 2JMIA 4CA1A 2K1JA 4X3GA 1XWHA 2K16A 1HYIA 2PNXA 5LKZA 1T1HA 1Z60A 3U5OA 2M13A 5K3QA 3T9KA 2RR4A 4QQ4A 5B79A 4OGEA 4OGCA 3N9OA 2VJEA 3FANA 2LV9A 4GNDA 2F6NA 5AIUA 2XOZA 3SHBA 3N9NA 5SVXA 5H1UA 3O34A 5DKAA 5C11A 4GNFA 3SOXA 1F62A 2MNYA 3ZNIA 4ZDTA 3FAOA 3HTKC 2OXQC 4ZQLA 3H7HA 2YURA 2ECWA 2HYED 3PHDA 1WEVA 5D1KB 4FIPA 3O33A 3RPGC 2YHNA 4YABA 5G05B 2EA6A 4XI1A 2HDPA 2FUIA 2LN0A 4ZUXU 2Y1MA 1ZBDB 2F42A 2DX8A 5D1MB 3ZTGA 5G04B 4YBMA 5G0FA 5H1VA 2KREA 3E2DA 2C2LA 2K4DA 2FUUA 3N9PA 4FO9A 1LDJB 3DQVR 5FB1A 3C5KA 4R8PK 2VJFB 2ECNA 4L58A 1WEWA 3EB5A 1Z6UA 3KQIA 3N9LA 4MVTA 2YU4A 5D1LB 2MD7B 2JMJA 2IQJA 3ZPVE 2KE1A 4GNEA 5KH3A 2BAYA 4I7CA 4O62A 1WE9A 4P5OB 4S3OC 3NG2A 1WGMA 4FK5A 4O64A 2C2VS 4YATA 3LDYA 1WESA 5FB0A 4L7XA 2CT2A 2QIZA 2RI7A 4W4UA 2DSMA 2FD4A 3O70A 2MUMA 5TDRA 2YW8A 2L80A 4PTBA 4GNGA 3C6WA 2LXPC 2F6JA 2XP0A 2EXUA 4Z0OA 2KKXA 3T6RA 4BHWA 4LKAA 2KU3A 4A49A 5DINA 4NN2A 4YBTA 3N9MA 2JMDA 1WIMA 1WEPA 3LVQE 3U5MA 4LADB 3ZVYA 2MA5A 3KDEC 2VPBA 2EGPA 1G25A 5TRBA 4V3KC 3PUQA 1DVPA 5H1TA 2LQ6A 3SUBA 1MBMA 2Y1NA 4LK9A 1LDKC 2ECTA 4R2YA 5TDWA 3GL6A 2I50A 4YC9A 5SVIA 3U5NA 2YREA 2XOYA 3HCUA 1K2FA 2CSVA 2YSJA 4PPEA 3L1XA 2MIQA 1BORA 2E6RA 4AUQB 3O7AA 3V43A 5B78A 2OWAA 2D8SA 3RPGB 1MM2A 4A4CA 5J3XA 2YYRA 2YT5A 3L1ZB 2YHOA 2CRWA 4YADA 3SOWA 4AVXA 3JUEA 4LJNA 3IHPA 2M3HA 3HCSA 3FM8C 2M6MA 4A0CD 1WEUA 5B75A 2KWOA 1JOCA 3M99A 3O35A 5LKTA 3O36A 2YVRA 4I7DA 4LLBA 3DWDA 3EB6A 1MM3A 3LVRE 5LKXA 2LXHC 4F1PA 1X4IA 2D8UA 2MKEA 4AYCA 3FEHA 3SOUA 1X4JA 2P57A 2ECIA 5FEYA 2DJAA 5AITA 5B76A 2YQMA 5B77A 4N4FA 3RTRB 2ECGA 4WZ0A 2IDAA 2VPEA 3L11A 1JM7A 4Z0RA 1WEOA 2G43A 3LRQA 5C13A 3M7KA 5SVYA 1X4UA 5H9MA 1WEEA 2VJEB 4S3OB 2G45A 5I3LA 1CHCA 2H0DA 3Q1DA 2CKLA 5FERA 2QICA 2LGLA 1VYXA 2KKYA 4UP5A 2QJ0A 1RMDA 3PLWA 5TBNA 2L43A 2KWNA 2Y43A 5LCWB 4C9ZA 1WEMA 2CSYA 4QF2A 3HCTA 1WENA 1E4UA 2JRJA 4IC2A 4A4BA 3ZYQA 4AP4A 5EYAF 4YAXA 2KR4A 2M1RA 5SVIB 2ECJA 5KH7A 2E6SA 2YSMA 3FL2A 2KFTA 2KIZA 3MDBC 2JUNA 2L5UA 4BBQA 3U5PA 2EODA 2KYUA 2LGGA 3LQJA 3DPLR 3M62A 2MD8C 2KGGA 4TKPB 2FSAA 2XEUA 4F52B 2KWKA 2E61A 3O47A 1FP0A 2K17A 2LRIC 4B86C 2L0BA 2MA6A 3LQIA 3FJUB 1U6GB 3T7LA
chains in the Genus database with same CATH topology
3QZVA 2MT5A 4WA6A 2YUCA 2ZETC 2VPDA 4AYCB 2XB1A 4B7YC 3KV6A 1HYJA 1VD4A 2YQLA 3M63A 1N87A 4UI9B 4V3LC 4WZ3B 2G6QA 3ASLA 3KNVA 4UP0A 2M85A 1WILA 4WZ2A 4N3WA 5LKUA 3MHHA 2MNZA 2LGVA 3KV5A 1JM7B 2LGKA 5B8DA 1FBVA 1Z2QA 5KH9A 4QF3A 2CSZA 4YBSA 2ECVA 2VJFA 2KGIA 2RSDA 2LDRA 5TABA 3LQHA 2H0DB 4FJCA 5JG6A 1VFYA 4I7BA 3N9QA 1IYMA 2CKLB 3I2DA 3VK6A 4CCGX 2VP7A 4Q6FA 2PUYA 3O37A 1WEQA 3MHSA 2L75A 2KWJA 1WFKA 4IC3A 2NAAA 2VNFA 4R7EA 2VPGA 3PURA 1V87A 3GV4A 3ZPV1 4MSXA 2AN6A 2UZGA 3ZVZB 4GB0A 2JMIA 4CA1A 2K1JA 4X3GA 1XWHA 2K16A 1HYIA 2PNXA 5LKZA 1T1HA 1Z60A 3U5OA 5B79A 3N9OA 2VJEA 2LV9A 4GNDA 2F6NA 5AIUA 3SHBA 3N9NA 5H1UA 3O34A 5DKAA 5C11A 4GNFA 3SOXA 1F62A 2MNYA 3ZNIA 4ZDTA 3HTKC 2OXQC 4ZQLA 2YURA 2ECWA 2HYED 3PHDA 1WEVA 5D1KB 4FIPA 3O33A 3RPGC 2YHNA 4YABA 5G05B 2EA6A 4XI1A 2HDPA 2FUIA 2LN0A 4ZUXU 2Y1MA 1ZBDB 2F42A 2DX8A 5D1MB 3ZTGA 5G04B 4YBMA 5G0FA 5H1VA 2KREA 2C2LA 2K4DA 2FUUA 3N9PA 4FO9A 1LDJB 3DQVR 5FB1A 3C5KA 4R8PK 2VJFB 2ECNA 4L58A 1WEWA 3EB5A 1Z6UA 3KQIA 3N9LA 4MVTA 2YU4A 5D1LB 2MD7B 2JMJA 3ZPVE 2KE1A 4GNEA 5KH3A 2BAYA 4I7CA 1WE9A 4P5OB 4S3OC 3NG2A 1WGMA 4FK5A 4O64A 2C2VS 4YATA 1WESA 5FB0A 4L7XA 2CT2A 2QIZA 2RI7A 4W4UA 3O70A 2MUMA 5TDRA 2YW8A 2L80A 4PTBA 4GNGA 3C6WA 2LXPC 2F6JA 3T6RA 4BHWA 4LKAA 2KU3A 4A49A 5DINA 4NN2A 4YBTA 3N9MA 2JMDA 1WIMA 1WEPA 3U5MA 4LADB 3ZVYA 2MA5A 2VPBA 2EGPA 1G25A 5TRBA 4V3KC 3PUQA 1DVPA 5H1TA 2LQ6A 2Y1NA 4LK9A 1LDKC 2ECTA 4R2YA 5TDWA 3GL6A 2I50A 4YC9A 3U5NA 2YREA 3HCUA 1K2FA 2YSJA 4PPEA 3L1XA 2MIQA 1BORA 2E6RA 4AUQB 3O7AA 3V43A 5B78A 2D8SA 3RPGB 1MM2A 4A4CA 5J3XA 2YYRA 2YT5A 3L1ZB 2YHOA 4YADA 3SOWA 4AVXA 4LJNA 3IHPA 2M3HA 3HCSA 2M6MA 4A0CD 1WEUA 5B75A 2KWOA 1JOCA 3M99A 3O35A 5LKTA 3O36A 4I7DA 4LLBA 3EB6A 1MM3A 5LKXA 2LXHC 1X4IA 4AYCA 3SOUA 1X4JA 2ECIA 5FEYA 5AITA 5B76A 2YQMA 5B77A 4N4FA 3RTRB 2ECGA 4WZ0A 2IDAA 2VPEA 3L11A 1JM7A 1WEOA 2G43A 3LRQA 5C13A 1X4UA 5H9MA 1WEEA 2VJEB 4S3OB 2G45A 5I3LA 1CHCA 2H0DA 2CKLA 5FERA 2QICA 2LGLA 1VYXA 4UP5A 2QJ0A 1RMDA 5TBNA 2L43A 2KWNA 2Y43A 5LCWB 4C9ZA 1WEMA 2CSYA 4QF2A 3HCTA 1WENA 1E4UA 2JRJA 4IC2A 4A4BA 3ZYQA 4AP4A 5EYAF 4YAXA 2KR4A 2M1RA 2ECJA 5KH7A 2E6SA 2YSMA 3FL2A 2KFTA 2KIZA 2L5UA 4BBQA 3U5PA 2EODA 2KYUA 2LGGA 3LQJA 3DPLR 3M62A 2MD8C 2KGGA 4TKPB 2FSAA 2XEUA 4F52B 2KWKA 1FP0A 2K17A 2LRIC 4B86C 2L0BA 2MA6A 3LQIA 1U6GB 3T7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZV A;  2MT5 A;  4WA6 A;  2YUC A;  2ZET C;  2VPD A;  4AYC B;  2XB1 A;  4B7Y C;  3KV6 A;  1HYJ A;  1VD4 A;  2YQL A;  3M63 A;  1N87 A;  4UI9 B;  4V3L C;  4WZ3 B;  2G6Q A;  3ASL A;  3KNV A;  4UP0 A;  2M85 A;  1WIL A;  4WZ2 A;  4N3W A;  5LKU A;  3MHH A;  2MNZ A;  2LGV A;  3KV5 A;  1JM7 B;  2LGK A;  5B8D A;  1FBV A;  1Z2Q A;  5KH9 A;  4QF3 A;  2CSZ A;  4YBS A;  2ECV A;  2VJF A;  2KGI A;  2RSD A;  2LDR A;  5TAB A;  3LQH A;  2H0D B;  4FJC A;  5JG6 A;  1VFY A;  4I7B A;  3N9Q A;  1IYM A;  2CKL B;  3I2D A;  3VK6 A;  4CCG X;  2VP7 A;  4Q6F A;  2PUY A;  3O37 A;  1WEQ A;  3MHS A;  2L75 A;  2KWJ A;  1WFK A;  4IC3 A;  2NAA A;  2VNF A;  4R7E A;  2VPG A;  3PUR A;  1V87 A;  3GV4 A;  3ZPV 1;  4MSX A;  2AN6 A;  2UZG A;  3ZVZ B;  4GB0 A;  2JMI A;  4CA1 A;  2K1J A;  4X3G A;  1XWH A;  2K16 A;  1HYI A;  2PNX A;  5LKZ A;  1T1H A;  1Z60 A;  3U5O A;  5B79 A;  3N9O A;  2VJE A;  2LV9 A;  4GND A;  2F6N A;  5AIU A;  3SHB A;  3N9N A;  5H1U A;  3O34 A;  5DKA A;  5C11 A;  4GNF A;  3SOX A;  1F62 A;  2MNY A;  3ZNI A;  4ZDT A;  3HTK C;  2OXQ C;  4ZQL A;  2YUR A;  2ECW A;  2HYE D;  3PHD A;  1WEV A;  5D1K B;  4FIP A;  3O33 A;  3RPG C;  2YHN A;  4YAB A;  5G05 B;  2EA6 A;  4XI1 A;  2HDP A;  2FUI A;  2LN0 A;  4ZUX U;  2Y1M A;  1ZBD B;  2F42 A;  2DX8 A;  5D1M B;  3ZTG A;  5G04 B;  4YBM A;  5G0F A;  5H1V A;  2KRE A;  2C2L A;  2K4D A;  2FUU A;  3N9P A;  4FO9 A;  1LDJ B;  3DQV R;  5FB1 A;  3C5K A;  4R8P K;  2VJF B;  2ECN A;  4L58 A;  1WEW A;  3EB5 A;  1Z6U A;  3KQI A;  3N9L A;  4MVT A;  2YU4 A;  5D1L B;  2MD7 B;  2JMJ A;  3ZPV E;  2KE1 A;  4GNE A;  5KH3 A;  2BAY A;  4I7C A;  1WE9 A;  4P5O B;  4S3O C;  3NG2 A;  1WGM A;  4FK5 A;  4O64 A;  2C2V S;  4YAT A;  1WES A;  5FB0 A;  4L7X A;  2CT2 A;  2QIZ A;  2RI7 A;  4W4U A;  3O70 A;  2MUM A;  5TDR A;  2YW8 A;  2L80 A;  4PTB A;  4GNG A;  3C6W A;  2LXP C;  2F6J A;  3T6R A;  4BHW A;  4LKA A;  2KU3 A;  4A49 A;  5DIN A;  4NN2 A;  4YBT A;  3N9M A;  2JMD A;  1WIM A;  1WEP A;  3U5M A;  4LAD B;  3ZVY A;  2MA5 A;  2VPB A;  2EGP A;  1G25 A;  5TRB A;  4V3K C;  3PUQ A;  1DVP A;  5H1T A;  2LQ6 A;  2Y1N A;  4LK9 A;  1LDK C;  2ECT A;  4R2Y A;  5TDW A;  3GL6 A;  2I50 A;  4YC9 A;  3U5N A;  2YRE A;  3HCU A;  1K2F A;  2YSJ A;  4PPE A;  3L1X A;  2MIQ A;  1BOR A;  2E6R A;  4AUQ B;  3O7A A;  3V43 A;  5B78 A;  2D8S A;  3RPG B;  1MM2 A;  4A4C A;  5J3X A;  2YYR A;  2YT5 A;  3L1Z B;  2YHO A;  4YAD A;  3SOW A;  4AVX A;  4LJN A;  3IHP A;  2M3H A;  3HCS A;  2M6M A;  4A0C D;  1WEU A;  5B75 A;  2KWO A;  1JOC A;  3M99 A;  3O35 A;  5LKT A;  3O36 A;  4I7D A;  4LLB A;  3EB6 A;  1MM3 A;  5LKX A;  2LXH C;  1X4I A;  4AYC A;  3SOU A;  1X4J A;  2ECI A;  5FEY A;  5AIT A;  5B76 A;  2YQM A;  5B77 A;  4N4F A;  3RTR B;  2ECG A;  4WZ0 A;  2IDA A;  2VPE A;  3L11 A;  1JM7 A;  1WEO A;  2G43 A;  3LRQ A;  5C13 A;  1X4U A;  5H9M A;  1WEE A;  2VJE B;  4S3O B;  2G45 A;  5I3L A;  1CHC A;  2H0D A;  2CKL A;  5FER A;  2QIC A;  2LGL A;  1VYX A;  4UP5 A;  2QJ0 A;  1RMD A;  5TBN A;  2L43 A;  2KWN A;  2Y43 A;  5LCW B;  4C9Z A;  1WEM A;  2CSY A;  4QF2 A;  3HCT A;  1WEN A;  1E4U A;  2JRJ A;  4IC2 A;  4A4B A;  3ZYQ A;  4AP4 A;  5EYA F;  4YAX A;  2KR4 A;  2M1R A;  2ECJ A;  5KH7 A;  2E6S A;  2YSM A;  3FL2 A;  2KFT A;  2KIZ A;  2L5U A;  4BBQ A;  3U5P A;  2EOD A;  2KYU A;  2LGG A;  3LQJ A;  3DPL R;  3M62 A;  2MD8 C;  2KGG A;  4TKP B;  2FSA A;  2XEU A;  4F52 B;  2KWK A;  1FP0 A;  2K17 A;  2LRI C;  4B86 C;  2L0B A;  2MA6 A;  3LQI A;  1U6G B;  3T7L A; 
#chains in the Genus database with same CATH topology
 3QZV A;  2MT5 A;  4WA6 A;  2YUC A;  2ZET C;  2VPD A;  2JM3 A;  4AYC B;  2XB1 A;  4B7Y C;  3KV6 A;  1HYJ A;  3DDT A;  1VD4 A;  2FFW A;  2YQL A;  2XOC A;  1N87 A;  3M63 A;  4UI9 B;  1DCQ A;  4V3L C;  2G6Q A;  4WZ3 B;  3ASL A;  3KNV A;  4UP0 A;  2M85 A;  1WIL A;  4WZ2 A;  4N3W A;  5LKU A;  3MHH A;  2MNZ A;  2B0O E;  2LGV A;  2EGM A;  3KV5 A;  3LJU X;  1JM7 B;  2LGK A;  5B8D A;  1FBV A;  2CON A;  1Z2Q A;  4H9D A;  5KH9 A;  4QF3 A;  2CSZ A;  4YBS A;  2ECV A;  2VJF A;  2KGI A;  2RSD A;  2LDR A;  5TAB A;  3LQH A;  2H0D B;  4FJC A;  5JG6 A;  1VFY A;  4I7B A;  3N9Q A;  1IYM A;  2CKL B;  3I2D A;  3VK6 A;  4CCG X;  2VP7 A;  4Q6F A;  2PUY A;  2L7P A;  3O37 A;  1WEQ A;  2CRR A;  2L75 A;  3MHS A;  2KWJ A;  1WFK A;  4IC3 A;  2NAA A;  2VNF A;  4R7E A;  2VPG A;  3PUR A;  1V87 A;  3GV4 A;  3ZPV 1;  4MSX A;  2AN6 A;  2LAU A;  2UZG A;  3ZVZ B;  4GB0 A;  2JMI A;  4CA1 A;  2K1J A;  4X3G A;  1XWH A;  2K16 A;  1HYI A;  2PNX A;  5LKZ A;  1T1H A;  1Z60 A;  3U5O A;  2M13 A;  5K3Q A;  3T9K A;  2RR4 A;  4QQ4 A;  5B79 A;  4OGE A;  4OGC A;  3N9O A;  2VJE A;  3FAN A;  2LV9 A;  4GND A;  2F6N A;  5AIU A;  2XOZ A;  3SHB A;  3N9N A;  5SVX A;  5H1U A;  3O34 A;  5DKA A;  5C11 A;  4GNF A;  3SOX A;  1F62 A;  2MNY A;  3ZNI A;  4ZDT A;  3FAO A;  3HTK C;  2OXQ C;  4ZQL A;  3H7H A;  2YUR A;  2ECW A;  2HYE D;  3PHD A;  1WEV A;  5D1K B;  4FIP A;  3O33 A;  3RPG C;  2YHN A;  4YAB A;  5G05 B;  2EA6 A;  4XI1 A;  2HDP A;  2FUI A;  2LN0 A;  4ZUX U;  2Y1M A;  1ZBD B;  2F42 A;  2DX8 A;  5D1M B;  3ZTG A;  5G04 B;  4YBM A;  5G0F A;  5H1V A;  2KRE A;  3E2D A;  2C2L A;  2K4D A;  2FUU A;  3N9P A;  4FO9 A;  1LDJ B;  3DQV R;  5FB1 A;  3C5K A;  4R8P K;  2VJF B;  2ECN A;  4L58 A;  1WEW A;  3EB5 A;  1Z6U A;  3KQI A;  3N9L A;  4MVT A;  2YU4 A;  5D1L B;  2MD7 B;  2JMJ A;  2IQJ A;  3ZPV E;  2KE1 A;  4GNE A;  5KH3 A;  2BAY A;  4I7C A;  4O62 A;  1WE9 A;  4P5O B;  4S3O C;  3NG2 A;  1WGM A;  4FK5 A;  4O64 A;  2C2V S;  4YAT A;  3LDY A;  1WES A;  5FB0 A;  4L7X A;  2CT2 A;  2QIZ A;  2RI7 A;  4W4U A;  2DSM A;  2FD4 A;  3O70 A;  2MUM A;  5TDR A;  2YW8 A;  2L80 A;  4PTB A;  4GNG A;  3C6W A;  2LXP C;  2F6J A;  2XP0 A;  2EXU A;  4Z0O A;  2KKX A;  3T6R A;  4BHW A;  4LKA A;  2KU3 A;  4A49 A;  5DIN A;  4NN2 A;  4YBT A;  3N9M A;  2JMD A;  1WIM A;  1WEP A;  3LVQ E;  3U5M A;  4LAD B;  3ZVY A;  2MA5 A;  3KDE C;  2VPB A;  2EGP A;  1G25 A;  5TRB A;  4V3K C;  3PUQ A;  1DVP A;  5H1T A;  2LQ6 A;  3SUB A;  1MBM A;  2Y1N A;  4LK9 A;  1LDK C;  2ECT A;  4R2Y A;  5TDW A;  3GL6 A;  2I50 A;  4YC9 A;  5SVI A;  3U5N A;  2YRE A;  2XOY A;  3HCU A;  1K2F A;  2CSV A;  2YSJ A;  4PPE A;  3L1X A;  2MIQ A;  1BOR A;  2E6R A;  4AUQ B;  3O7A A;  3V43 A;  5B78 A;  2OWA A;  2D8S A;  3RPG B;  1MM2 A;  4A4C A;  5J3X A;  2YYR A;  2YT5 A;  3L1Z B;  2YHO A;  2CRW A;  4YAD A;  3SOW A;  4AVX A;  3JUE A;  4LJN A;  3IHP A;  2M3H A;  3HCS A;  3FM8 C;  2M6M A;  4A0C D;  1WEU A;  5B75 A;  2KWO A;  1JOC A;  3M99 A;  3O35 A;  5LKT A;  3O36 A;  2YVR A;  4I7D A;  4LLB A;  3DWD A;  3EB6 A;  1MM3 A;  3LVR E;  5LKX A;  2LXH C;  4F1P A;  1X4I A;  2D8U A;  2MKE A;  4AYC A;  3FEH A;  3SOU A;  1X4J A;  2P57 A;  2ECI A;  5FEY A;  2DJA A;  5AIT A;  5B76 A;  2YQM A;  5B77 A;  4N4F A;  3RTR B;  2ECG A;  4WZ0 A;  2IDA A;  2VPE A;  3L11 A;  1JM7 A;  4Z0R A;  1WEO A;  2G43 A;  3LRQ A;  5C13 A;  3M7K A;  5SVY A;  1X4U A;  5H9M A;  1WEE A;  2VJE B;  4S3O B;  2G45 A;  5I3L A;  1CHC A;  2H0D A;  3Q1D A;  2CKL A;  5FER A;  2QIC A;  2LGL A;  1VYX A;  2KKY A;  4UP5 A;  2QJ0 A;  1RMD A;  3PLW A;  5TBN A;  2L43 A;  2KWN A;  2Y43 A;  5LCW B;  4C9Z A;  1WEM A;  2CSY A;  4QF2 A;  3HCT A;  1WEN A;  1E4U A;  2JRJ A;  4IC2 A;  4A4B A;  3ZYQ A;  4AP4 A;  5EYA F;  4YAX A;  2KR4 A;  2M1R A;  5SVI B;  2ECJ A;  5KH7 A;  2E6S A;  2YSM A;  3FL2 A;  2KFT A;  2KIZ A;  3MDB C;  2JUN A;  2L5U A;  4BBQ A;  3U5P A;  2EOD A;  2KYU A;  2LGG A;  3LQJ A;  3DPL R;  3M62 A;  2MD8 C;  2KGG A;  4TKP B;  2FSA A;  2XEU A;  4F52 B;  2KWK A;  2E61 A;  3O47 A;  1FP0 A;  2K17 A;  2LRI C;  4B86 C;  2L0B A;  2MA6 A;  3LQI A;  3FJU B;  1U6G B;  3T7L A; 
#chains in the Genus database with same CATH homology
 3QZV A;  2MT5 A;  4WA6 A;  2YUC A;  2ZET C;  2VPD A;  4AYC B;  2XB1 A;  4B7Y C;  3KV6 A;  1HYJ A;  1VD4 A;  2YQL A;  3M63 A;  1N87 A;  4UI9 B;  4V3L C;  4WZ3 B;  2G6Q A;  3ASL A;  3KNV A;  4UP0 A;  2M85 A;  1WIL A;  4WZ2 A;  4N3W A;  5LKU A;  3MHH A;  2MNZ A;  2LGV A;  3KV5 A;  1JM7 B;  2LGK A;  5B8D A;  1FBV A;  1Z2Q A;  5KH9 A;  4QF3 A;  2CSZ A;  4YBS A;  2ECV A;  2VJF A;  2KGI A;  2RSD A;  2LDR A;  5TAB A;  3LQH A;  2H0D B;  4FJC A;  5JG6 A;  1VFY A;  4I7B A;  3N9Q A;  1IYM A;  2CKL B;  3I2D A;  3VK6 A;  4CCG X;  2VP7 A;  4Q6F A;  2PUY A;  3O37 A;  1WEQ A;  3MHS A;  2L75 A;  2KWJ A;  1WFK A;  4IC3 A;  2NAA A;  2VNF A;  4R7E A;  2VPG A;  3PUR A;  1V87 A;  3GV4 A;  3ZPV 1;  4MSX A;  2AN6 A;  2UZG A;  3ZVZ B;  4GB0 A;  2JMI A;  4CA1 A;  2K1J A;  4X3G A;  1XWH A;  2K16 A;  1HYI A;  2PNX A;  5LKZ A;  1T1H A;  1Z60 A;  3U5O A;  5B79 A;  3N9O A;  2VJE A;  2LV9 A;  4GND A;  2F6N A;  5AIU A;  3SHB A;  3N9N A;  5H1U A;  3O34 A;  5DKA A;  5C11 A;  4GNF A;  3SOX A;  1F62 A;  2MNY A;  3ZNI A;  4ZDT A;  3HTK C;  2OXQ C;  4ZQL A;  2YUR A;  2ECW A;  2HYE D;  3PHD A;  1WEV A;  5D1K B;  4FIP A;  3O33 A;  3RPG C;  2YHN A;  4YAB A;  5G05 B;  2EA6 A;  4XI1 A;  2HDP A;  2FUI A;  2LN0 A;  4ZUX U;  2Y1M A;  1ZBD B;  2F42 A;  2DX8 A;  5D1M B;  3ZTG A;  5G04 B;  4YBM A;  5G0F A;  5H1V A;  2KRE A;  2C2L A;  2K4D A;  2FUU A;  3N9P A;  4FO9 A;  1LDJ B;  3DQV R;  5FB1 A;  3C5K A;  4R8P K;  2VJF B;  2ECN A;  4L58 A;  1WEW A;  3EB5 A;  1Z6U A;  3KQI A;  3N9L A;  4MVT A;  2YU4 A;  5D1L B;  2MD7 B;  2JMJ A;  3ZPV E;  2KE1 A;  4GNE A;  5KH3 A;  2BAY A;  4I7C A;  1WE9 A;  4P5O B;  4S3O C;  3NG2 A;  1WGM A;  4FK5 A;  4O64 A;  2C2V S;  4YAT A;  1WES A;  5FB0 A;  4L7X A;  2CT2 A;  2QIZ A;  2RI7 A;  4W4U A;  3O70 A;  2MUM A;  5TDR A;  2YW8 A;  2L80 A;  4PTB A;  4GNG A;  3C6W A;  2LXP C;  2F6J A;  3T6R A;  4BHW A;  4LKA A;  2KU3 A;  4A49 A;  5DIN A;  4NN2 A;  4YBT A;  3N9M A;  2JMD A;  1WIM A;  1WEP A;  3U5M A;  4LAD B;  3ZVY A;  2MA5 A;  2VPB A;  2EGP A;  1G25 A;  5TRB A;  4V3K C;  3PUQ A;  1DVP A;  5H1T A;  2LQ6 A;  2Y1N A;  4LK9 A;  1LDK C;  2ECT A;  4R2Y A;  5TDW A;  3GL6 A;  2I50 A;  4YC9 A;  3U5N A;  2YRE A;  3HCU A;  1K2F A;  2YSJ A;  4PPE A;  3L1X A;  2MIQ A;  1BOR A;  2E6R A;  4AUQ B;  3O7A A;  3V43 A;  5B78 A;  2D8S A;  3RPG B;  1MM2 A;  4A4C A;  5J3X A;  2YYR A;  2YT5 A;  3L1Z B;  2YHO A;  4YAD A;  3SOW A;  4AVX A;  4LJN A;  3IHP A;  2M3H A;  3HCS A;  2M6M A;  4A0C D;  1WEU A;  5B75 A;  2KWO A;  1JOC A;  3M99 A;  3O35 A;  5LKT A;  3O36 A;  4I7D A;  4LLB A;  3EB6 A;  1MM3 A;  5LKX A;  2LXH C;  1X4I A;  4AYC A;  3SOU A;  1X4J A;  2ECI A;  5FEY A;  5AIT A;  5B76 A;  2YQM A;  5B77 A;  4N4F A;  3RTR B;  2ECG A;  4WZ0 A;  2IDA A;  2VPE A;  3L11 A;  1JM7 A;  1WEO A;  2G43 A;  3LRQ A;  5C13 A;  1X4U A;  5H9M A;  1WEE A;  2VJE B;  4S3O B;  2G45 A;  5I3L A;  1CHC A;  2H0D A;  2CKL A;  5FER A;  2QIC A;  2LGL A;  1VYX A;  4UP5 A;  2QJ0 A;  1RMD A;  5TBN A;  2L43 A;  2KWN A;  2Y43 A;  5LCW B;  4C9Z A;  1WEM A;  2CSY A;  4QF2 A;  3HCT A;  1WEN A;  1E4U A;  2JRJ A;  4IC2 A;  4A4B A;  3ZYQ A;  4AP4 A;  5EYA F;  4YAX A;  2KR4 A;  2M1R A;  2ECJ A;  5KH7 A;  2E6S A;  2YSM A;  3FL2 A;  2KFT A;  2KIZ A;  2L5U A;  4BBQ A;  3U5P A;  2EOD A;  2KYU A;  2LGG A;  3LQJ A;  3DPL R;  3M62 A;  2MD8 C;  2KGG A;  4TKP B;  2FSA A;  2XEU A;  4F52 B;  2KWK A;  1FP0 A;  2K17 A;  2LRI C;  4B86 C;  2L0B A;  2MA6 A;  3LQI A;  1U6G B;  3T7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...