2L80A

Solution structure of the zinc finger domain of usp13
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
VSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
publication title Biochemical Characterization of the Ubiquitin Receptors in USP13 Reveals Different Catalytic Activation of Deubiquitination from Its Analogue USP5
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 114
sequence length 114
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l80A01
1F62A 2YQMA 5EYAF 5LKZA 5B75A 2LV9A 4UP5A 2D8SA 2EGPA 2F6JA 4YADA 2YSJA 4UI9B 2CSZA 1WGMA 4I7CA 2KE1A 2YT5A 4ZDTA 4GNEA 5C11A 2UZGA 2NAAA 2KREA 2M85A 5KH7A 4YATA 5DINA 5TDWA 4GB0A 1WESA 1Z60A 2MA5A 1FP0A 4R7EA 1IYMA 2LXPC 3ZPV1 2JMIA 3C6WA 1X4UA 2LGGA 2JMDA 2KWKA 3ZPVE 2HYED 3RPGB 3N9QA 1XWHA 2L43A 5DKAA 1JOCA 4PTBA 4X3GA 4CCGX 5TABA 2VPEA 2M1RA 3O7AA 4V3KC 2LDRA 3T6RA 2MNZA 4B7YC 1V87A 5B76A 2ZETC 4LJNA 2K17A 4F52B 2H0DB 3PURA 2ECVA 2CKLB 1X4JA 4LLBA 2MIQA 1VD4A 4FIPA 2KYUA 2YQLA 2L80A 3LQIA 4WA6A 2QICA 4QF3A 2IDAA 2FUIA 2I50A 2RI7A 5G05B 3NG2A 5D1MB 5TRBA 1WEEA 1BORA 2VJFB 4AP4A 4LK9A 3O35A 2MD7B 4C9ZA 2H0DA 3IHPA 2XEUA 4LADB 2VPDA 2F6NA 2ECJA 1JM7B 5JG6A 4FJCA 4TKPB 1K2FA 3SOXA 2YHNA 2VJFA 3MHHA 4IC3A 2VJEB 2KGGA 2VPBA 5LKUA 1WIMA 3O36A 2C2VS 4YC9A 3GL6A 5FB0A 5H1UA 1WE9A 1U6GB 4A4CA 1JM7A 4FO9A 4AVXA 2FSAA 2RSDA 2MD8C 3M63A 4AYCB 2YSMA 2VJEA 2YURA 4GNDA 2XB1A 1WEOA 3EB5A 1FBVA 1WFKA 3DQVR 2YREA 4R2YA 1WEMA 2LGVA 2KGIA 4S3OB 2HDPA 2YU4A 3KV6A 5AITA 1N87A 4AYCA 1LDJB 3C5KA 3ASLA 3ZVYA 5C13A 3FL2A 4L58A 4XI1A 5D1LB 4YBMA 3SOWA 2F42A 4GNFA 2LXHC 4Q6FA 2L75A 1Z6UA 3O37A 5H9MA 1ZBDB 2JRJA 4GNGA 4BBQA 2KR4A 4FK5A 4N4FA 4PPEA 2K1JA 4NN2A 1WEUA 5B8DA 2VP7A 3MHSA 2G45A 3T7LA 2M6MA 4AUQB 2KIZA 2EODA 2AN6A 2LGKA 2LRIC 3RPGC 5KH9A 2E6RA 2K16A 5D1KB 3HCUA 3DPLR 2YW8A 2YHOA 2OXQC 2YYRA 5FEYA 1E4UA 3ZNIA 2Y1NA 1G25A 3O70A 4V3LC 4A49A 4N3WA 1WEQA 1MM2A 3LRQA 2VPGA 3KNVA 2BAYA 2K4DA 3I2DA 5LKXA 3L1XA 4A0CD 3L11A 1T1HA 2FUUA 2M3HA 4O64A 4WZ3B 1X4IA 3ZVZB 3SHBA 3N9LA 3HTKC 3HCTA 5AIUA 3HCSA 1WENA 1VYXA 3LQHA 3VK6A 2KFTA 4WZ0A 2ECNA 2L5UA 3U5MA 1HYJA 3M99A 4I7BA 2MUMA 3N9NA 3KQIA 1LDKC 4YAXA 4A4BA 3RTRB 3SOUA 5FERA 1WILA 2LN0A 2LQ6A 2VNFA 2C2LA 2Y43A 2ECIA 5G04B 2PNXA 2MT5A 3QZVA 1WEWA 5LCWB 5H1TA 4YBTA 5J3XA 3GV4A 4I7DA 2DX8A 4YBSA 3U5OA 5H1VA 3PHDA 2KU3A 2JMJA 3L1ZB 5TDRA 4S3OC 4YABA 4MVTA 4LKAA 4P5OB 5B79A 2MNYA 2QIZA 4B86C 2LGLA 4UP0A 2CT2A 2L0BA 5I3LA 4QF2A 1RMDA 5KH3A 1CHCA 5G0FA 4IC2A 1WEVA 5LKTA 4CA1A 2ECWA 2MA6A 2G43A 2CSYA 4R8PK 3O33A 4W4UA 2ECTA 2Y1MA 1HYIA 4WZ2A 5FB1A 3N9MA 3O34A 2KWOA 2QJ0A 1WEPA 2CKLA 2KWJA 3U5NA 3KV5A 3N9OA 3U5PA 2KWNA 1Z2QA 4ZQLA 2E6SA 2PUYA 3ZTGA 3V43A 5B78A 5B77A 1DVPA 4MSXA 1MM3A 4ZUXU 1VFYA 4BHWA 2G6QA 5TBNA 3EB6A 3PUQA 3N9PA 4L7XA 2ECGA 2YUCA 3LQJA 2EA6A 3M62A 3ZYQA
chains in the Genus database with same CATH superfamily
2XP0A 1F62A 2YQMA 5EYAF 5LKZA 5B75A 2LV9A 4UP5A 2D8SA 2FD4A 2EGPA 2F6JA 4YADA 2YSJA 4OGEA 4UI9B 2CSZA 1WGMA 4I7CA 2KE1A 2YT5A 4ZDTA 4GNEA 5C11A 2UZGA 2NAAA 2KREA 2M85A 3LVQE 5KH7A 4YATA 5DINA 5TDWA 4F1PA 4GB0A 1WESA 1Z60A 2MA5A 3SUBA 1FP0A 4R7EA 1IYMA 2LXPC 3ZPV1 2JMIA 3C6WA 1X4UA 2LGGA 2MKEA 2JMDA 2KWKA 3ZPVE 2HYED 3RPGB 3N9QA 1XWHA 2L43A 5DKAA 1JOCA 4PTBA 4X3GA 4CCGX 5TABA 2VPEA 2M1RA 3O7AA 4V3KC 2LDRA 3T6RA 2MNZA 4B7YC 1V87A 5B76A 2ZETC 4LJNA 2K17A 4F52B 2H0DB 3PURA 2ECVA 2CKLB 4QQ4A 1X4JA 4LLBA 2MIQA 1VD4A 4FIPA 2KYUA 2YQLA 2JM3A 2L80A 3LQIA 4WA6A 2QICA 4QF3A 2IDAA 2FUIA 2I50A 2RI7A 2EGMA 2KKXA 5G05B 3NG2A 5D1MB 5TRBA 1WEEA 1BORA 3FM8C 2VJFB 4AP4A 4LK9A 2EXUA 3O35A 2MD7B 4C9ZA 2D8UA 2H0DA 3IHPA 2XEUA 4LADB 2VPDA 3T9KA 2LAUA 2F6NA 2ECJA 1JM7B 5JG6A 4FJCA 4TKPB 1K2FA 3SOXA 2YHNA 2DSMA 2VJFA 3MHHA 4IC3A 2VJEB 2KGGA 2VPBA 5LKUA 1WIMA 4Z0OA 2KKYA 3O36A 2C2VS 3H7HA 4YC9A 3Q1DA 3GL6A 5FB0A 5H1UA 1WE9A 1U6GB 4A4CA 1JM7A 4Z0RA 4FO9A 3M7KA 3DDTA 3MDBC 4AVXA 2FSAA 2RSDA 2MD8C 3M63A 4AYCB 2YSMA 2VJEA 2YURA 4GNDA 2XB1A 1WEOA 3EB5A 1FBVA 1WFKA 3DQVR 2YREA 4R2YA 1WEMA 2LGVA 2KGIA 4S3OB 2HDPA 2YU4A 3KV6A 5AITA 2YVRA 1N87A 4AYCA 1LDJB 2CRRA 3C5KA 3ASLA 3ZVYA 5C13A 3KDEC 3FL2A 4L58A 4XI1A 2DJAA 5D1LB 2CONA 4YBMA 3SOWA 2F42A 4GNFA 2IQJA 2LXHC 4Q6FA 2L75A 1Z6UA 3PLWA 3LDYA 3O37A 5H9MA 1ZBDB 2JRJA 4GNGA 4BBQA 2KR4A 1DCQA 4FK5A 4N4FA 4PPEA 2K1JA 4NN2A 2E61A 1WEUA 5B8DA 2VP7A 3MHSA 2G45A 4OGCA 3T7LA 2M6MA 3FJUB 4AUQB 2KIZA 2EODA 2AN6A 2LGKA 2LRIC 3RPGC 5KH9A 2P57A 2E6RA 2K16A 5D1KB 3HCUA 3DPLR 2YW8A 2YHOA 2OXQC 2YYRA 5FEYA 1E4UA 3ZNIA 2Y1NA 1G25A 3O70A 4V3LC 4A49A 4N3WA 3DWDA 1WEQA 1MM2A 3LRQA 2VPGA 4H9DA 3KNVA 2BAYA 2K4DA 3I2DA 5LKXA 3L1XA 4A0CD 3L11A 1T1HA 3LJUX 3FAOA 2FUUA 2M3HA 4O64A 4WZ3B 4O62A 1X4IA 3ZVZB 2CSVA 3SHBA 3N9LA 3HTKC 3HCTA 5AIUA 3HCSA 1WENA 1VYXA 3LQHA 3VK6A 5K3QA 2KFTA 4WZ0A 2ECNA 2L5UA 3E2DA 3U5MA 1HYJA 5SVIA 3M99A 4I7BA 2FFWA 2MUMA 3N9NA 3KQIA 1LDKC 4YAXA 2XOCA 4A4BA 3RTRB 3SOUA 5FERA 1WILA 2LN0A 2LQ6A 2VNFA 2C2LA 2Y43A 2ECIA 5G04B 2PNXA 2MT5A 2B0OE 3QZVA 1WEWA 5LCWB 5H1TA 4YBTA 5J3XA 3GV4A 4I7DA 2DX8A 4YBSA 3U5OA 5H1VA 3PHDA 2KU3A 2JMJA 3L1ZB 5TDRA 4S3OC 4YABA 4MVTA 2L7PA 4LKAA 2CRWA 3LVRE 4P5OB 5B79A 2MNYA 2QIZA 4B86C 2LGLA 2M13A 4UP0A 2CT2A 2L0BA 5I3LA 4QF2A 1RMDA 2RR4A 3JUEA 5KH3A 3FEHA 1CHCA 5G0FA 4IC2A 1MBMA 1WEVA 5LKTA 2OWAA 4CA1A 2ECWA 2MA6A 5SVYA 2G43A 2CSYA 4R8PK 3O33A 4W4UA 2ECTA 2Y1MA 1HYIA 4WZ2A 5FB1A 3N9MA 3O34A 2KWOA 2QJ0A 1WEPA 2XOYA 2CKLA 2KWJA 3U5NA 3KV5A 3N9OA 3U5PA 2KWNA 1Z2QA 4ZQLA 2E6SA 2PUYA 3FANA 5SVIB 3O47A 2JUNA 3ZTGA 3V43A 5B78A 5B77A 1DVPA 4MSXA 1MM3A 4ZUXU 1VFYA 4BHWA 2G6QA 5TBNA 3EB6A 3PUQA 3N9PA 2XOZA 5SVXA 4L7XA 2ECGA 2YUCA 3LQJA 2EA6A 3M62A 3ZYQA
chains in the Genus database with same CATH topology
1F62A 2YQMA 5EYAF 5LKZA 5B75A 2LV9A 4UP5A 2D8SA 2EGPA 2F6JA 4YADA 2YSJA 4UI9B 2CSZA 1WGMA 4I7CA 2KE1A 2YT5A 4ZDTA 4GNEA 5C11A 2UZGA 2NAAA 2KREA 2M85A 5KH7A 4YATA 5DINA 5TDWA 4GB0A 1WESA 1Z60A 2MA5A 1FP0A 4R7EA 1IYMA 2LXPC 3ZPV1 2JMIA 3C6WA 1X4UA 2LGGA 2JMDA 2KWKA 3ZPVE 2HYED 3RPGB 3N9QA 1XWHA 2L43A 5DKAA 1JOCA 4PTBA 4X3GA 4CCGX 5TABA 2VPEA 2M1RA 3O7AA 4V3KC 2LDRA 3T6RA 2MNZA 4B7YC 1V87A 5B76A 2ZETC 4LJNA 2K17A 4F52B 2H0DB 3PURA 2ECVA 2CKLB 1X4JA 4LLBA 2MIQA 1VD4A 4FIPA 2KYUA 2YQLA 2L80A 3LQIA 4WA6A 2QICA 4QF3A 2IDAA 2FUIA 2I50A 2RI7A 5G05B 3NG2A 5D1MB 5TRBA 1WEEA 1BORA 2VJFB 4AP4A 4LK9A 3O35A 2MD7B 4C9ZA 2H0DA 3IHPA 2XEUA 4LADB 2VPDA 2F6NA 2ECJA 1JM7B 5JG6A 4FJCA 4TKPB 1K2FA 3SOXA 2YHNA 2VJFA 3MHHA 4IC3A 2VJEB 2KGGA 2VPBA 5LKUA 1WIMA 3O36A 2C2VS 4YC9A 3GL6A 5FB0A 5H1UA 1WE9A 1U6GB 4A4CA 1JM7A 4FO9A 4AVXA 2FSAA 2RSDA 2MD8C 3M63A 4AYCB 2YSMA 2VJEA 2YURA 4GNDA 2XB1A 1WEOA 3EB5A 1FBVA 1WFKA 3DQVR 2YREA 4R2YA 1WEMA 2LGVA 2KGIA 4S3OB 2HDPA 2YU4A 3KV6A 5AITA 1N87A 4AYCA 1LDJB 3C5KA 3ASLA 3ZVYA 5C13A 3FL2A 4L58A 4XI1A 5D1LB 4YBMA 3SOWA 2F42A 4GNFA 2LXHC 4Q6FA 2L75A 1Z6UA 3O37A 5H9MA 1ZBDB 2JRJA 4GNGA 4BBQA 2KR4A 4FK5A 4N4FA 4PPEA 2K1JA 4NN2A 1WEUA 5B8DA 2VP7A 3MHSA 2G45A 3T7LA 2M6MA 4AUQB 2KIZA 2EODA 2AN6A 2LGKA 2LRIC 3RPGC 5KH9A 2E6RA 2K16A 5D1KB 3HCUA 3DPLR 2YW8A 2YHOA 2OXQC 2YYRA 5FEYA 1E4UA 3ZNIA 2Y1NA 1G25A 3O70A 4V3LC 4A49A 4N3WA 1WEQA 1MM2A 3LRQA 2VPGA 3KNVA 2BAYA 2K4DA 3I2DA 5LKXA 3L1XA 4A0CD 3L11A 1T1HA 2FUUA 2M3HA 4O64A 4WZ3B 1X4IA 3ZVZB 3SHBA 3N9LA 3HTKC 3HCTA 5AIUA 3HCSA 1WENA 1VYXA 3LQHA 3VK6A 2KFTA 4WZ0A 2ECNA 2L5UA 3U5MA 1HYJA 3M99A 4I7BA 2MUMA 3N9NA 3KQIA 1LDKC 4YAXA 4A4BA 3RTRB 3SOUA 5FERA 1WILA 2LN0A 2LQ6A 2VNFA 2C2LA 2Y43A 2ECIA 5G04B 2PNXA 2MT5A 3QZVA 1WEWA 5LCWB 5H1TA 4YBTA 5J3XA 3GV4A 4I7DA 2DX8A 4YBSA 3U5OA 5H1VA 3PHDA 2KU3A 2JMJA 3L1ZB 5TDRA 4S3OC 4YABA 4MVTA 4LKAA 4P5OB 5B79A 2MNYA 2QIZA 4B86C 2LGLA 4UP0A 2CT2A 2L0BA 5I3LA 4QF2A 1RMDA 5KH3A 1CHCA 5G0FA 4IC2A 1WEVA 5LKTA 4CA1A 2ECWA 2MA6A 2G43A 2CSYA 4R8PK 3O33A 4W4UA 2ECTA 2Y1MA 1HYIA 4WZ2A 5FB1A 3N9MA 3O34A 2KWOA 2QJ0A 1WEPA 2CKLA 2KWJA 3U5NA 3KV5A 3N9OA 3U5PA 2KWNA 1Z2QA 4ZQLA 2E6SA 2PUYA 3ZTGA 3V43A 5B78A 5B77A 1DVPA 4MSXA 1MM3A 4ZUXU 1VFYA 4BHWA 2G6QA 5TBNA 3EB6A 3PUQA 3N9PA 4L7XA 2ECGA 2YUCA 3LQJA 2EA6A 3M62A 3ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F62 A;  2YQM A;  5EYA F;  5LKZ A;  5B75 A;  2LV9 A;  4UP5 A;  2D8S A;  2EGP A;  2F6J A;  4YAD A;  2YSJ A;  4UI9 B;  2CSZ A;  1WGM A;  4I7C A;  2KE1 A;  2YT5 A;  4ZDT A;  4GNE A;  5C11 A;  2UZG A;  2NAA A;  2KRE A;  2M85 A;  5KH7 A;  4YAT A;  5DIN A;  5TDW A;  4GB0 A;  1WES A;  1Z60 A;  2MA5 A;  1FP0 A;  4R7E A;  1IYM A;  2LXP C;  3ZPV 1;  2JMI A;  3C6W A;  1X4U A;  2LGG A;  2JMD A;  2KWK A;  3ZPV E;  2HYE D;  3RPG B;  3N9Q A;  1XWH A;  2L43 A;  5DKA A;  1JOC A;  4PTB A;  4X3G A;  4CCG X;  5TAB A;  2VPE A;  2M1R A;  3O7A A;  4V3K C;  2LDR A;  3T6R A;  2MNZ A;  4B7Y C;  1V87 A;  5B76 A;  2ZET C;  4LJN A;  2K17 A;  4F52 B;  2H0D B;  3PUR A;  2ECV A;  2CKL B;  1X4J A;  4LLB A;  2MIQ A;  1VD4 A;  4FIP A;  2KYU A;  2YQL A;  2L80 A;  3LQI A;  4WA6 A;  2QIC A;  4QF3 A;  2IDA A;  2FUI A;  2I50 A;  2RI7 A;  5G05 B;  3NG2 A;  5D1M B;  5TRB A;  1WEE A;  1BOR A;  2VJF B;  4AP4 A;  4LK9 A;  3O35 A;  2MD7 B;  4C9Z A;  2H0D A;  3IHP A;  2XEU A;  4LAD B;  2VPD A;  2F6N A;  2ECJ A;  1JM7 B;  5JG6 A;  4FJC A;  4TKP B;  1K2F A;  3SOX A;  2YHN A;  2VJF A;  3MHH A;  4IC3 A;  2VJE B;  2KGG A;  2VPB A;  5LKU A;  1WIM A;  3O36 A;  2C2V S;  4YC9 A;  3GL6 A;  5FB0 A;  5H1U A;  1WE9 A;  1U6G B;  4A4C A;  1JM7 A;  4FO9 A;  4AVX A;  2FSA A;  2RSD A;  2MD8 C;  3M63 A;  4AYC B;  2YSM A;  2VJE A;  2YUR A;  4GND A;  2XB1 A;  1WEO A;  3EB5 A;  1FBV A;  1WFK A;  3DQV R;  2YRE A;  4R2Y A;  1WEM A;  2LGV A;  2KGI A;  4S3O B;  2HDP A;  2YU4 A;  3KV6 A;  5AIT A;  1N87 A;  4AYC A;  1LDJ B;  3C5K A;  3ASL A;  3ZVY A;  5C13 A;  3FL2 A;  4L58 A;  4XI1 A;  5D1L B;  4YBM A;  3SOW A;  2F42 A;  4GNF A;  2LXH C;  4Q6F A;  2L75 A;  1Z6U A;  3O37 A;  5H9M A;  1ZBD B;  2JRJ A;  4GNG A;  4BBQ A;  2KR4 A;  4FK5 A;  4N4F A;  4PPE A;  2K1J A;  4NN2 A;  1WEU A;  5B8D A;  2VP7 A;  3MHS A;  2G45 A;  3T7L A;  2M6M A;  4AUQ B;  2KIZ A;  2EOD A;  2AN6 A;  2LGK A;  2LRI C;  3RPG C;  5KH9 A;  2E6R A;  2K16 A;  5D1K B;  3HCU A;  3DPL R;  2YW8 A;  2YHO A;  2OXQ C;  2YYR A;  5FEY A;  1E4U A;  3ZNI A;  2Y1N A;  1G25 A;  3O70 A;  4V3L C;  4A49 A;  4N3W A;  1WEQ A;  1MM2 A;  3LRQ A;  2VPG A;  3KNV A;  2BAY A;  2K4D A;  3I2D A;  5LKX A;  3L1X A;  4A0C D;  3L11 A;  1T1H A;  2FUU A;  2M3H A;  4O64 A;  4WZ3 B;  1X4I A;  3ZVZ B;  3SHB A;  3N9L A;  3HTK C;  3HCT A;  5AIU A;  3HCS A;  1WEN A;  1VYX A;  3LQH A;  3VK6 A;  2KFT A;  4WZ0 A;  2ECN A;  2L5U A;  3U5M A;  1HYJ A;  3M99 A;  4I7B A;  2MUM A;  3N9N A;  3KQI A;  1LDK C;  4YAX A;  4A4B A;  3RTR B;  3SOU A;  5FER A;  1WIL A;  2LN0 A;  2LQ6 A;  2VNF A;  2C2L A;  2Y43 A;  2ECI A;  5G04 B;  2PNX A;  2MT5 A;  3QZV A;  1WEW A;  5LCW B;  5H1T A;  4YBT A;  5J3X A;  3GV4 A;  4I7D A;  2DX8 A;  4YBS A;  3U5O A;  5H1V A;  3PHD A;  2KU3 A;  2JMJ A;  3L1Z B;  5TDR A;  4S3O C;  4YAB A;  4MVT A;  4LKA A;  4P5O B;  5B79 A;  2MNY A;  2QIZ A;  4B86 C;  2LGL A;  4UP0 A;  2CT2 A;  2L0B A;  5I3L A;  4QF2 A;  1RMD A;  5KH3 A;  1CHC A;  5G0F A;  4IC2 A;  1WEV A;  5LKT A;  4CA1 A;  2ECW A;  2MA6 A;  2G43 A;  2CSY A;  4R8P K;  3O33 A;  4W4U A;  2ECT A;  2Y1M A;  1HYI A;  4WZ2 A;  5FB1 A;  3N9M A;  3O34 A;  2KWO A;  2QJ0 A;  1WEP A;  2CKL A;  2KWJ A;  3U5N A;  3KV5 A;  3N9O A;  3U5P A;  2KWN A;  1Z2Q A;  4ZQL A;  2E6S A;  2PUY A;  3ZTG A;  3V43 A;  5B78 A;  5B77 A;  1DVP A;  4MSX A;  1MM3 A;  4ZUX U;  1VFY A;  4BHW A;  2G6Q A;  5TBN A;  3EB6 A;  3PUQ A;  3N9P A;  4L7X A;  2ECG A;  2YUC A;  3LQJ A;  2EA6 A;  3M62 A;  3ZYQ A; 
#chains in the Genus database with same CATH topology
 2XP0 A;  1F62 A;  2YQM A;  5EYA F;  5LKZ A;  5B75 A;  2LV9 A;  4UP5 A;  2D8S A;  2FD4 A;  2EGP A;  2F6J A;  4YAD A;  2YSJ A;  4OGE A;  4UI9 B;  2CSZ A;  1WGM A;  4I7C A;  2KE1 A;  2YT5 A;  4ZDT A;  4GNE A;  5C11 A;  2UZG A;  2NAA A;  2KRE A;  2M85 A;  3LVQ E;  5KH7 A;  4YAT A;  5DIN A;  5TDW A;  4F1P A;  4GB0 A;  1WES A;  1Z60 A;  2MA5 A;  3SUB A;  1FP0 A;  4R7E A;  1IYM A;  2LXP C;  3ZPV 1;  2JMI A;  3C6W A;  1X4U A;  2LGG A;  2MKE A;  2JMD A;  2KWK A;  3ZPV E;  2HYE D;  3RPG B;  3N9Q A;  1XWH A;  2L43 A;  5DKA A;  1JOC A;  4PTB A;  4X3G A;  4CCG X;  5TAB A;  2VPE A;  2M1R A;  3O7A A;  4V3K C;  2LDR A;  3T6R A;  2MNZ A;  4B7Y C;  1V87 A;  5B76 A;  2ZET C;  4LJN A;  2K17 A;  4F52 B;  2H0D B;  3PUR A;  2ECV A;  2CKL B;  4QQ4 A;  1X4J A;  4LLB A;  2MIQ A;  1VD4 A;  4FIP A;  2KYU A;  2YQL A;  2JM3 A;  2L80 A;  3LQI A;  4WA6 A;  2QIC A;  4QF3 A;  2IDA A;  2FUI A;  2I50 A;  2RI7 A;  2EGM A;  2KKX A;  5G05 B;  3NG2 A;  5D1M B;  5TRB A;  1WEE A;  1BOR A;  3FM8 C;  2VJF B;  4AP4 A;  4LK9 A;  2EXU A;  3O35 A;  2MD7 B;  4C9Z A;  2D8U A;  2H0D A;  3IHP A;  2XEU A;  4LAD B;  2VPD A;  3T9K A;  2LAU A;  2F6N A;  2ECJ A;  1JM7 B;  5JG6 A;  4FJC A;  4TKP B;  1K2F A;  3SOX A;  2YHN A;  2DSM A;  2VJF A;  3MHH A;  4IC3 A;  2VJE B;  2KGG A;  2VPB A;  5LKU A;  1WIM A;  4Z0O A;  2KKY A;  3O36 A;  2C2V S;  3H7H A;  4YC9 A;  3Q1D A;  3GL6 A;  5FB0 A;  5H1U A;  1WE9 A;  1U6G B;  4A4C A;  1JM7 A;  4Z0R A;  4FO9 A;  3M7K A;  3DDT A;  3MDB C;  4AVX A;  2FSA A;  2RSD A;  2MD8 C;  3M63 A;  4AYC B;  2YSM A;  2VJE A;  2YUR A;  4GND A;  2XB1 A;  1WEO A;  3EB5 A;  1FBV A;  1WFK A;  3DQV R;  2YRE A;  4R2Y A;  1WEM A;  2LGV A;  2KGI A;  4S3O B;  2HDP A;  2YU4 A;  3KV6 A;  5AIT A;  2YVR A;  1N87 A;  4AYC A;  1LDJ B;  2CRR A;  3C5K A;  3ASL A;  3ZVY A;  5C13 A;  3KDE C;  3FL2 A;  4L58 A;  4XI1 A;  2DJA A;  5D1L B;  2CON A;  4YBM A;  3SOW A;  2F42 A;  4GNF A;  2IQJ A;  2LXH C;  4Q6F A;  2L75 A;  1Z6U A;  3PLW A;  3LDY A;  3O37 A;  5H9M A;  1ZBD B;  2JRJ A;  4GNG A;  4BBQ A;  2KR4 A;  1DCQ A;  4FK5 A;  4N4F A;  4PPE A;  2K1J A;  4NN2 A;  2E61 A;  1WEU A;  5B8D A;  2VP7 A;  3MHS A;  2G45 A;  4OGC A;  3T7L A;  2M6M A;  3FJU B;  4AUQ B;  2KIZ A;  2EOD A;  2AN6 A;  2LGK A;  2LRI C;  3RPG C;  5KH9 A;  2P57 A;  2E6R A;  2K16 A;  5D1K B;  3HCU A;  3DPL R;  2YW8 A;  2YHO A;  2OXQ C;  2YYR A;  5FEY A;  1E4U A;  3ZNI A;  2Y1N A;  1G25 A;  3O70 A;  4V3L C;  4A49 A;  4N3W A;  3DWD A;  1WEQ A;  1MM2 A;  3LRQ A;  2VPG A;  4H9D A;  3KNV A;  2BAY A;  2K4D A;  3I2D A;  5LKX A;  3L1X A;  4A0C D;  3L11 A;  1T1H A;  3LJU X;  3FAO A;  2FUU A;  2M3H A;  4O64 A;  4WZ3 B;  4O62 A;  1X4I A;  3ZVZ B;  2CSV A;  3SHB A;  3N9L A;  3HTK C;  3HCT A;  5AIU A;  3HCS A;  1WEN A;  1VYX A;  3LQH A;  3VK6 A;  5K3Q A;  2KFT A;  4WZ0 A;  2ECN A;  2L5U A;  3E2D A;  3U5M A;  1HYJ A;  5SVI A;  3M99 A;  4I7B A;  2FFW A;  2MUM A;  3N9N A;  3KQI A;  1LDK C;  4YAX A;  2XOC A;  4A4B A;  3RTR B;  3SOU A;  5FER A;  1WIL A;  2LN0 A;  2LQ6 A;  2VNF A;  2C2L A;  2Y43 A;  2ECI A;  5G04 B;  2PNX A;  2MT5 A;  2B0O E;  3QZV A;  1WEW A;  5LCW B;  5H1T A;  4YBT A;  5J3X A;  3GV4 A;  4I7D A;  2DX8 A;  4YBS A;  3U5O A;  5H1V A;  3PHD A;  2KU3 A;  2JMJ A;  3L1Z B;  5TDR A;  4S3O C;  4YAB A;  4MVT A;  2L7P A;  4LKA A;  2CRW A;  3LVR E;  4P5O B;  5B79 A;  2MNY A;  2QIZ A;  4B86 C;  2LGL A;  2M13 A;  4UP0 A;  2CT2 A;  2L0B A;  5I3L A;  4QF2 A;  1RMD A;  2RR4 A;  3JUE A;  5KH3 A;  3FEH A;  1CHC A;  5G0F A;  4IC2 A;  1MBM A;  1WEV A;  5LKT A;  2OWA A;  4CA1 A;  2ECW A;  2MA6 A;  5SVY A;  2G43 A;  2CSY A;  4R8P K;  3O33 A;  4W4U A;  2ECT A;  2Y1M A;  1HYI A;  4WZ2 A;  5FB1 A;  3N9M A;  3O34 A;  2KWO A;  2QJ0 A;  1WEP A;  2XOY A;  2CKL A;  2KWJ A;  3U5N A;  3KV5 A;  3N9O A;  3U5P A;  2KWN A;  1Z2Q A;  4ZQL A;  2E6S A;  2PUY A;  3FAN A;  5SVI B;  3O47 A;  2JUN A;  3ZTG A;  3V43 A;  5B78 A;  5B77 A;  1DVP A;  4MSX A;  1MM3 A;  4ZUX U;  1VFY A;  4BHW A;  2G6Q A;  5TBN A;  3EB6 A;  3PUQ A;  3N9P A;  2XOZ A;  5SVX A;  4L7X A;  2ECG A;  2YUC A;  3LQJ A;  2EA6 A;  3M62 A;  3ZYQ A; 
#chains in the Genus database with same CATH homology
 1F62 A;  2YQM A;  5EYA F;  5LKZ A;  5B75 A;  2LV9 A;  4UP5 A;  2D8S A;  2EGP A;  2F6J A;  4YAD A;  2YSJ A;  4UI9 B;  2CSZ A;  1WGM A;  4I7C A;  2KE1 A;  2YT5 A;  4ZDT A;  4GNE A;  5C11 A;  2UZG A;  2NAA A;  2KRE A;  2M85 A;  5KH7 A;  4YAT A;  5DIN A;  5TDW A;  4GB0 A;  1WES A;  1Z60 A;  2MA5 A;  1FP0 A;  4R7E A;  1IYM A;  2LXP C;  3ZPV 1;  2JMI A;  3C6W A;  1X4U A;  2LGG A;  2JMD A;  2KWK A;  3ZPV E;  2HYE D;  3RPG B;  3N9Q A;  1XWH A;  2L43 A;  5DKA A;  1JOC A;  4PTB A;  4X3G A;  4CCG X;  5TAB A;  2VPE A;  2M1R A;  3O7A A;  4V3K C;  2LDR A;  3T6R A;  2MNZ A;  4B7Y C;  1V87 A;  5B76 A;  2ZET C;  4LJN A;  2K17 A;  4F52 B;  2H0D B;  3PUR A;  2ECV A;  2CKL B;  1X4J A;  4LLB A;  2MIQ A;  1VD4 A;  4FIP A;  2KYU A;  2YQL A;  2L80 A;  3LQI A;  4WA6 A;  2QIC A;  4QF3 A;  2IDA A;  2FUI A;  2I50 A;  2RI7 A;  5G05 B;  3NG2 A;  5D1M B;  5TRB A;  1WEE A;  1BOR A;  2VJF B;  4AP4 A;  4LK9 A;  3O35 A;  2MD7 B;  4C9Z A;  2H0D A;  3IHP A;  2XEU A;  4LAD B;  2VPD A;  2F6N A;  2ECJ A;  1JM7 B;  5JG6 A;  4FJC A;  4TKP B;  1K2F A;  3SOX A;  2YHN A;  2VJF A;  3MHH A;  4IC3 A;  2VJE B;  2KGG A;  2VPB A;  5LKU A;  1WIM A;  3O36 A;  2C2V S;  4YC9 A;  3GL6 A;  5FB0 A;  5H1U A;  1WE9 A;  1U6G B;  4A4C A;  1JM7 A;  4FO9 A;  4AVX A;  2FSA A;  2RSD A;  2MD8 C;  3M63 A;  4AYC B;  2YSM A;  2VJE A;  2YUR A;  4GND A;  2XB1 A;  1WEO A;  3EB5 A;  1FBV A;  1WFK A;  3DQV R;  2YRE A;  4R2Y A;  1WEM A;  2LGV A;  2KGI A;  4S3O B;  2HDP A;  2YU4 A;  3KV6 A;  5AIT A;  1N87 A;  4AYC A;  1LDJ B;  3C5K A;  3ASL A;  3ZVY A;  5C13 A;  3FL2 A;  4L58 A;  4XI1 A;  5D1L B;  4YBM A;  3SOW A;  2F42 A;  4GNF A;  2LXH C;  4Q6F A;  2L75 A;  1Z6U A;  3O37 A;  5H9M A;  1ZBD B;  2JRJ A;  4GNG A;  4BBQ A;  2KR4 A;  4FK5 A;  4N4F A;  4PPE A;  2K1J A;  4NN2 A;  1WEU A;  5B8D A;  2VP7 A;  3MHS A;  2G45 A;  3T7L A;  2M6M A;  4AUQ B;  2KIZ A;  2EOD A;  2AN6 A;  2LGK A;  2LRI C;  3RPG C;  5KH9 A;  2E6R A;  2K16 A;  5D1K B;  3HCU A;  3DPL R;  2YW8 A;  2YHO A;  2OXQ C;  2YYR A;  5FEY A;  1E4U A;  3ZNI A;  2Y1N A;  1G25 A;  3O70 A;  4V3L C;  4A49 A;  4N3W A;  1WEQ A;  1MM2 A;  3LRQ A;  2VPG A;  3KNV A;  2BAY A;  2K4D A;  3I2D A;  5LKX A;  3L1X A;  4A0C D;  3L11 A;  1T1H A;  2FUU A;  2M3H A;  4O64 A;  4WZ3 B;  1X4I A;  3ZVZ B;  3SHB A;  3N9L A;  3HTK C;  3HCT A;  5AIU A;  3HCS A;  1WEN A;  1VYX A;  3LQH A;  3VK6 A;  2KFT A;  4WZ0 A;  2ECN A;  2L5U A;  3U5M A;  1HYJ A;  3M99 A;  4I7B A;  2MUM A;  3N9N A;  3KQI A;  1LDK C;  4YAX A;  4A4B A;  3RTR B;  3SOU A;  5FER A;  1WIL A;  2LN0 A;  2LQ6 A;  2VNF A;  2C2L A;  2Y43 A;  2ECI A;  5G04 B;  2PNX A;  2MT5 A;  3QZV A;  1WEW A;  5LCW B;  5H1T A;  4YBT A;  5J3X A;  3GV4 A;  4I7D A;  2DX8 A;  4YBS A;  3U5O A;  5H1V A;  3PHD A;  2KU3 A;  2JMJ A;  3L1Z B;  5TDR A;  4S3O C;  4YAB A;  4MVT A;  4LKA A;  4P5O B;  5B79 A;  2MNY A;  2QIZ A;  4B86 C;  2LGL A;  4UP0 A;  2CT2 A;  2L0B A;  5I3L A;  4QF2 A;  1RMD A;  5KH3 A;  1CHC A;  5G0F A;  4IC2 A;  1WEV A;  5LKT A;  4CA1 A;  2ECW A;  2MA6 A;  2G43 A;  2CSY A;  4R8P K;  3O33 A;  4W4U A;  2ECT A;  2Y1M A;  1HYI A;  4WZ2 A;  5FB1 A;  3N9M A;  3O34 A;  2KWO A;  2QJ0 A;  1WEP A;  2CKL A;  2KWJ A;  3U5N A;  3KV5 A;  3N9O A;  3U5P A;  2KWN A;  1Z2Q A;  4ZQL A;  2E6S A;  2PUY A;  3ZTG A;  3V43 A;  5B78 A;  5B77 A;  1DVP A;  4MSX A;  1MM3 A;  4ZUX U;  1VFY A;  4BHW A;  2G6Q A;  5TBN A;  3EB6 A;  3PUQ A;  3N9P A;  4L7X A;  2ECG A;  2YUC A;  3LQJ A;  2EA6 A;  3M62 A;  3ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...