4ZQLA

Crystal structure of trim24 with 3,4-dimethoxy-n-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
177
Chain Sequence
b'MNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Crystal structure of TRIM24 with 3,4-dimethoxy-N-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 49
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4zqlA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4zqlA01
4QSPA 5DYUA 5E3GA 2RFJA 4IR4A 3UVXA 5C8GA 4CUSA 4NR6A 4WZ2A 3VK6A 4MR3A 2D9EA 4FLPA 5EM3A 2F42A 1X4JA 5AITA 4LLBA 4YC9A 5FH7A 2K1JA 4UYDA 4HXNA 4LZ2A 5B79A 5B77A 4TT2A 3QZSA 2H0DB 1WEVA 4YYMA 2G45A 4XUAA 4ZC9A 3LQIA 3D7CA 2Y1MA 4BW1A 5FG5A 1JM7A 4BW3A 3FKMX 3ZYQA 5B78A 4HBYA 4KV4A 5C13A 2YW8A 4XY9A 4YYIA 1JM4B 4Z93A 5EISA 1T1HA 4O7CA 1WEUA 3C6WA 5E0RA 4WZ0A 2WP1A 3UV4A 4HBWA 3S91A 2YSJA 4BBQA 1WE9A 5G04B 5LJ1A 5D24A 1VYXA 5EK9A 3KNVA 4QEWA 3M99A 3LXJA 2EGPA 4FK5A 5E9MA 2F6NA 3IU6A 2E6RA 4CLBA 3EB5A 3HCSA 2DATA 5D3TA 5EPRA 4UIWA 4A9OA 4OGJA 5EWHA 2VJEA 3O7AA 3U5OA 2YQMA 5IGMA 1LDKC 2MA5A 5CPEA 4YADA 4BJXA 5A5OA 3LQJA 1WEOA 5CQ8A 5H1UA 4YABA 3DWYA 2R0SA 1E4UA 5F62A 5F61A 4CL9A 2RO1A 5E9YA 4PY6A 4MVTA 4O78A 5CQTA 2JMIA 4MEOA 4WHUA 5CS8A 4CUUA 4YH3A 2VP7A 5H1VA 4QEVA 4Z6HA 3SOXA 5DY7A 5D7XA 5FE3A 2Y1NA 5FE8A 1K2FA 4PPEA 4S3OC 4A0CD 5FE7A 4NRBA 4HXOA 2M85A 2KWOA 2ECWA 4YBSA 4OGIA 3QZVA 2VNFA 4O70A 4UIYA 3I2DA 5CRZA 4LZRA 4WA6A 2ECJA 5FG4A 2MNYA 3RPGC 5FH6A 2MNZA 5DFBA 5KH7A 3JVJA 3TLPA 2KGGA 5EA1A 4UIZA 4F3IA 4CA1A 3N9PA 2ECGA 5LKUA 4Q0NA 5DLZA 2OXQC 5ENFA 3U5MA 4IORA 1EQFA 3SVFA 2ZETC 2LV9A 2MUMA 3HTKC 4L58A 4WHWA 4B86C 4ALGA 4UYHA 2M3HA 4NR4A 2DVSA 4MSXA 5FEYA 4HXMA 2L5EA 3UW9A 1Z60A 5DINA 4A4CA 5A85A 3MQMA 1CHCA 2R10A 5FE5A 4ZDTA 2CSZA 5G4SA 5CU8A 5TABA 2YT5A 5DKHA 4XUBA 5HRWA 3QZTA 3O34A 4KCXA 5F1HA 3O35A 5HELA 3P1CA 4CUQA 5HRXA 5A83A 2RI7A 5LVQA 2G6QA 5I3LA 4LYSA 2LXPC 5I83A 2LN0A 4QUUA 4NQMA 2OSSA 2Y43A 1JM7B 3JVKA 4HXPA 5H85A 3G0JA 4QSXA 2LGVA 4YAXA 2UZGA 5AIUA 4NUEA 1WGMA 2KU3A 3GG3A 4NYVA 4A9NA 5CUAA 4QR3A 5LJ0A 4IR6A 5FH8A 3L11A 2WP2A 5JWMA 4ZW1A 2E6SA 4AP4A 4YYHA 1WUMA 4J0RA 2MA6A 4QF3A 2G4AA 2EA6A 5L8UA 3PURA 4UI9B 5I7XA 4UYEA 2VPEA 4N3WA 2I7KA 4NR9A 4PS5A 3ZPV1 1WUGA 4C66A 4PTBA 3HCUA 2E7OA 4AKNA 4MEPA 4NRCA 1WEWA 4WZ3B 5ETDA 4NN2A 2YQLA 3MHHA 5ENHA 4BW2A 3GV4A 4ZUXU 4FJCA 2VJEB 5KH3A 5I29A 5LKXA 3MHSA 3JVMA 3IU5A 4TU4A 2YUCA 5F5ZA 4QB3A 5K29A 4HXSA 5LVRA 5EWCA 4IR3A 5HQ5A 2PNXA 2KIZA 2JMJA 2DX8A 5F63A 4I7BA 3MB4A 1WFKA 5B75A 3G0LA 2NXBA 4A9IA 5FDZA 2K16A 2LGLA 3M62A 3PUQA 5I7YA 2E3KA 2H60A 3GL6A 5CQ5A 3U5KA 3T7LA 3AADA 2KYUA 5E73A 3P1DA 4LDFA 5F25A 4C9ZA 4TQNA 4J1PA 5HQ6A 5I86A 5G05B 3IHPA 2MIQA 5D3SA 3ZVZB 4GB0A 2L84A 5CFWA 5KH9A 1N72A 4IOOA 4MR5A 4YBTA 5C85A 3PHDA 4QEUA 5D3RA 4LJNA 4UP5A 4O7AA 5FE4A 5FE9A 2GRCA 2LGGA 5JG6A 5LKZA 1WEMA 2E7NA 5CGPA 2KWJA 5D3JA 4GNEA 4A9EA 4LR6A 3FL2A 4Z1QA 2YSMA 5ACYA 4W4UA 5LCWB 5AD2A 4FIPA 3KQIA 5D1KB 4DONA 2JRJA 3Q2FA 1E6IA 2NAAA 4HXLA 1FBVA 3ASLA 4TT6A 2D8SA 3N9NA 3LJWA 4YYNA 2DVQA 3P1EA 3LQHA 4UYFA 4WIVA 5HM0A 4UIXA 5KHMA 5A82A 4AYCA 5D1MB 5HCLA 4NS5A 2F6JA 5A5RA 4NQNA 2CT2A 2QJ0A 4YYKA 4NR5A 4V3KC 2FUUA 2MD8C 5LJ2A 5EWVA 2L0BA 1ZS5A 4UITA 2OUOA 2RSDA 1XWHA 1WEEA 4F52B 3N9QA 1X4IA 4QY4A 4A9JA 5G4RA 5F1LA 5BT4A 5DKCA 5E9LA 4X2IA 5A5PA 2YHOA 1LDJB 2LXHC 4AUQB 2H0DA 4IOQA 2MD7B 5EVAA 2G43A 2YDWA 5E3DA 4O64A 5JI8A 3C5KA 3SHBA 5I89A 4L7XA 5A7CA 5L99A 4Q6FA 5IBNA 3KV5A 5G0FA 2DWWA 2L80A 5ENBA 4TTEA 5KU3A 4IC2A 2DVRA 2L75A 5F2PA 2LDRA 4Z6IA 4A9HA 4O7EA 4QSQA 5KTUA 4TS8A 4TT4A 3ZYUA 5ENEA 2KR4A 3UV2A 1F68A 2VPDA 5EP7A 5FE2A 5I1QA 3O36A 3AQAA 2LQ6A 5F36A 1U6GB 3DPLR 5FFWA 2ECTA 5CUBA 2YHNA 4QF2A 2L5UA 1JOCA 5EQ1A 2AN6A 3LRQA 4QR5A 3UVWA 5H9MA 5I88A 5B76A 3UVYA 2EODA 3L1ZB 3ZPVE 4NR8A 2KGIA 4I7DA 4R2YA 1VD4A 5TBNA 3MXFA 2FUIA 1Z6UA 5L97A 1WILA 5C7NA 5IGNA 2LSPB 5D1LB 2C2VS 5HENA 1X4UA 3NXBA 5CUDA 2PUYA 4MR4A 3UVDA 4IR5A 5A5SA 5HLSA 2DKWA 4QZSA 2FSAA 2HYED 5EICA 4QBMA 4UYGA 5C89A 4NXJA 2ECVA 5E9IA 2YYRA 2K4DA 4O7FA 5L96A 3M63A 5FERA 3U5NA 5DKAA 5HEMA 1Z2QA 3KV6A 2RNYA 5A5QA 3SVHA 2C2LA 2KTBB 5AD3A 4A9MA 1VFYA 3P5OA 4QUTA 3U5LA 4LRGA 3N9LA 2VJFA 5L98A 3UV5A 4TKPB 4YYDA 5CUEA 5LKTA 1F62A 5A5NA 4RVRA 4N4IA 4PCIA 3HCTA 5F60A 3EB6A 5DLXA 2YURA 4NUCA 5KO4A 5LUUA 5DFCA 5C4QA 2KREA 2KWNA 4R7EA 5TRBA 5ENJA 4O74A 1WEQA 2I8NA 4XYAA 3RCWA 4FO9A 5F3AA 5E9VA 3O37A 3HMHA 3N9MA 3T6RA 4C67A 2M1RA 5HJCA 1WEPA 4R8PK 4UIUA 5B8DA 5AMEA 4A9LA 4QSWA 5COIA 4GPJA 4YYJA 4QR4A 2R0YA 2VPGA 4GNGA 5CQ4A 4CUPA 5TB6A 5DYAA 4MENA 5DKDA 1N87A 2CKLA 2D82A 4V3LC 5DYXA 2DVVA 3V43A 5TCMA 5CQ3A 1MM2A 5TDWA 4N4FA 4YYGA 4QYDA 5FB1A 2KE1A 2L43A 2IDAA 2KFTA 4X3GA 4LYWA 4NYXA 5CZGA 4Q0OA 4Y03A 3U5JA 5J0DA 4QC3A 4YK0A 4BHWA 3SVGA 1DVPA 4KV1A 5FG6A 4IC3A 4LK9A 3DQVR 5D3HA 5EPBA 5KTWA 1MM3A 5AMFA 3S92A 5I40A 4OUFA 5DW2A 5DW1A 1ZBDB 4J3IA 5L8TA 3MB3A 1WENA 4CCGX 5CTLA 5ENGA 4YY4A 2XEUA 4O76A 3O33A 2BAYA 4QYLA 4B7YC 4S3OB 3L1XA 2YEMA 2VPBA 4GNFA 4NR7A 3HMFA 5CY9A 5CQAA 5DBMA 3ZTGA 4QSSA 4E96A 4QSVA 3N9OA 4BW4A 5D25A 4P5OB 4TZ2A 4CFKA 4J0SA 5ENIA 5FBXA 4ALHA 3MUKA 1X0JA 3Q2EA 4HXRA 5HFQA 2YREA 5DFDA 3RPGB 4O72A 4PKLA 5C87A 1WESA 5FFYA 5ENCA 4YY6A 3U5PA 1FP0A 5FB0A 4NRAA 2YW5A 3SOWA 5CQ7A 5IGKA 4A4BA 3ONIA 2I50A 4XI1A 5D26A 4QSRA 2LGKA 5IGLA 3ZVYA 5CUGA 4LKAA 4QSTA 5EGUA 5E9KA 3P1FA 4LADB 4QSUA 4QC1A 5D3LA 5I80A 2MT5A 2K17A 5E7DA 5HQ7A 5FE1A 2RNWA 4TU6A 2VJFB 4TYLA 3ZNIA 2YYNA 3K2JA 4O71A 1RMDA 4N4GA 5EI4A 2CSYA 5IIDA 4Z1SA 5FE6A 5CP5A 5II1A 4UIVA 5BT5A 1BORA 2OO1A 3JVLA 2KWKA 3NG2A 4YBMA 4NUDA 4N4HA 5CUCA 3O70A 3I3JA 4UP0A 4O77A 5E74A 4HXKA 2YEKA 4YH4A 5J3XA 2JMDA 2R0VA 5TDRA 4LC2A 5KTXA 1HYJA 4TZ8A 4A49A 2YU4A 3HMEA 2HDPA 5ETBA 5II2A 3RTRB 2L85A 5CQ6A 5HRVA 3DAIA 2N9GA 1JSPB 4YATA 4ZQLA 4GNDA 2M6MA 5EYAF 5CRMA 5BT3A 5H1TA 5D3NA 2CKLB 4XY8A 5EU1A 5D0CA 2QIZA 2RNXA 5FE0A 5EPSA 4HBVA 4CFLA 5EV9A 2LRIC 4O7BA 5DX4A 4PCEA 2ECIA 5C11A 1IYMA 4LYIA 4HBXA 4O75A 5IG6A 4AVXA 4A9FA 4QNSA 5A81A 2YELA 2YQDA 4LZSA 5HFRA 4A9KA 5EWWA 4CUTA 5FFVA 1G25A 3SOUA 4MR6A 1WIMA 4UYFB 5D3PA 5EWDA 5DYCA 3MULA 2ECNA 1HYIA 2QICA 4AYCB 4NYWA 2MJVB 4CURA 2XB1A 1V87A 4MEQA 4I7CA 2RS9B
chains in the Genus database with same CATH superfamily
4QSPA 5DYUA 5E3GA 2RFJA 4IR4A 3UVXA 5C8GA 4CUSA 4NR6A 4WZ2A 3VK6A 4MR3A 2D9EA 4FLPA 5EM3A 2F42A 1X4JA 5AITA 4LLBA 4YC9A 5FH7A 2K1JA 4O62A 4UYDA 4HXNA 4LZ2A 5B79A 5B77A 4TT2A 3QZSA 1MBMA 1WEVA 2H0DB 4YYMA 2G45A 4XUAA 4ZC9A 3DWDA 3LQIA 3D7CA 2Y1MA 4BW1A 3D1BA 5FG5A 1JM7A 4BW3A 3FKMX 3ZYQA 5B78A 4HBYA 4KV4A 5C13A 2YW8A 4XY9A 4YYIA 1JM4B 4Z93A 5EISA 1T1HA 4O7CA 1WEUA 3C6WA 5E0RA 4WZ0A 2WP1A 3UV4A 4HBWA 3S91A 2YSJA 4BBQA 1WE9A 5G04B 5LJ1A 5D24A 1VYXA 3FJUB 5EK9A 3KNVA 4QEWA 3M99A 3LXJA 2EGPA 4FK5A 5E9MA 4Z0OA 2F6NA 3IU6A 4H9DA 2E6RA 4CLBA 3EB5A 3HCSA 2DATA 5D3TA 5EPRA 4UIWA 4A9OA 4OGJA 5EWHA 2VJEA 3O7AA 3U5OA 2YQMA 5IGMA 1LDKC 2MA5A 5CPEA 4YADA 4BJXA 3VKHA 5A5OA 3LQJA 1WEOA 5CQ8A 5H1UA 2EXUA 4YABA 3LDYA 3DWYA 2R0SA 1E4UA 5F62A 5F61A 4CL9A 2RO1A 5E9YA 4PY6A 2DJAA 4MVTA 4O78A 5CQTA 2JMIA 4MEOA 4WHUA 5CS8A 4CUUA 4YH3A 2VP7A 5H1VA 4QEVA 4Z6HA 3SOXA 5DY7A 5D7XA 5FE3A 2Y1NA 5FE8A 4AI6A 1K2FA 4PPEA 4S3OC 4A0CD 5FE7A 4NRBA 3D1DA 4HXOA 2M85A 2KWOA 2ECWA 4YBSA 4OGIA 3QZVA 2VNFA 4O70A 4UIYA 3I2DA 5CRZA 4LZRA 4WA6A 2ECJA 5FG4A 4AKGA 2MNYA 5FH6A 3RPGC 2MNZA 5DFBA 5KH7A 3JVJA 3TLPA 2KGGA 5EA1A 4UIZA 4F3IA 2YVRA 4CA1A 3N9PA 2ECGA 5LKUA 4Q0NA 3H7HA 5DLZA 2OXQC 2KKYA 5ENFA 2DSMA 4Z0RA 3U5MA 4IORA 1EQFA 3SVFA 2ZETC 2LV9A 2MUMA 3HTKC 4L58A 4WHWA 4B86C 4ALGA 4UYHA 2M3HA 4NR4A 2DVSA 2LAUA 4MSXA 5FEYA 4HXMA 2L5EA 3UW9A 1Z60A 5DINA 4A4CA 5A85A 3MQMA 1CHCA 2R10A 5FE5A 4ZDTA 2CSZA 5G4SA 5CU8A 5TABA 2YT5A 5DKHA 4XUBA 5HRWA 3QZTA 4AKIA 3O34A 4KCXA 5F1HA 3O47A 3O35A 5HELA 3P1CA 4CUQA 5HRXA 5A83A 2RI7A 5LVQA 2G6QA 5I3LA 4LYSA 2LXPC 5I83A 2LN0A 4QUUA 4NQMA 2CONA 2OSSA 2Y43A 1JM7B 3JVKA 4HXPA 5H85A 3G0JA 4QSXA 2LGVA 4YAXA 2UZGA 5AIUA 4NUEA 1WGMA 2KU3A 3GG3A 4NYVA 4A9NA 5CUAA 4QR3A 5LJ0A 4IR6A 5FH8A 3L11A 4QQ4A 2WP2A 3LVQE 5JWMA 4ZW1A 2E6SA 4AP4A 4YYHA 1WUMA 4J0RA 2MA6A 4QF3A 2G4AA 2EA6A 5L8UA 3PURA 4UI9B 5I7XA 4UYEA 2VPEA 4N3WA 2I7KA 4NR9A 4PS5A 3ZPV1 3T9KA 1WUGA 4C66A 4PTBA 3HCUA 2E7OA 4AKNA 4MEPA 4NRCA 1WEWA 4WZ3B 5ETDA 4NN2A 2YQLA 3MHHA 5ENHA 4BW2A 3GV4A 4ZUXU 4FJCA 2VJEB 5KH3A 5I29A 5LKXA 3MHSA 3JVMA 3IU5A 4TU4A 2YUCA 5F5ZA 4QB3A 5K29A 4HXSA 5LVRA 3M7KA 3LJUX 5EWCA 4IR3A 5HQ5A 2FFWA 3SUBA 2MKEA 2PNXA 2KIZA 2JMJA 2DX8A 5F63A 4I7BA 3MB4A 1WFKA 5B75A 3G0LA 2NXBA 4A9IA 5FDZA 2K16A 2RR4A 2LGLA 3M62A 3PUQA 5I7YA 2XOCA 2E3KA 2H60A 2EGMA 3GL6A 5CQ5A 3U5KA 3T7LA 3AADA 2KYUA 5E73A 3P1DA 4LDFA 5F25A 3DDTA 4C9ZA 4TQNA 3Q1DA 4J1PA 5HQ6A 5I86A 5G05B 3IHPA 2MIQA 5D3SA 3ZVZB 4GB0A 2L84A 5CFWA 5KH9A 1N72A 4IOOA 4MR5A 4YBTA 5C85A 3PHDA 4QEUA 5D3RA 4LJNA 2XOZA 4UP5A 4O7AA 5FE4A 5FE9A 2GRCA 2LGGA 5JG6A 5LKZA 1WEMA 2E7NA 5CGPA 2KWJA 5D3JA 5SVXA 4GNEA 4A9EA 4LR6A 3FL2A 4Z1QA 2YSMA 5ACYA 4W4UA 5LCWB 5AD2A 1PUOA 4FIPA 3KQIA 5D1KB 4DONA 2JRJA 3Q2FA 1E6IA 2NAAA 4HXLA 1FBVA 3ASLA 4TT6A 2D8SA 3N9NA 3LJWA 4YYNA 2DVQA 3P1EA 3LQHA 4UYFA 4WIVA 5HM0A 4UIXA 5KHMA 5A82A 4AYCA 5D1MB 5HCLA 4NS5A 2F6JA 5A5RA 4NQNA 2CT2A 2KKXA 2QJ0A 4YYKA 4NR5A 4V3KC 2FUUA 2MD8C 5LJ2A 5EWVA 2L0BA 1ZS5A 4UITA 2OUOA 2RSDA 4OGEA 1XWHA 1WEEA 4F52B 3N9QA 1X4IA 4QY4A 4A9JA 5G4RA 5F1LA 5BT4A 5DKCA 5E9LA 4X2IA 5A5PA 2YHOA 1LDJB 2LXHC 4AUQB 2H0DA 4IOQA 2MD7B 5EVAA 2G43A 5K3QA 2YDWA 5E3DA 3JUEA 4O64A 5JI8A 3C5KA 3SHBA 5I89A 4L7XA 5A7CA 5L99A 4Q6FA 5IBNA 3KV5A 2IQJA 2DWWA 2L80A 5G0FA 5ENBA 4TTEA 5KU3A 4IC2A 2DVRA 2L75A 5F2PA 2LDRA 4Z6IA 4A9HA 4O7EA 4QSQA 5KTUA 4TS8A 4TT4A 3ZYUA 5ENEA 2KR4A 3UV2A 1F68A 2VPDA 5EP7A 5FE2A 5I1QA 3O36A 3AQAA 2LQ6A 5F36A 1U6GB 3DPLR 5FFWA 2ECTA 5CUBA 2YHNA 4QF2A 2L5UA 1JOCA 5EQ1A 2AN6A 3LRQA 4QR5A 3UVWA 5H9MA 5I88A 5B76A 3UVYA 2EODA 3L1ZB 4AKHA 3ZPVE 4NR8A 2KGIA 4I7DA 4R2YA 1VD4A 5TBNA 3MXFA 2FUIA 1Z6UA 5L97A 1WILA 5C7NA 5IGNA 3E2DA 2LSPB 5D1LB 2C2VS 5HENA 1X4UA 3NXBA 5CUDA 2PUYA 4MR4A 3UVDA 4IR5A 5A5SA 5HLSA 2DKWA 4QZSA 2FSAA 2HYED 5EICA 2FD4A 4QBMA 4UYGA 5C89A 4NXJA 2ECVA 5E9IA 2YYRA 2K4DA 4O7FA 5L96A 3M63A 5FERA 3U5NA 5DKAA 5HEMA 1Z2QA 3KV6A 2RNYA 5A5QA 3SVHA 2C2LA 2KTBB 5AD3A 4A9MA 1VFYA 3P5OA 4QUTA 3U5LA 4LRGA 3N9LA 2VJFA 5L98A 3UV5A 2CRRA 4TKPB 4YYDA 5CUEA 5LKTA 1F62A 5A5NA 2XOYA 4RVRA 4N4IA 4PCIA 3HCTA 5F60A 3EB6A 5DLXA 2YURA 4NUCA 5KO4A 5LUUA 5DFCA 5C4QA 2KREA 2KWNA 4R7EA 5TRBA 1ZKRA 4O74A 5ENJA 1WEQA 2I8NA 4XYAA 3RCWA 2P57A 4FO9A 5SVYA 5F3AA 5E9VA 3O37A 3HMHA 3N9MA 3T6RA 4C67A 2M1RA 5HJCA 1WEPA 2JUNA 4R8PK 4UIUA 5B8DA 5AMEA 4A9LA 5SVIA 4QSWA 5COIA 4GPJA 4YYJA 4QR4A 2R0YA 2VPGA 4GNGA 5CQ4A 4CUPA 5TB6A 5DYAA 4MENA 5DKDA 1N87A 2CKLA 2D82A 4V3LC 3KDEC 5DYXA 2DVVA 3V43A 5TCMA 5CQ3A 1MM2A 2B0OE 5TDWA 4N4FA 4YYGA 4QYDA 2CRWA 5FB1A 2KE1A 2L43A 2IDAA 2KFTA 2M13A 2OWAA 4X3GA 4LYWA 4NYXA 5CZGA 4Q0OA 4Y03A 3U5JA 5J0DA 2D8UA 4QC3A 4YK0A 4BHWA 3VKGA 3SVGA 1DVPA 4KV1A 5FG6A 4IC3A 4LK9A 3DQVR 5D3HA 5EPBA 5KTWA 1MM3A 5AMFA 3S92A 5I40A 4OUFA 2JM3A 5DW2A 5DW1A 1ZBDB 2EJNA 4J3IA 5L8TA 3ERRA 3MB3A 1WENA 4CCGX 5CTLA 5ENGA 4YY4A 2XEUA 4O76A 3O33A 2BAYA 4QYLA 4B7YC 4S3OB 2XP0A 2YEMA 2VPBA 3L1XA 4GNFA 4NR7A 3HMFA 5CY9A 5CQAA 5DBMA 3ZTGA 3MDBC 4QSSA 4E96A 3PLWA 4QSVA 3N9OA 4BW4A 5D25A 4P5OB 4TZ2A 4CFKA 4J0SA 5ENIA 5FBXA 4ALHA 3MUKA 1X0JA 3Q2EA 4HXRA 5HFQA 2YREA 5DFDA 3RPGB 4O72A 4PKLA 5C87A 1WESA 5FFYA 5ENCA 4YY6A 3U5PA 1FP0A 5FB0A 4NRAA 2YW5A 3SOWA 5CQ7A 5IGKA 4A4BA 3ONIA 2I50A 4XI1A 5D26A 4QSRA 2LGKA 5IGLA 3FM8C 3ZVYA 5CUGA 4LKAA 4QSTA 5EGUA 5E9KA 3P1FA 4LADB 4QSUA 4QC1A 5D3LA 5I80A 3FAOA 2MT5A 2K17A 5E7DA 5HQ7A 5FE1A 2RNWA 4TU6A 2VJFB 4TYLA 1DCQA 3ZNIA 2YYNA 3K2JA 4O71A 1RMDA 4N4GA 5EI4A 2CSYA 5IIDA 4Z1SA 5FE6A 5CP5A 5II1A 4UIVA 5BT5A 1BORA 2CSVA 2OO1A 3JVLA 2E61A 2KWKA 4YBMA 3LVRE 4NUDA 4N4HA 5CUCA 3NG2A 3O70A 3I3JA 4UP0A 4O77A 5E74A 4HXKA 2YEKA 4YH4A 5J3XA 2JMDA 2R0VA 5TDRA 4LC2A 5KTXA 1HYJA 4TZ8A 4A49A 2YU4A 3HMEA 2HDPA 5ETBA 5II2A 3RTRB 2L85A 5CQ6A 5HRVA 5SVIB 3DAIA 2N9GA 1JSPB 4YATA 4F1PA 4ZQLA 4GNDA 2M6MA 5EYAF 5CRMA 5BT3A 5H1TA 5D3NA 2CKLB 4XY8A 5EU1A 5D0CA 2QIZA 2RNXA 5FE0A 5EPSA 4HBVA 4CFLA 5EV9A 2LRIC 4O7BA 5DX4A 4PCEA 2ECIA 5C11A 1IYMA 4LYIA 4HBXA 4O75A 5IG6A 2L7PA 3FEHA 4AVXA 4A9FA 4QNSA 5A81A 2YELA 2YQDA 4LZSA 5HFRA 4A9KA 5EWWA 4CUTA 5FFVA 1G25A 3SOUA 4MR6A 1WIMA 4UYFB 5D3PA 5EWDA 5DYCA 3MULA 2ECNA 1HYIA 2QICA 4AYCB 4NYWA 2MJVB 4CURA 2XB1A 1V87A 4MEQA 4I7CA 3FANA 2RS9B 4OGCA
chains in the Genus database with same CATH topology
4QSPA 5DYUA 5E3GA 2RFJA 4IR4A 3UVXA 5C8GA 4CUSA 4NR6A 4WZ2A 3VK6A 4MR3A 2D9EA 4FLPA 5EM3A 2F42A 1X4JA 5AITA 4LLBA 4YC9A 5FH7A 2K1JA 4UYDA 4HXNA 4LZ2A 5B79A 5B77A 4TT2A 3QZSA 2H0DB 1WEVA 4YYMA 2G45A 4XUAA 4ZC9A 3LQIA 3D7CA 2Y1MA 4BW1A 5FG5A 1JM7A 4BW3A 3FKMX 3ZYQA 5B78A 4HBYA 4KV4A 5C13A 2YW8A 4XY9A 4YYIA 1JM4B 4Z93A 5EISA 1T1HA 4O7CA 1WEUA 3C6WA 5E0RA 4WZ0A 2WP1A 3UV4A 4HBWA 3S91A 2YSJA 4BBQA 1WE9A 5G04B 5LJ1A 5D24A 1VYXA 5EK9A 3KNVA 4QEWA 3M99A 3LXJA 2EGPA 4FK5A 5E9MA 2F6NA 3IU6A 2E6RA 4CLBA 3EB5A 3HCSA 2DATA 5D3TA 5EPRA 4UIWA 4A9OA 4OGJA 5EWHA 2VJEA 3O7AA 3U5OA 2YQMA 5IGMA 1LDKC 2MA5A 5CPEA 4YADA 4BJXA 5A5OA 3LQJA 1WEOA 5CQ8A 5H1UA 4YABA 3DWYA 2R0SA 1E4UA 5F62A 5F61A 4CL9A 2RO1A 5E9YA 4PY6A 4MVTA 4O78A 5CQTA 2JMIA 4MEOA 4WHUA 5CS8A 4CUUA 4YH3A 2VP7A 5H1VA 4QEVA 4Z6HA 3SOXA 5DY7A 5D7XA 5FE3A 2Y1NA 5FE8A 1K2FA 4PPEA 4S3OC 4A0CD 5FE7A 4NRBA 4HXOA 2M85A 2KWOA 2ECWA 4YBSA 4OGIA 3QZVA 2VNFA 4O70A 4UIYA 3I2DA 5CRZA 4LZRA 4WA6A 2ECJA 5FG4A 2MNYA 3RPGC 5FH6A 2MNZA 5DFBA 5KH7A 3JVJA 3TLPA 2KGGA 5EA1A 4UIZA 4F3IA 4CA1A 3N9PA 2ECGA 5LKUA 4Q0NA 5DLZA 2OXQC 5ENFA 3U5MA 4IORA 1EQFA 3SVFA 2ZETC 2LV9A 2MUMA 3HTKC 4L58A 4WHWA 4B86C 4ALGA 4UYHA 2M3HA 4NR4A 2DVSA 4MSXA 5FEYA 4HXMA 2L5EA 3UW9A 1Z60A 5DINA 4A4CA 5A85A 3MQMA 1CHCA 2R10A 5FE5A 4ZDTA 2CSZA 5G4SA 5CU8A 5TABA 2YT5A 5DKHA 4XUBA 5HRWA 3QZTA 3O34A 4KCXA 5F1HA 3O35A 5HELA 3P1CA 4CUQA 5HRXA 5A83A 2RI7A 5LVQA 2G6QA 5I3LA 4LYSA 2LXPC 5I83A 2LN0A 4QUUA 4NQMA 2OSSA 2Y43A 1JM7B 3JVKA 4HXPA 5H85A 3G0JA 4QSXA 2LGVA 4YAXA 2UZGA 5AIUA 4NUEA 1WGMA 2KU3A 3GG3A 4NYVA 4A9NA 5CUAA 4QR3A 5LJ0A 4IR6A 5FH8A 3L11A 2WP2A 5JWMA 4ZW1A 2E6SA 4AP4A 4YYHA 1WUMA 4J0RA 2MA6A 4QF3A 2G4AA 2EA6A 5L8UA 3PURA 4UI9B 5I7XA 4UYEA 2VPEA 4N3WA 2I7KA 4NR9A 4PS5A 3ZPV1 1WUGA 4C66A 4PTBA 3HCUA 2E7OA 4AKNA 4MEPA 4NRCA 1WEWA 4WZ3B 5ETDA 4NN2A 2YQLA 3MHHA 5ENHA 4BW2A 3GV4A 4ZUXU 4FJCA 2VJEB 5KH3A 5I29A 5LKXA 3MHSA 3JVMA 3IU5A 4TU4A 2YUCA 5F5ZA 4QB3A 5K29A 4HXSA 5LVRA 5EWCA 4IR3A 5HQ5A 2PNXA 2KIZA 2JMJA 2DX8A 5F63A 4I7BA 3MB4A 1WFKA 5B75A 3G0LA 2NXBA 4A9IA 5FDZA 2K16A 2LGLA 3M62A 3PUQA 5I7YA 2E3KA 2H60A 3GL6A 5CQ5A 3U5KA 3T7LA 3AADA 2KYUA 5E73A 3P1DA 4LDFA 5F25A 4C9ZA 4TQNA 4J1PA 5HQ6A 5I86A 5G05B 3IHPA 2MIQA 5D3SA 3ZVZB 4GB0A 2L84A 5CFWA 5KH9A 1N72A 4IOOA 4MR5A 4YBTA 5C85A 3PHDA 4QEUA 5D3RA 4LJNA 4UP5A 4O7AA 5FE4A 5FE9A 2GRCA 2LGGA 5JG6A 5LKZA 1WEMA 2E7NA 5CGPA 2KWJA 5D3JA 4GNEA 4A9EA 4LR6A 3FL2A 4Z1QA 2YSMA 5ACYA 4W4UA 5LCWB 5AD2A 4FIPA 3KQIA 5D1KB 4DONA 2JRJA 3Q2FA 1E6IA 2NAAA 4HXLA 1FBVA 3ASLA 4TT6A 2D8SA 3N9NA 3LJWA 4YYNA 2DVQA 3P1EA 3LQHA 4UYFA 4WIVA 5HM0A 4UIXA 5KHMA 5A82A 4AYCA 5D1MB 5HCLA 4NS5A 2F6JA 5A5RA 4NQNA 2CT2A 2QJ0A 4YYKA 4NR5A 4V3KC 2FUUA 2MD8C 5LJ2A 5EWVA 2L0BA 1ZS5A 4UITA 2OUOA 2RSDA 1XWHA 1WEEA 4F52B 3N9QA 1X4IA 4QY4A 4A9JA 5G4RA 5F1LA 5BT4A 5DKCA 5E9LA 4X2IA 5A5PA 2YHOA 1LDJB 2LXHC 4AUQB 2H0DA 4IOQA 2MD7B 5EVAA 2G43A 2YDWA 5E3DA 4O64A 5JI8A 3C5KA 3SHBA 5I89A 4L7XA 5A7CA 5L99A 4Q6FA 5IBNA 3KV5A 5G0FA 2DWWA 2L80A 5ENBA 4TTEA 5KU3A 4IC2A 2DVRA 2L75A 5F2PA 2LDRA 4Z6IA 4A9HA 4O7EA 4QSQA 5KTUA 4TS8A 4TT4A 3ZYUA 5ENEA 2KR4A 3UV2A 1F68A 2VPDA 5EP7A 5FE2A 5I1QA 3O36A 3AQAA 2LQ6A 5F36A 1U6GB 3DPLR 5FFWA 2ECTA 5CUBA 2YHNA 4QF2A 2L5UA 1JOCA 5EQ1A 2AN6A 3LRQA 4QR5A 3UVWA 5H9MA 5I88A 5B76A 3UVYA 2EODA 3L1ZB 3ZPVE 4NR8A 2KGIA 4I7DA 4R2YA 1VD4A 5TBNA 3MXFA 2FUIA 1Z6UA 5L97A 1WILA 5C7NA 5IGNA 2LSPB 5D1LB 2C2VS 5HENA 1X4UA 3NXBA 5CUDA 2PUYA 4MR4A 3UVDA 4IR5A 5A5SA 5HLSA 2DKWA 4QZSA 2FSAA 2HYED 5EICA 4QBMA 4UYGA 5C89A 4NXJA 2ECVA 5E9IA 2YYRA 2K4DA 4O7FA 5L96A 3M63A 5FERA 3U5NA 5DKAA 5HEMA 1Z2QA 3KV6A 2RNYA 5A5QA 3SVHA 2C2LA 2KTBB 5AD3A 4A9MA 1VFYA 3P5OA 4QUTA 3U5LA 4LRGA 3N9LA 2VJFA 5L98A 3UV5A 4TKPB 4YYDA 5CUEA 5LKTA 1F62A 5A5NA 4RVRA 4N4IA 4PCIA 3HCTA 5F60A 3EB6A 5DLXA 2YURA 4NUCA 5KO4A 5LUUA 5DFCA 5C4QA 2KREA 2KWNA 4R7EA 5TRBA 5ENJA 4O74A 1WEQA 2I8NA 4XYAA 3RCWA 4FO9A 5F3AA 5E9VA 3O37A 3HMHA 3N9MA 3T6RA 4C67A 2M1RA 5HJCA 1WEPA 4R8PK 4UIUA 5B8DA 5AMEA 4A9LA 4QSWA 5COIA 4GPJA 4YYJA 4QR4A 2R0YA 2VPGA 4GNGA 5CQ4A 4CUPA 5TB6A 5DYAA 4MENA 5DKDA 1N87A 2CKLA 2D82A 4V3LC 5DYXA 2DVVA 3V43A 5TCMA 5CQ3A 1MM2A 5TDWA 4N4FA 4YYGA 4QYDA 5FB1A 2KE1A 2L43A 2IDAA 2KFTA 4X3GA 4LYWA 4NYXA 5CZGA 4Q0OA 4Y03A 3U5JA 5J0DA 4QC3A 4YK0A 4BHWA 3SVGA 1DVPA 4KV1A 5FG6A 4IC3A 4LK9A 3DQVR 5D3HA 5EPBA 5KTWA 1MM3A 5AMFA 3S92A 5I40A 4OUFA 5DW2A 5DW1A 1ZBDB 4J3IA 5L8TA 3MB3A 1WENA 4CCGX 5CTLA 5ENGA 4YY4A 2XEUA 4O76A 3O33A 2BAYA 4QYLA 4B7YC 4S3OB 3L1XA 2YEMA 2VPBA 4GNFA 4NR7A 3HMFA 5CY9A 5CQAA 5DBMA 3ZTGA 4QSSA 4E96A 4QSVA 3N9OA 4BW4A 5D25A 4P5OB 4TZ2A 4CFKA 4J0SA 5ENIA 5FBXA 4ALHA 3MUKA 1X0JA 3Q2EA 4HXRA 5HFQA 2YREA 5DFDA 3RPGB 4O72A 4PKLA 5C87A 1WESA 5FFYA 5ENCA 4YY6A 3U5PA 1FP0A 5FB0A 4NRAA 2YW5A 3SOWA 5CQ7A 5IGKA 4A4BA 3ONIA 2I50A 4XI1A 5D26A 4QSRA 2LGKA 5IGLA 3ZVYA 5CUGA 4LKAA 4QSTA 5EGUA 5E9KA 3P1FA 4LADB 4QSUA 4QC1A 5D3LA 5I80A 2MT5A 2K17A 5E7DA 5HQ7A 5FE1A 2RNWA 4TU6A 2VJFB 4TYLA 3ZNIA 2YYNA 3K2JA 4O71A 1RMDA 4N4GA 5EI4A 2CSYA 5IIDA 4Z1SA 5FE6A 5CP5A 5II1A 4UIVA 5BT5A 1BORA 2OO1A 3JVLA 2KWKA 3NG2A 4YBMA 4NUDA 4N4HA 5CUCA 3O70A 3I3JA 4UP0A 4O77A 5E74A 4HXKA 2YEKA 4YH4A 5J3XA 2JMDA 2R0VA 5TDRA 4LC2A 5KTXA 1HYJA 4TZ8A 4A49A 2YU4A 3HMEA 2HDPA 5ETBA 5II2A 3RTRB 2L85A 5CQ6A 5HRVA 3DAIA 2N9GA 1JSPB 4YATA 4ZQLA 4GNDA 2M6MA 5EYAF 5CRMA 5BT3A 5H1TA 5D3NA 2CKLB 4XY8A 5EU1A 5D0CA 2QIZA 2RNXA 5FE0A 5EPSA 4HBVA 4CFLA 5EV9A 2LRIC 4O7BA 5DX4A 4PCEA 2ECIA 5C11A 1IYMA 4LYIA 4HBXA 4O75A 5IG6A 4AVXA 4A9FA 4QNSA 5A81A 2YELA 2YQDA 4LZSA 5HFRA 4A9KA 5EWWA 4CUTA 5FFVA 1G25A 3SOUA 4MR6A 1WIMA 4UYFB 5D3PA 5EWDA 5DYCA 3MULA 2ECNA 1HYIA 2QICA 4AYCB 4NYWA 2MJVB 4CURA 2XB1A 1V87A 4MEQA 4I7CA 2RS9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSP A;  5DYU A;  5E3G A;  2RFJ A;  4IR4 A;  3UVX A;  5C8G A;  4CUS A;  4NR6 A;  4WZ2 A;  3VK6 A;  4MR3 A;  2D9E A;  4FLP A;  5EM3 A;  2F42 A;  1X4J A;  5AIT A;  4LLB A;  4YC9 A;  5FH7 A;  2K1J A;  4UYD A;  4HXN A;  4LZ2 A;  5B79 A;  5B77 A;  4TT2 A;  3QZS A;  2H0D B;  1WEV A;  4YYM A;  2G45 A;  4XUA A;  4ZC9 A;  3LQI A;  3D7C A;  2Y1M A;  4BW1 A;  5FG5 A;  1JM7 A;  4BW3 A;  3FKM X;  3ZYQ A;  5B78 A;  4HBY A;  4KV4 A;  5C13 A;  2YW8 A;  4XY9 A;  4YYI A;  1JM4 B;  4Z93 A;  5EIS A;  1T1H A;  4O7C A;  1WEU A;  3C6W A;  5E0R A;  4WZ0 A;  2WP1 A;  3UV4 A;  4HBW A;  3S91 A;  2YSJ A;  4BBQ A;  1WE9 A;  5G04 B;  5LJ1 A;  5D24 A;  1VYX A;  5EK9 A;  3KNV A;  4QEW A;  3M99 A;  3LXJ A;  2EGP A;  4FK5 A;  5E9M A;  2F6N A;  3IU6 A;  2E6R A;  4CLB A;  3EB5 A;  3HCS A;  2DAT A;  5D3T A;  5EPR A;  4UIW A;  4A9O A;  4OGJ A;  5EWH A;  2VJE A;  3O7A A;  3U5O A;  2YQM A;  5IGM A;  1LDK C;  2MA5 A;  5CPE A;  4YAD A;  4BJX A;  5A5O A;  3LQJ A;  1WEO A;  5CQ8 A;  5H1U A;  4YAB A;  3DWY A;  2R0S A;  1E4U A;  5F62 A;  5F61 A;  4CL9 A;  2RO1 A;  5E9Y A;  4PY6 A;  4MVT A;  4O78 A;  5CQT A;  2JMI A;  4MEO A;  4WHU A;  5CS8 A;  4CUU A;  4YH3 A;  2VP7 A;  5H1V A;  4QEV A;  4Z6H A;  3SOX A;  5DY7 A;  5D7X A;  5FE3 A;  2Y1N A;  5FE8 A;  1K2F A;  4PPE A;  4S3O C;  4A0C D;  5FE7 A;  4NRB A;  4HXO A;  2M85 A;  2KWO A;  2ECW A;  4YBS A;  4OGI A;  3QZV A;  2VNF A;  4O70 A;  4UIY A;  3I2D A;  5CRZ A;  4LZR A;  4WA6 A;  2ECJ A;  5FG4 A;  2MNY A;  3RPG C;  5FH6 A;  2MNZ A;  5DFB A;  5KH7 A;  3JVJ A;  3TLP A;  2KGG A;  5EA1 A;  4UIZ A;  4F3I A;  4CA1 A;  3N9P A;  2ECG A;  5LKU A;  4Q0N A;  5DLZ A;  2OXQ C;  5ENF A;  3U5M A;  4IOR A;  1EQF A;  3SVF A;  2ZET C;  2LV9 A;  2MUM A;  3HTK C;  4L58 A;  4WHW A;  4B86 C;  4ALG A;  4UYH A;  2M3H A;  4NR4 A;  2DVS A;  4MSX A;  5FEY A;  4HXM A;  2L5E A;  3UW9 A;  1Z60 A;  5DIN A;  4A4C A;  5A85 A;  3MQM A;  1CHC A;  2R10 A;  5FE5 A;  4ZDT A;  2CSZ A;  5G4S A;  5CU8 A;  5TAB A;  2YT5 A;  5DKH A;  4XUB A;  5HRW A;  3QZT A;  3O34 A;  4KCX A;  5F1H A;  3O35 A;  5HEL A;  3P1C A;  4CUQ A;  5HRX A;  5A83 A;  2RI7 A;  5LVQ A;  2G6Q A;  5I3L A;  4LYS A;  2LXP C;  5I83 A;  2LN0 A;  4QUU A;  4NQM A;  2OSS A;  2Y43 A;  1JM7 B;  3JVK A;  4HXP A;  5H85 A;  3G0J A;  4QSX A;  2LGV A;  4YAX A;  2UZG A;  5AIU A;  4NUE A;  1WGM A;  2KU3 A;  3GG3 A;  4NYV A;  4A9N A;  5CUA A;  4QR3 A;  5LJ0 A;  4IR6 A;  5FH8 A;  3L11 A;  2WP2 A;  5JWM A;  4ZW1 A;  2E6S A;  4AP4 A;  4YYH A;  1WUM A;  4J0R A;  2MA6 A;  4QF3 A;  2G4A A;  2EA6 A;  5L8U A;  3PUR A;  4UI9 B;  5I7X A;  4UYE A;  2VPE A;  4N3W A;  2I7K A;  4NR9 A;  4PS5 A;  3ZPV 1;  1WUG A;  4C66 A;  4PTB A;  3HCU A;  2E7O A;  4AKN A;  4MEP A;  4NRC A;  1WEW A;  4WZ3 B;  5ETD A;  4NN2 A;  2YQL A;  3MHH A;  5ENH A;  4BW2 A;  3GV4 A;  4ZUX U;  4FJC A;  2VJE B;  5KH3 A;  5I29 A;  5LKX A;  3MHS A;  3JVM A;  3IU5 A;  4TU4 A;  2YUC A;  5F5Z A;  4QB3 A;  5K29 A;  4HXS A;  5LVR A;  5EWC A;  4IR3 A;  5HQ5 A;  2PNX A;  2KIZ A;  2JMJ A;  2DX8 A;  5F63 A;  4I7B A;  3MB4 A;  1WFK A;  5B75 A;  3G0L A;  2NXB A;  4A9I A;  5FDZ A;  2K16 A;  2LGL A;  3M62 A;  3PUQ A;  5I7Y A;  2E3K A;  2H60 A;  3GL6 A;  5CQ5 A;  3U5K A;  3T7L A;  3AAD A;  2KYU A;  5E73 A;  3P1D A;  4LDF A;  5F25 A;  4C9Z A;  4TQN A;  4J1P A;  5HQ6 A;  5I86 A;  5G05 B;  3IHP A;  2MIQ A;  5D3S A;  3ZVZ B;  4GB0 A;  2L84 A;  5CFW A;  5KH9 A;  1N72 A;  4IOO A;  4MR5 A;  4YBT A;  5C85 A;  3PHD A;  4QEU A;  5D3R A;  4LJN A;  4UP5 A;  4O7A A;  5FE4 A;  5FE9 A;  2GRC A;  2LGG A;  5JG6 A;  5LKZ A;  1WEM A;  2E7N A;  5CGP A;  2KWJ A;  5D3J A;  4GNE A;  4A9E A;  4LR6 A;  3FL2 A;  4Z1Q A;  2YSM A;  5ACY A;  4W4U A;  5LCW B;  5AD2 A;  4FIP A;  3KQI A;  5D1K B;  4DON A;  2JRJ A;  3Q2F A;  1E6I A;  2NAA A;  4HXL A;  1FBV A;  3ASL A;  4TT6 A;  2D8S A;  3N9N A;  3LJW A;  4YYN A;  2DVQ A;  3P1E A;  3LQH A;  4UYF A;  4WIV A;  5HM0 A;  4UIX A;  5KHM A;  5A82 A;  4AYC A;  5D1M B;  5HCL A;  4NS5 A;  2F6J A;  5A5R A;  4NQN A;  2CT2 A;  2QJ0 A;  4YYK A;  4NR5 A;  4V3K C;  2FUU A;  2MD8 C;  5LJ2 A;  5EWV A;  2L0B A;  1ZS5 A;  4UIT A;  2OUO A;  2RSD A;  1XWH A;  1WEE A;  4F52 B;  3N9Q A;  1X4I A;  4QY4 A;  4A9J A;  5G4R A;  5F1L A;  5BT4 A;  5DKC A;  5E9L A;  4X2I A;  5A5P A;  2YHO A;  1LDJ B;  2LXH C;  4AUQ B;  2H0D A;  4IOQ A;  2MD7 B;  5EVA A;  2G43 A;  2YDW A;  5E3D A;  4O64 A;  5JI8 A;  3C5K A;  3SHB A;  5I89 A;  4L7X A;  5A7C A;  5L99 A;  4Q6F A;  5IBN A;  3KV5 A;  5G0F A;  2DWW A;  2L80 A;  5ENB A;  4TTE A;  5KU3 A;  4IC2 A;  2DVR A;  2L75 A;  5F2P A;  2LDR A;  4Z6I A;  4A9H A;  4O7E A;  4QSQ A;  5KTU A;  4TS8 A;  4TT4 A;  3ZYU A;  5ENE A;  2KR4 A;  3UV2 A;  1F68 A;  2VPD A;  5EP7 A;  5FE2 A;  5I1Q A;  3O36 A;  3AQA A;  2LQ6 A;  5F36 A;  1U6G B;  3DPL R;  5FFW A;  2ECT A;  5CUB A;  2YHN A;  4QF2 A;  2L5U A;  1JOC A;  5EQ1 A;  2AN6 A;  3LRQ A;  4QR5 A;  3UVW A;  5H9M A;  5I88 A;  5B76 A;  3UVY A;  2EOD A;  3L1Z B;  3ZPV E;  4NR8 A;  2KGI A;  4I7D A;  4R2Y A;  1VD4 A;  5TBN A;  3MXF A;  2FUI A;  1Z6U A;  5L97 A;  1WIL A;  5C7N A;  5IGN A;  2LSP B;  5D1L B;  2C2V S;  5HEN A;  1X4U A;  3NXB A;  5CUD A;  2PUY A;  4MR4 A;  3UVD A;  4IR5 A;  5A5S A;  5HLS A;  2DKW A;  4QZS A;  2FSA A;  2HYE D;  5EIC A;  4QBM A;  4UYG A;  5C89 A;  4NXJ A;  2ECV A;  5E9I A;  2YYR A;  2K4D A;  4O7F A;  5L96 A;  3M63 A;  5FER A;  3U5N A;  5DKA A;  5HEM A;  1Z2Q A;  3KV6 A;  2RNY A;  5A5Q A;  3SVH A;  2C2L A;  2KTB B;  5AD3 A;  4A9M A;  1VFY A;  3P5O A;  4QUT A;  3U5L A;  4LRG A;  3N9L A;  2VJF A;  5L98 A;  3UV5 A;  4TKP B;  4YYD A;  5CUE A;  5LKT A;  1F62 A;  5A5N A;  4RVR A;  4N4I A;  4PCI A;  3HCT A;  5F60 A;  3EB6 A;  5DLX A;  2YUR A;  4NUC A;  5KO4 A;  5LUU A;  5DFC A;  5C4Q A;  2KRE A;  2KWN A;  4R7E A;  5TRB A;  5ENJ A;  4O74 A;  1WEQ A;  2I8N A;  4XYA A;  3RCW A;  4FO9 A;  5F3A A;  5E9V A;  3O37 A;  3HMH A;  3N9M A;  3T6R A;  4C67 A;  2M1R A;  5HJC A;  1WEP A;  4R8P K;  4UIU A;  5B8D A;  5AME A;  4A9L A;  4QSW A;  5COI A;  4GPJ A;  4YYJ A;  4QR4 A;  2R0Y A;  2VPG A;  4GNG A;  5CQ4 A;  4CUP A;  5TB6 A;  5DYA A;  4MEN A;  5DKD A;  1N87 A;  2CKL A;  2D82 A;  4V3L C;  5DYX A;  2DVV A;  3V43 A;  5TCM A;  5CQ3 A;  1MM2 A;  5TDW A;  4N4F A;  4YYG A;  4QYD A;  5FB1 A;  2KE1 A;  2L43 A;  2IDA A;  2KFT A;  4X3G A;  4LYW A;  4NYX A;  5CZG A;  4Q0O A;  4Y03 A;  3U5J A;  5J0D A;  4QC3 A;  4YK0 A;  4BHW A;  3SVG A;  1DVP A;  4KV1 A;  5FG6 A;  4IC3 A;  4LK9 A;  3DQV R;  5D3H A;  5EPB A;  5KTW A;  1MM3 A;  5AMF A;  3S92 A;  5I40 A;  4OUF A;  5DW2 A;  5DW1 A;  1ZBD B;  4J3I A;  5L8T A;  3MB3 A;  1WEN A;  4CCG X;  5CTL A;  5ENG A;  4YY4 A;  2XEU A;  4O76 A;  3O33 A;  2BAY A;  4QYL A;  4B7Y C;  4S3O B;  3L1X A;  2YEM A;  2VPB A;  4GNF A;  4NR7 A;  3HMF A;  5CY9 A;  5CQA A;  5DBM A;  3ZTG A;  4QSS A;  4E96 A;  4QSV A;  3N9O A;  4BW4 A;  5D25 A;  4P5O B;  4TZ2 A;  4CFK A;  4J0S A;  5ENI A;  5FBX A;  4ALH A;  3MUK A;  1X0J A;  3Q2E A;  4HXR A;  5HFQ A;  2YRE A;  5DFD A;  3RPG B;  4O72 A;  4PKL A;  5C87 A;  1WES A;  5FFY A;  5ENC A;  4YY6 A;  3U5P A;  1FP0 A;  5FB0 A;  4NRA A;  2YW5 A;  3SOW A;  5CQ7 A;  5IGK A;  4A4B A;  3ONI A;  2I50 A;  4XI1 A;  5D26 A;  4QSR A;  2LGK A;  5IGL A;  3ZVY A;  5CUG A;  4LKA A;  4QST A;  5EGU A;  5E9K A;  3P1F A;  4LAD B;  4QSU A;  4QC1 A;  5D3L A;  5I80 A;  2MT5 A;  2K17 A;  5E7D A;  5HQ7 A;  5FE1 A;  2RNW A;  4TU6 A;  2VJF B;  4TYL A;  3ZNI A;  2YYN A;  3K2J A;  4O71 A;  1RMD A;  4N4G A;  5EI4 A;  2CSY A;  5IID A;  4Z1S A;  5FE6 A;  5CP5 A;  5II1 A;  4UIV A;  5BT5 A;  1BOR A;  2OO1 A;  3JVL A;  2KWK A;  3NG2 A;  4YBM A;  4NUD A;  4N4H A;  5CUC A;  3O70 A;  3I3J A;  4UP0 A;  4O77 A;  5E74 A;  4HXK A;  2YEK A;  4YH4 A;  5J3X A;  2JMD A;  2R0V A;  5TDR A;  4LC2 A;  5KTX A;  1HYJ A;  4TZ8 A;  4A49 A;  2YU4 A;  3HME A;  2HDP A;  5ETB A;  5II2 A;  3RTR B;  2L85 A;  5CQ6 A;  5HRV A;  3DAI A;  2N9G A;  1JSP B;  4YAT A;  4ZQL A;  4GND A;  2M6M A;  5EYA F;  5CRM A;  5BT3 A;  5H1T A;  5D3N A;  2CKL B;  4XY8 A;  5EU1 A;  5D0C A;  2QIZ A;  2RNX A;  5FE0 A;  5EPS A;  4HBV A;  4CFL A;  5EV9 A;  2LRI C;  4O7B A;  5DX4 A;  4PCE A;  2ECI A;  5C11 A;  1IYM A;  4LYI A;  4HBX A;  4O75 A;  5IG6 A;  4AVX A;  4A9F A;  4QNS A;  5A81 A;  2YEL A;  2YQD A;  4LZS A;  5HFR A;  4A9K A;  5EWW A;  4CUT A;  5FFV A;  1G25 A;  3SOU A;  4MR6 A;  1WIM A;  4UYF B;  5D3P A;  5EWD A;  5DYC A;  3MUL A;  2ECN A;  1HYI A;  2QIC A;  4AYC B;  4NYW A;  2MJV B;  4CUR A;  2XB1 A;  1V87 A;  4MEQ A;  4I7C A;  2RS9 B; 
#chains in the Genus database with same CATH topology
 4QSP A;  5DYU A;  5E3G A;  2RFJ A;  4IR4 A;  3UVX A;  5C8G A;  4CUS A;  4NR6 A;  4WZ2 A;  3VK6 A;  4MR3 A;  2D9E A;  4FLP A;  5EM3 A;  2F42 A;  1X4J A;  5AIT A;  4LLB A;  4YC9 A;  5FH7 A;  2K1J A;  4O62 A;  4UYD A;  4HXN A;  4LZ2 A;  5B79 A;  5B77 A;  4TT2 A;  3QZS A;  1MBM A;  1WEV A;  2H0D B;  4YYM A;  2G45 A;  4XUA A;  4ZC9 A;  3DWD A;  3LQI A;  3D7C A;  2Y1M A;  4BW1 A;  3D1B A;  5FG5 A;  1JM7 A;  4BW3 A;  3FKM X;  3ZYQ A;  5B78 A;  4HBY A;  4KV4 A;  5C13 A;  2YW8 A;  4XY9 A;  4YYI A;  1JM4 B;  4Z93 A;  5EIS A;  1T1H A;  4O7C A;  1WEU A;  3C6W A;  5E0R A;  4WZ0 A;  2WP1 A;  3UV4 A;  4HBW A;  3S91 A;  2YSJ A;  4BBQ A;  1WE9 A;  5G04 B;  5LJ1 A;  5D24 A;  1VYX A;  3FJU B;  5EK9 A;  3KNV A;  4QEW A;  3M99 A;  3LXJ A;  2EGP A;  4FK5 A;  5E9M A;  4Z0O A;  2F6N A;  3IU6 A;  4H9D A;  2E6R A;  4CLB A;  3EB5 A;  3HCS A;  2DAT A;  5D3T A;  5EPR A;  4UIW A;  4A9O A;  4OGJ A;  5EWH A;  2VJE A;  3O7A A;  3U5O A;  2YQM A;  5IGM A;  1LDK C;  2MA5 A;  5CPE A;  4YAD A;  4BJX A;  3VKH A;  5A5O A;  3LQJ A;  1WEO A;  5CQ8 A;  5H1U A;  2EXU A;  4YAB A;  3LDY A;  3DWY A;  2R0S A;  1E4U A;  5F62 A;  5F61 A;  4CL9 A;  2RO1 A;  5E9Y A;  4PY6 A;  2DJA A;  4MVT A;  4O78 A;  5CQT A;  2JMI A;  4MEO A;  4WHU A;  5CS8 A;  4CUU A;  4YH3 A;  2VP7 A;  5H1V A;  4QEV A;  4Z6H A;  3SOX A;  5DY7 A;  5D7X A;  5FE3 A;  2Y1N A;  5FE8 A;  4AI6 A;  1K2F A;  4PPE A;  4S3O C;  4A0C D;  5FE7 A;  4NRB A;  3D1D A;  4HXO A;  2M85 A;  2KWO A;  2ECW A;  4YBS A;  4OGI A;  3QZV A;  2VNF A;  4O70 A;  4UIY A;  3I2D A;  5CRZ A;  4LZR A;  4WA6 A;  2ECJ A;  5FG4 A;  4AKG A;  2MNY A;  5FH6 A;  3RPG C;  2MNZ A;  5DFB A;  5KH7 A;  3JVJ A;  3TLP A;  2KGG A;  5EA1 A;  4UIZ A;  4F3I A;  2YVR A;  4CA1 A;  3N9P A;  2ECG A;  5LKU A;  4Q0N A;  3H7H A;  5DLZ A;  2OXQ C;  2KKY A;  5ENF A;  2DSM A;  4Z0R A;  3U5M A;  4IOR A;  1EQF A;  3SVF A;  2ZET C;  2LV9 A;  2MUM A;  3HTK C;  4L58 A;  4WHW A;  4B86 C;  4ALG A;  4UYH A;  2M3H A;  4NR4 A;  2DVS A;  2LAU A;  4MSX A;  5FEY A;  4HXM A;  2L5E A;  3UW9 A;  1Z60 A;  5DIN A;  4A4C A;  5A85 A;  3MQM A;  1CHC A;  2R10 A;  5FE5 A;  4ZDT A;  2CSZ A;  5G4S A;  5CU8 A;  5TAB A;  2YT5 A;  5DKH A;  4XUB A;  5HRW A;  3QZT A;  4AKI A;  3O34 A;  4KCX A;  5F1H A;  3O47 A;  3O35 A;  5HEL A;  3P1C A;  4CUQ A;  5HRX A;  5A83 A;  2RI7 A;  5LVQ A;  2G6Q A;  5I3L A;  4LYS A;  2LXP C;  5I83 A;  2LN0 A;  4QUU A;  4NQM A;  2CON A;  2OSS A;  2Y43 A;  1JM7 B;  3JVK A;  4HXP A;  5H85 A;  3G0J A;  4QSX A;  2LGV A;  4YAX A;  2UZG A;  5AIU A;  4NUE A;  1WGM A;  2KU3 A;  3GG3 A;  4NYV A;  4A9N A;  5CUA A;  4QR3 A;  5LJ0 A;  4IR6 A;  5FH8 A;  3L11 A;  4QQ4 A;  2WP2 A;  3LVQ E;  5JWM A;  4ZW1 A;  2E6S A;  4AP4 A;  4YYH A;  1WUM A;  4J0R A;  2MA6 A;  4QF3 A;  2G4A A;  2EA6 A;  5L8U A;  3PUR A;  4UI9 B;  5I7X A;  4UYE A;  2VPE A;  4N3W A;  2I7K A;  4NR9 A;  4PS5 A;  3ZPV 1;  3T9K A;  1WUG A;  4C66 A;  4PTB A;  3HCU A;  2E7O A;  4AKN A;  4MEP A;  4NRC A;  1WEW A;  4WZ3 B;  5ETD A;  4NN2 A;  2YQL A;  3MHH A;  5ENH A;  4BW2 A;  3GV4 A;  4ZUX U;  4FJC A;  2VJE B;  5KH3 A;  5I29 A;  5LKX A;  3MHS A;  3JVM A;  3IU5 A;  4TU4 A;  2YUC A;  5F5Z A;  4QB3 A;  5K29 A;  4HXS A;  5LVR A;  3M7K A;  3LJU X;  5EWC A;  4IR3 A;  5HQ5 A;  2FFW A;  3SUB A;  2MKE A;  2PNX A;  2KIZ A;  2JMJ A;  2DX8 A;  5F63 A;  4I7B A;  3MB4 A;  1WFK A;  5B75 A;  3G0L A;  2NXB A;  4A9I A;  5FDZ A;  2K16 A;  2RR4 A;  2LGL A;  3M62 A;  3PUQ A;  5I7Y A;  2XOC A;  2E3K A;  2H60 A;  2EGM A;  3GL6 A;  5CQ5 A;  3U5K A;  3T7L A;  3AAD A;  2KYU A;  5E73 A;  3P1D A;  4LDF A;  5F25 A;  3DDT A;  4C9Z A;  4TQN A;  3Q1D A;  4J1P A;  5HQ6 A;  5I86 A;  5G05 B;  3IHP A;  2MIQ A;  5D3S A;  3ZVZ B;  4GB0 A;  2L84 A;  5CFW A;  5KH9 A;  1N72 A;  4IOO A;  4MR5 A;  4YBT A;  5C85 A;  3PHD A;  4QEU A;  5D3R A;  4LJN A;  2XOZ A;  4UP5 A;  4O7A A;  5FE4 A;  5FE9 A;  2GRC A;  2LGG A;  5JG6 A;  5LKZ A;  1WEM A;  2E7N A;  5CGP A;  2KWJ A;  5D3J A;  5SVX A;  4GNE A;  4A9E A;  4LR6 A;  3FL2 A;  4Z1Q A;  2YSM A;  5ACY A;  4W4U A;  5LCW B;  5AD2 A;  1PUO A;  4FIP A;  3KQI A;  5D1K B;  4DON A;  2JRJ A;  3Q2F A;  1E6I A;  2NAA A;  4HXL A;  1FBV A;  3ASL A;  4TT6 A;  2D8S A;  3N9N A;  3LJW A;  4YYN A;  2DVQ A;  3P1E A;  3LQH A;  4UYF A;  4WIV A;  5HM0 A;  4UIX A;  5KHM A;  5A82 A;  4AYC A;  5D1M B;  5HCL A;  4NS5 A;  2F6J A;  5A5R A;  4NQN A;  2CT2 A;  2KKX A;  2QJ0 A;  4YYK A;  4NR5 A;  4V3K C;  2FUU A;  2MD8 C;  5LJ2 A;  5EWV A;  2L0B A;  1ZS5 A;  4UIT A;  2OUO A;  2RSD A;  4OGE A;  1XWH A;  1WEE A;  4F52 B;  3N9Q A;  1X4I A;  4QY4 A;  4A9J A;  5G4R A;  5F1L A;  5BT4 A;  5DKC A;  5E9L A;  4X2I A;  5A5P A;  2YHO A;  1LDJ B;  2LXH C;  4AUQ B;  2H0D A;  4IOQ A;  2MD7 B;  5EVA A;  2G43 A;  5K3Q A;  2YDW A;  5E3D A;  3JUE A;  4O64 A;  5JI8 A;  3C5K A;  3SHB A;  5I89 A;  4L7X A;  5A7C A;  5L99 A;  4Q6F A;  5IBN A;  3KV5 A;  2IQJ A;  2DWW A;  2L80 A;  5G0F A;  5ENB A;  4TTE A;  5KU3 A;  4IC2 A;  2DVR A;  2L75 A;  5F2P A;  2LDR A;  4Z6I A;  4A9H A;  4O7E A;  4QSQ A;  5KTU A;  4TS8 A;  4TT4 A;  3ZYU A;  5ENE A;  2KR4 A;  3UV2 A;  1F68 A;  2VPD A;  5EP7 A;  5FE2 A;  5I1Q A;  3O36 A;  3AQA A;  2LQ6 A;  5F36 A;  1U6G B;  3DPL R;  5FFW A;  2ECT A;  5CUB A;  2YHN A;  4QF2 A;  2L5U A;  1JOC A;  5EQ1 A;  2AN6 A;  3LRQ A;  4QR5 A;  3UVW A;  5H9M A;  5I88 A;  5B76 A;  3UVY A;  2EOD A;  3L1Z B;  4AKH A;  3ZPV E;  4NR8 A;  2KGI A;  4I7D A;  4R2Y A;  1VD4 A;  5TBN A;  3MXF A;  2FUI A;  1Z6U A;  5L97 A;  1WIL A;  5C7N A;  5IGN A;  3E2D A;  2LSP B;  5D1L B;  2C2V S;  5HEN A;  1X4U A;  3NXB A;  5CUD A;  2PUY A;  4MR4 A;  3UVD A;  4IR5 A;  5A5S A;  5HLS A;  2DKW A;  4QZS A;  2FSA A;  2HYE D;  5EIC A;  2FD4 A;  4QBM A;  4UYG A;  5C89 A;  4NXJ A;  2ECV A;  5E9I A;  2YYR A;  2K4D A;  4O7F A;  5L96 A;  3M63 A;  5FER A;  3U5N A;  5DKA A;  5HEM A;  1Z2Q A;  3KV6 A;  2RNY A;  5A5Q A;  3SVH A;  2C2L A;  2KTB B;  5AD3 A;  4A9M A;  1VFY A;  3P5O A;  4QUT A;  3U5L A;  4LRG A;  3N9L A;  2VJF A;  5L98 A;  3UV5 A;  2CRR A;  4TKP B;  4YYD A;  5CUE A;  5LKT A;  1F62 A;  5A5N A;  2XOY A;  4RVR A;  4N4I A;  4PCI A;  3HCT A;  5F60 A;  3EB6 A;  5DLX A;  2YUR A;  4NUC A;  5KO4 A;  5LUU A;  5DFC A;  5C4Q A;  2KRE A;  2KWN A;  4R7E A;  5TRB A;  1ZKR A;  4O74 A;  5ENJ A;  1WEQ A;  2I8N A;  4XYA A;  3RCW A;  2P57 A;  4FO9 A;  5SVY A;  5F3A A;  5E9V A;  3O37 A;  3HMH A;  3N9M A;  3T6R A;  4C67 A;  2M1R A;  5HJC A;  1WEP A;  2JUN A;  4R8P K;  4UIU A;  5B8D A;  5AME A;  4A9L A;  5SVI A;  4QSW A;  5COI A;  4GPJ A;  4YYJ A;  4QR4 A;  2R0Y A;  2VPG A;  4GNG A;  5CQ4 A;  4CUP A;  5TB6 A;  5DYA A;  4MEN A;  5DKD A;  1N87 A;  2CKL A;  2D82 A;  4V3L C;  3KDE C;  5DYX A;  2DVV A;  3V43 A;  5TCM A;  5CQ3 A;  1MM2 A;  2B0O E;  5TDW A;  4N4F A;  4YYG A;  4QYD A;  2CRW A;  5FB1 A;  2KE1 A;  2L43 A;  2IDA A;  2KFT A;  2M13 A;  2OWA A;  4X3G A;  4LYW A;  4NYX A;  5CZG A;  4Q0O A;  4Y03 A;  3U5J A;  5J0D A;  2D8U A;  4QC3 A;  4YK0 A;  4BHW A;  3VKG A;  3SVG A;  1DVP A;  4KV1 A;  5FG6 A;  4IC3 A;  4LK9 A;  3DQV R;  5D3H A;  5EPB A;  5KTW A;  1MM3 A;  5AMF A;  3S92 A;  5I40 A;  4OUF A;  2JM3 A;  5DW2 A;  5DW1 A;  1ZBD B;  2EJN A;  4J3I A;  5L8T A;  3ERR A;  3MB3 A;  1WEN A;  4CCG X;  5CTL A;  5ENG A;  4YY4 A;  2XEU A;  4O76 A;  3O33 A;  2BAY A;  4QYL A;  4B7Y C;  4S3O B;  2XP0 A;  2YEM A;  2VPB A;  3L1X A;  4GNF A;  4NR7 A;  3HMF A;  5CY9 A;  5CQA A;  5DBM A;  3ZTG A;  3MDB C;  4QSS A;  4E96 A;  3PLW A;  4QSV A;  3N9O A;  4BW4 A;  5D25 A;  4P5O B;  4TZ2 A;  4CFK A;  4J0S A;  5ENI A;  5FBX A;  4ALH A;  3MUK A;  1X0J A;  3Q2E A;  4HXR A;  5HFQ A;  2YRE A;  5DFD A;  3RPG B;  4O72 A;  4PKL A;  5C87 A;  1WES A;  5FFY A;  5ENC A;  4YY6 A;  3U5P A;  1FP0 A;  5FB0 A;  4NRA A;  2YW5 A;  3SOW A;  5CQ7 A;  5IGK A;  4A4B A;  3ONI A;  2I50 A;  4XI1 A;  5D26 A;  4QSR A;  2LGK A;  5IGL A;  3FM8 C;  3ZVY A;  5CUG A;  4LKA A;  4QST A;  5EGU A;  5E9K A;  3P1F A;  4LAD B;  4QSU A;  4QC1 A;  5D3L A;  5I80 A;  3FAO A;  2MT5 A;  2K17 A;  5E7D A;  5HQ7 A;  5FE1 A;  2RNW A;  4TU6 A;  2VJF B;  4TYL A;  1DCQ A;  3ZNI A;  2YYN A;  3K2J A;  4O71 A;  1RMD A;  4N4G A;  5EI4 A;  2CSY A;  5IID A;  4Z1S A;  5FE6 A;  5CP5 A;  5II1 A;  4UIV A;  5BT5 A;  1BOR A;  2CSV A;  2OO1 A;  3JVL A;  2E61 A;  2KWK A;  4YBM A;  3LVR E;  4NUD A;  4N4H A;  5CUC A;  3NG2 A;  3O70 A;  3I3J A;  4UP0 A;  4O77 A;  5E74 A;  4HXK A;  2YEK A;  4YH4 A;  5J3X A;  2JMD A;  2R0V A;  5TDR A;  4LC2 A;  5KTX A;  1HYJ A;  4TZ8 A;  4A49 A;  2YU4 A;  3HME A;  2HDP A;  5ETB A;  5II2 A;  3RTR B;  2L85 A;  5CQ6 A;  5HRV A;  5SVI B;  3DAI A;  2N9G A;  1JSP B;  4YAT A;  4F1P A;  4ZQL A;  4GND A;  2M6M A;  5EYA F;  5CRM A;  5BT3 A;  5H1T A;  5D3N A;  2CKL B;  4XY8 A;  5EU1 A;  5D0C A;  2QIZ A;  2RNX A;  5FE0 A;  5EPS A;  4HBV A;  4CFL A;  5EV9 A;  2LRI C;  4O7B A;  5DX4 A;  4PCE A;  2ECI A;  5C11 A;  1IYM A;  4LYI A;  4HBX A;  4O75 A;  5IG6 A;  2L7P A;  3FEH A;  4AVX A;  4A9F A;  4QNS A;  5A81 A;  2YEL A;  2YQD A;  4LZS A;  5HFR A;  4A9K A;  5EWW A;  4CUT A;  5FFV A;  1G25 A;  3SOU A;  4MR6 A;  1WIM A;  4UYF B;  5D3P A;  5EWD A;  5DYC A;  3MUL A;  2ECN A;  1HYI A;  2QIC A;  4AYC B;  4NYW A;  2MJV B;  4CUR A;  2XB1 A;  1V87 A;  4MEQ A;  4I7C A;  3FAN A;  2RS9 B;  4OGC A; 
#chains in the Genus database with same CATH homology
 4QSP A;  5DYU A;  5E3G A;  2RFJ A;  4IR4 A;  3UVX A;  5C8G A;  4CUS A;  4NR6 A;  4WZ2 A;  3VK6 A;  4MR3 A;  2D9E A;  4FLP A;  5EM3 A;  2F42 A;  1X4J A;  5AIT A;  4LLB A;  4YC9 A;  5FH7 A;  2K1J A;  4UYD A;  4HXN A;  4LZ2 A;  5B79 A;  5B77 A;  4TT2 A;  3QZS A;  2H0D B;  1WEV A;  4YYM A;  2G45 A;  4XUA A;  4ZC9 A;  3LQI A;  3D7C A;  2Y1M A;  4BW1 A;  5FG5 A;  1JM7 A;  4BW3 A;  3FKM X;  3ZYQ A;  5B78 A;  4HBY A;  4KV4 A;  5C13 A;  2YW8 A;  4XY9 A;  4YYI A;  1JM4 B;  4Z93 A;  5EIS A;  1T1H A;  4O7C A;  1WEU A;  3C6W A;  5E0R A;  4WZ0 A;  2WP1 A;  3UV4 A;  4HBW A;  3S91 A;  2YSJ A;  4BBQ A;  1WE9 A;  5G04 B;  5LJ1 A;  5D24 A;  1VYX A;  5EK9 A;  3KNV A;  4QEW A;  3M99 A;  3LXJ A;  2EGP A;  4FK5 A;  5E9M A;  2F6N A;  3IU6 A;  2E6R A;  4CLB A;  3EB5 A;  3HCS A;  2DAT A;  5D3T A;  5EPR A;  4UIW A;  4A9O A;  4OGJ A;  5EWH A;  2VJE A;  3O7A A;  3U5O A;  2YQM A;  5IGM A;  1LDK C;  2MA5 A;  5CPE A;  4YAD A;  4BJX A;  5A5O A;  3LQJ A;  1WEO A;  5CQ8 A;  5H1U A;  4YAB A;  3DWY A;  2R0S A;  1E4U A;  5F62 A;  5F61 A;  4CL9 A;  2RO1 A;  5E9Y A;  4PY6 A;  4MVT A;  4O78 A;  5CQT A;  2JMI A;  4MEO A;  4WHU A;  5CS8 A;  4CUU A;  4YH3 A;  2VP7 A;  5H1V A;  4QEV A;  4Z6H A;  3SOX A;  5DY7 A;  5D7X A;  5FE3 A;  2Y1N A;  5FE8 A;  1K2F A;  4PPE A;  4S3O C;  4A0C D;  5FE7 A;  4NRB A;  4HXO A;  2M85 A;  2KWO A;  2ECW A;  4YBS A;  4OGI A;  3QZV A;  2VNF A;  4O70 A;  4UIY A;  3I2D A;  5CRZ A;  4LZR A;  4WA6 A;  2ECJ A;  5FG4 A;  2MNY A;  3RPG C;  5FH6 A;  2MNZ A;  5DFB A;  5KH7 A;  3JVJ A;  3TLP A;  2KGG A;  5EA1 A;  4UIZ A;  4F3I A;  4CA1 A;  3N9P A;  2ECG A;  5LKU A;  4Q0N A;  5DLZ A;  2OXQ C;  5ENF A;  3U5M A;  4IOR A;  1EQF A;  3SVF A;  2ZET C;  2LV9 A;  2MUM A;  3HTK C;  4L58 A;  4WHW A;  4B86 C;  4ALG A;  4UYH A;  2M3H A;  4NR4 A;  2DVS A;  4MSX A;  5FEY A;  4HXM A;  2L5E A;  3UW9 A;  1Z60 A;  5DIN A;  4A4C A;  5A85 A;  3MQM A;  1CHC A;  2R10 A;  5FE5 A;  4ZDT A;  2CSZ A;  5G4S A;  5CU8 A;  5TAB A;  2YT5 A;  5DKH A;  4XUB A;  5HRW A;  3QZT A;  3O34 A;  4KCX A;  5F1H A;  3O35 A;  5HEL A;  3P1C A;  4CUQ A;  5HRX A;  5A83 A;  2RI7 A;  5LVQ A;  2G6Q A;  5I3L A;  4LYS A;  2LXP C;  5I83 A;  2LN0 A;  4QUU A;  4NQM A;  2OSS A;  2Y43 A;  1JM7 B;  3JVK A;  4HXP A;  5H85 A;  3G0J A;  4QSX A;  2LGV A;  4YAX A;  2UZG A;  5AIU A;  4NUE A;  1WGM A;  2KU3 A;  3GG3 A;  4NYV A;  4A9N A;  5CUA A;  4QR3 A;  5LJ0 A;  4IR6 A;  5FH8 A;  3L11 A;  2WP2 A;  5JWM A;  4ZW1 A;  2E6S A;  4AP4 A;  4YYH A;  1WUM A;  4J0R A;  2MA6 A;  4QF3 A;  2G4A A;  2EA6 A;  5L8U A;  3PUR A;  4UI9 B;  5I7X A;  4UYE A;  2VPE A;  4N3W A;  2I7K A;  4NR9 A;  4PS5 A;  3ZPV 1;  1WUG A;  4C66 A;  4PTB A;  3HCU A;  2E7O A;  4AKN A;  4MEP A;  4NRC A;  1WEW A;  4WZ3 B;  5ETD A;  4NN2 A;  2YQL A;  3MHH A;  5ENH A;  4BW2 A;  3GV4 A;  4ZUX U;  4FJC A;  2VJE B;  5KH3 A;  5I29 A;  5LKX A;  3MHS A;  3JVM A;  3IU5 A;  4TU4 A;  2YUC A;  5F5Z A;  4QB3 A;  5K29 A;  4HXS A;  5LVR A;  5EWC A;  4IR3 A;  5HQ5 A;  2PNX A;  2KIZ A;  2JMJ A;  2DX8 A;  5F63 A;  4I7B A;  3MB4 A;  1WFK A;  5B75 A;  3G0L A;  2NXB A;  4A9I A;  5FDZ A;  2K16 A;  2LGL A;  3M62 A;  3PUQ A;  5I7Y A;  2E3K A;  2H60 A;  3GL6 A;  5CQ5 A;  3U5K A;  3T7L A;  3AAD A;  2KYU A;  5E73 A;  3P1D A;  4LDF A;  5F25 A;  4C9Z A;  4TQN A;  4J1P A;  5HQ6 A;  5I86 A;  5G05 B;  3IHP A;  2MIQ A;  5D3S A;  3ZVZ B;  4GB0 A;  2L84 A;  5CFW A;  5KH9 A;  1N72 A;  4IOO A;  4MR5 A;  4YBT A;  5C85 A;  3PHD A;  4QEU A;  5D3R A;  4LJN A;  4UP5 A;  4O7A A;  5FE4 A;  5FE9 A;  2GRC A;  2LGG A;  5JG6 A;  5LKZ A;  1WEM A;  2E7N A;  5CGP A;  2KWJ A;  5D3J A;  4GNE A;  4A9E A;  4LR6 A;  3FL2 A;  4Z1Q A;  2YSM A;  5ACY A;  4W4U A;  5LCW B;  5AD2 A;  4FIP A;  3KQI A;  5D1K B;  4DON A;  2JRJ A;  3Q2F A;  1E6I A;  2NAA A;  4HXL A;  1FBV A;  3ASL A;  4TT6 A;  2D8S A;  3N9N A;  3LJW A;  4YYN A;  2DVQ A;  3P1E A;  3LQH A;  4UYF A;  4WIV A;  5HM0 A;  4UIX A;  5KHM A;  5A82 A;  4AYC A;  5D1M B;  5HCL A;  4NS5 A;  2F6J A;  5A5R A;  4NQN A;  2CT2 A;  2QJ0 A;  4YYK A;  4NR5 A;  4V3K C;  2FUU A;  2MD8 C;  5LJ2 A;  5EWV A;  2L0B A;  1ZS5 A;  4UIT A;  2OUO A;  2RSD A;  1XWH A;  1WEE A;  4F52 B;  3N9Q A;  1X4I A;  4QY4 A;  4A9J A;  5G4R A;  5F1L A;  5BT4 A;  5DKC A;  5E9L A;  4X2I A;  5A5P A;  2YHO A;  1LDJ B;  2LXH C;  4AUQ B;  2H0D A;  4IOQ A;  2MD7 B;  5EVA A;  2G43 A;  2YDW A;  5E3D A;  4O64 A;  5JI8 A;  3C5K A;  3SHB A;  5I89 A;  4L7X A;  5A7C A;  5L99 A;  4Q6F A;  5IBN A;  3KV5 A;  5G0F A;  2DWW A;  2L80 A;  5ENB A;  4TTE A;  5KU3 A;  4IC2 A;  2DVR A;  2L75 A;  5F2P A;  2LDR A;  4Z6I A;  4A9H A;  4O7E A;  4QSQ A;  5KTU A;  4TS8 A;  4TT4 A;  3ZYU A;  5ENE A;  2KR4 A;  3UV2 A;  1F68 A;  2VPD A;  5EP7 A;  5FE2 A;  5I1Q A;  3O36 A;  3AQA A;  2LQ6 A;  5F36 A;  1U6G B;  3DPL R;  5FFW A;  2ECT A;  5CUB A;  2YHN A;  4QF2 A;  2L5U A;  1JOC A;  5EQ1 A;  2AN6 A;  3LRQ A;  4QR5 A;  3UVW A;  5H9M A;  5I88 A;  5B76 A;  3UVY A;  2EOD A;  3L1Z B;  3ZPV E;  4NR8 A;  2KGI A;  4I7D A;  4R2Y A;  1VD4 A;  5TBN A;  3MXF A;  2FUI A;  1Z6U A;  5L97 A;  1WIL A;  5C7N A;  5IGN A;  2LSP B;  5D1L B;  2C2V S;  5HEN A;  1X4U A;  3NXB A;  5CUD A;  2PUY A;  4MR4 A;  3UVD A;  4IR5 A;  5A5S A;  5HLS A;  2DKW A;  4QZS A;  2FSA A;  2HYE D;  5EIC A;  4QBM A;  4UYG A;  5C89 A;  4NXJ A;  2ECV A;  5E9I A;  2YYR A;  2K4D A;  4O7F A;  5L96 A;  3M63 A;  5FER A;  3U5N A;  5DKA A;  5HEM A;  1Z2Q A;  3KV6 A;  2RNY A;  5A5Q A;  3SVH A;  2C2L A;  2KTB B;  5AD3 A;  4A9M A;  1VFY A;  3P5O A;  4QUT A;  3U5L A;  4LRG A;  3N9L A;  2VJF A;  5L98 A;  3UV5 A;  4TKP B;  4YYD A;  5CUE A;  5LKT A;  1F62 A;  5A5N A;  4RVR A;  4N4I A;  4PCI A;  3HCT A;  5F60 A;  3EB6 A;  5DLX A;  2YUR A;  4NUC A;  5KO4 A;  5LUU A;  5DFC A;  5C4Q A;  2KRE A;  2KWN A;  4R7E A;  5TRB A;  5ENJ A;  4O74 A;  1WEQ A;  2I8N A;  4XYA A;  3RCW A;  4FO9 A;  5F3A A;  5E9V A;  3O37 A;  3HMH A;  3N9M A;  3T6R A;  4C67 A;  2M1R A;  5HJC A;  1WEP A;  4R8P K;  4UIU A;  5B8D A;  5AME A;  4A9L A;  4QSW A;  5COI A;  4GPJ A;  4YYJ A;  4QR4 A;  2R0Y A;  2VPG A;  4GNG A;  5CQ4 A;  4CUP A;  5TB6 A;  5DYA A;  4MEN A;  5DKD A;  1N87 A;  2CKL A;  2D82 A;  4V3L C;  5DYX A;  2DVV A;  3V43 A;  5TCM A;  5CQ3 A;  1MM2 A;  5TDW A;  4N4F A;  4YYG A;  4QYD A;  5FB1 A;  2KE1 A;  2L43 A;  2IDA A;  2KFT A;  4X3G A;  4LYW A;  4NYX A;  5CZG A;  4Q0O A;  4Y03 A;  3U5J A;  5J0D A;  4QC3 A;  4YK0 A;  4BHW A;  3SVG A;  1DVP A;  4KV1 A;  5FG6 A;  4IC3 A;  4LK9 A;  3DQV R;  5D3H A;  5EPB A;  5KTW A;  1MM3 A;  5AMF A;  3S92 A;  5I40 A;  4OUF A;  5DW2 A;  5DW1 A;  1ZBD B;  4J3I A;  5L8T A;  3MB3 A;  1WEN A;  4CCG X;  5CTL A;  5ENG A;  4YY4 A;  2XEU A;  4O76 A;  3O33 A;  2BAY A;  4QYL A;  4B7Y C;  4S3O B;  3L1X A;  2YEM A;  2VPB A;  4GNF A;  4NR7 A;  3HMF A;  5CY9 A;  5CQA A;  5DBM A;  3ZTG A;  4QSS A;  4E96 A;  4QSV A;  3N9O A;  4BW4 A;  5D25 A;  4P5O B;  4TZ2 A;  4CFK A;  4J0S A;  5ENI A;  5FBX A;  4ALH A;  3MUK A;  1X0J A;  3Q2E A;  4HXR A;  5HFQ A;  2YRE A;  5DFD A;  3RPG B;  4O72 A;  4PKL A;  5C87 A;  1WES A;  5FFY A;  5ENC A;  4YY6 A;  3U5P A;  1FP0 A;  5FB0 A;  4NRA A;  2YW5 A;  3SOW A;  5CQ7 A;  5IGK A;  4A4B A;  3ONI A;  2I50 A;  4XI1 A;  5D26 A;  4QSR A;  2LGK A;  5IGL A;  3ZVY A;  5CUG A;  4LKA A;  4QST A;  5EGU A;  5E9K A;  3P1F A;  4LAD B;  4QSU A;  4QC1 A;  5D3L A;  5I80 A;  2MT5 A;  2K17 A;  5E7D A;  5HQ7 A;  5FE1 A;  2RNW A;  4TU6 A;  2VJF B;  4TYL A;  3ZNI A;  2YYN A;  3K2J A;  4O71 A;  1RMD A;  4N4G A;  5EI4 A;  2CSY A;  5IID A;  4Z1S A;  5FE6 A;  5CP5 A;  5II1 A;  4UIV A;  5BT5 A;  1BOR A;  2OO1 A;  3JVL A;  2KWK A;  3NG2 A;  4YBM A;  4NUD A;  4N4H A;  5CUC A;  3O70 A;  3I3J A;  4UP0 A;  4O77 A;  5E74 A;  4HXK A;  2YEK A;  4YH4 A;  5J3X A;  2JMD A;  2R0V A;  5TDR A;  4LC2 A;  5KTX A;  1HYJ A;  4TZ8 A;  4A49 A;  2YU4 A;  3HME A;  2HDP A;  5ETB A;  5II2 A;  3RTR B;  2L85 A;  5CQ6 A;  5HRV A;  3DAI A;  2N9G A;  1JSP B;  4YAT A;  4ZQL A;  4GND A;  2M6M A;  5EYA F;  5CRM A;  5BT3 A;  5H1T A;  5D3N A;  2CKL B;  4XY8 A;  5EU1 A;  5D0C A;  2QIZ A;  2RNX A;  5FE0 A;  5EPS A;  4HBV A;  4CFL A;  5EV9 A;  2LRI C;  4O7B A;  5DX4 A;  4PCE A;  2ECI A;  5C11 A;  1IYM A;  4LYI A;  4HBX A;  4O75 A;  5IG6 A;  4AVX A;  4A9F A;  4QNS A;  5A81 A;  2YEL A;  2YQD A;  4LZS A;  5HFR A;  4A9K A;  5EWW A;  4CUT A;  5FFV A;  1G25 A;  3SOU A;  4MR6 A;  1WIM A;  4UYF B;  5D3P A;  5EWD A;  5DYC A;  3MUL A;  2ECN A;  1HYI A;  2QIC A;  4AYC B;  4NYW A;  2MJV B;  4CUR A;  2XB1 A;  1V87 A;  4MEQ A;  4I7C A;  2RS9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...