4ZQLA

Crystal structure of trim24 with 3,4-dimethoxy-n-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
177
Chain Sequence
MNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of TRIM24 with 3,4-dimethoxy-N-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription intermediary factor 1-alpha
total genus 49
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4zqlA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4zqlA01
5EK9A 5E7DA 5F3AA 2KFTA 3PHDA 4A9IA 2KWOA 2QICA 3N9PA 5CS8A 5L8TA 3T7LA 5A5PA 4MENA 5FFWA 2WP2A 5FG6A 2DX8A 1XWHA 5BT4A 4BHWA 2DVVA 2DATA 5A5SA 3SVFA 4GPJA 4DONA 4Z1QA 1E4UA 1VFYA 4NR9A 1E6IA 5EVAA 2E6RA 5DX4A 3KNVA 4KV1A 5I88A 3U5MA 4MEOA 4UYDA 4N4IA 4IC2A 5D3TA 1V87A 5E9LA 4YYGA 1VYXA 2KGIA 2Y1MA 2RNWA 3MUKA 3MULA 4QSSA 5DFDA 2N9GA 3AQAA 3K2JA 5EWCA 4UYFB 2FUUA 2Y1NA 5AITA 4CCGX 5CUGA 2L84A 3Q2FA 4MEPA 4OGJA 5G4SA 4A9KA 5E3DA 3RPGB 5C13A 3MB3A 2XEUA 1WGMA 3LXJA 4O71A 5EPRA 3GG3A 3U5KA 4TZ8A 5F61A 4CURA 2XB1A 5F63A 4Z1SA 4IOOA 4LZSA 4UYGA 1WEUA 2R0VA 2D9EA 5E9IA 5TB6A 4YBSA 1JM7B 5CQ3A 2K16A 2LV9A 2ECVA 5FE9A 4QF2A 5LJ1A 4IR5A 2K4DA 2Y43A 4UYEA 3HMFA 4TS8A 4Y03A 4YYNA 5B78A 1Z6UA 3JVJA 3DPLR 4MVTA 3RTRB 5EQ1A 4YABA 5EPSA 3ZYQA 4V3LC 4PTBA 4PS5A 3ONIA 4YBMA 1WEWA 5JG6A 1Z2QA 1F68A 4GNFA 4XI1A 4QSPA 5DKDA 4MR4A 1N72A 1WUGA 3QZSA 5KH9A 4NYXA 5I86A 4NR8A 5DYXA 2MJVB 4O77A 2YREA 5A82A 3QZTA 5FE1A 4QEWA 3UV5A 3C5KA 3MB4A 3ZVZB 4A9HA 2L43A 3N9MA 1MM2A 4OGIA 4WIVA 5D1MB 5FH7A 3AADA 5EWDA 5G05B 3O33A 4J3IA 4L7XA 4HBXA 4A9JA 2IDAA 3M62A 2DVQA 5I3LA 4NS5A 5HELA 4UITA 4HXRA 3HCUA 4O70A 4TZ2A 2OXQC 4XUAA 5B76A 4N4FA 4XY9A 3FL2A 1DVPA 5G04B 4IR6A 2YDWA 4J1PA 3T6RA 4AYCA 5ETDA 2LDRA 4O7CA 4LYSA 5ENHA 1X4UA 5CUEA 3DQVR 3UVYA 2OSSA 2F42A 3IHPA 3N9QA 5CFWA 2EODA 4LKAA 5C8GA 2OO1A 4NXJA 3IU6A 4O7FA 1WEEA 5EU1A 4R8PK 4HBWA 4O76A 4V3KC 4QBMA 4YY6A 3L1XA 4LDFA 4LYIA 4NUCA 2K17A 3LQHA 4YH3A 4WZ2A 5C89A 1FBVA 5G0FA 4O7AA 2YYRA 4QSTA 2LGKA 3UW9A 2MT5A 2QJ0A 2D82A 4QEVA 1MM3A 5IIDA 5KO4A 1ZS5A 4AYCB 3ASLA 5CQ5A 2I8NA 3FKMX 4QEUA 3SOWA 4Z93A 5L8UA 5CTLA 3L11A 4BW2A 2LGVA 5D3SA 5FB1A 3ZYUA 2VPEA 5DKAA 4LR6A 5IGLA 2FSAA 2F6NA 3PUQA 5COIA 4B86C 5HENA 2KYUA 4O74A 2KE1A 2KU3A 1FP0A 2VPGA 4TYLA 5DW2A 3IU5A 5H9MA 3JVKA 5A85A 5KTWA 4QSWA 4LJNA 4A9EA 3JVLA 2JMJA 5JI8A 5EWHA 4A9NA 2YHOA 1F62A 5HM0A 4O7BA 1WUMA 4A9LA 3KV5A 4HXSA 5F60A 2C2LA 3SVHA 2YQDA 2BAYA 5A5QA 2KIZA 5CQ8A 3ZPVE 4NRAA 1RMDA 1WIMA 5TABA 5LKTA 4NQMA 4NUEA 3N9LA 4R7EA 4QUTA 5KH3A 4TU4A 5BT3A 4HXLA 3I3JA 5FG4A 4TT4A 5EGUA 4GNDA 2MNYA 2ECTA 5IBNA 3U5JA 5ENJA 5I89A 3O37A 2R0SA 2LXPC 3SOXA 3LRQA 4J0RA 2E7OA 5I40A 4AP4A 4IR3A 5B75A 5E9MA 5DINA 2L5EA 4CFLA 3UVDA 4QSVA 1WEMA 2KTBB 3NXBA 4KCXA 5LVQA 2MA6A 5LVRA 3I2DA 4FK5A 4A9MA 3ZNIA 5D0CA 4CLBA 4ZQLA 3MXFA 1WILA 2EA6A 5ETBA 1BORA 4YYMA 2YW5A 5TDRA 4F52B 3MHSA 4PY6A 3Q2EA 2VJEA 2C2VS 4MSXA 2JRJA 2YQMA 5L99A 5FERA 2LN0A 4WZ3B 5DLZA 5LJ0A 2YQLA 4LK9A 5KH7A 4F3IA 3ZVYA 5BT5A 5F36A 5ENCA 3UVXA 1WENA 5FFYA 5HQ7A 5LKZA 2JMDA 5IG6A 5B8DA 1WEPA 3P5OA 4BW1A 4BW3A 1U6GB 2ECGA 2HDPA 5H85A 2NAAA 4UI9B 2I7KA 4QR5A 5CUDA 2UZGA 5LKXA 4N4HA 3HTKC 5EWWA 5II1A 1WEVA 4AUQB 2E7NA 4NR4A 5ENBA 3U5NA 3GL6A 3P1DA 5DYAA 2YURA 3DWYA 5HLSA 2RSDA 4NR7A 4UIYA 5L97A 1K2FA 5LKUA 2RI7A 4WA6A 4QSQA 3U5OA 4YAXA 5B77A 5D26A 4FJCA 4MR5A 3DAIA 4TT2A 2YHNA 2DWWA 2KWNA 5TDWA 4WHUA 5HFQA 5D3PA 1IYMA 3P1FA 3KV6A 5HRXA 3TLPA 2MNZA 2VJFA 2RO1A 2RS9B 3SOUA 4L58A 2LQ6A 2KWJA 5FH8A 1X4JA 2KWKA 4A4CA 4A0CD 1JOCA 5FE5A 2H0DA 4LZ2A 5AIUA 5HRVA 4XYAA 5FBXA 4WZ0A 2I50A 2FUIA 4QSRA 5F1LA 2OUOA 5CP5A 2R10A 5E3GA 4C9ZA 3HCTA 2YW8A 4YC9A 2HYED 5HJCA 4QB3A 5DKCA 2ECNA 4WHWA 2VP7A 5A5OA 2M1RA 3SVGA 4C66A 2L85A 4CL9A 4NYVA 4I7DA 3ZPV1 4HXNA 2ECJA 5HCLA 4YYIA 2MD8C 5KTXA 5H1VA 4W4UA 4B7YC 3NG2A 5ENEA 2JMIA 5CUBA 4UYFA 5G4RA 3O35A 5C87A 2L5UA 5D7XA 3M99A 4IORA 5DKHA 2CKLB 4A49A 2RFJA 5CGPA 4AVXA 4HBVA 5TBNA 4FO9A 4HXMA 3D7CA 5FE4A 4TT6A 2F6JA 5J3XA 2L75A 4GB0A 2LGLA 4UP0A 5I29A 5CQAA 5I80A 4HXPA 4CUUA 4TU6A 4CUQA 1WEOA 3SHBA 2MA5A 3UVWA 4NRBA 4QF3A 2KGGA 5I1QA 4X3GA 2VNFA 4ZW1A 5CUAA 3U5PA 4QY4A 5EPBA 4CFKA 3RPGC 4TKPB 1G25A 4LADB 4E96A 1LDJB 5FDZA 3JVMA 5F5ZA 4MR6A 3UV2A 4R2YA 4IOQA 2YEMA 5D25A 5F1HA 1T1HA 5E0RA 3PURA 3V43A 5C85A 5CU8A 4Z6IA 2G4AA 4N3WA 5AMFA 2YEKA 2YYNA 4LC2A 2CKLA 4ALGA 4I7BA 5DY7A 2YT5A 5DYCA 5IGMA 2LXHC 5H1UA 2EGPA 2L0BA 4MR3A 3O7AA 4TQNA 2M85A 4YYDA 2M6MA 4QYDA 2ECWA 2MD7B 4O72A 4QZSA 2R0YA 5C11A 2YUCA 3P1EA 4QNSA 1Z60A 4NUDA 4X2IA 5CY9A 2MUMA 3G0LA 1WE9A 4CUSA 5D3LA 4QUUA 5CZGA 5I83A 2M3HA 5LJ2A 2MIQA 4NYWA 3VK6A 5A5RA 5EP7A 5KTUA 4Z6HA 4A9OA 3L1ZB 5HRWA 4QSUA 4C67A 2RNYA 5ACYA 2CSYA 5TCMA 5FEYA 5E9VA 4O75A 5FE6A 5DBMA 4NRCA 3O36A 2G43A 3M63A 1HYIA 3G0JA 5FH6A 5C4QA 5ENIA 4BBQA 4UIVA 3LJWA 5D3JA 1EQFA 2RNXA 5EM3A 5F2PA 2YELA 5D1LB 5JWMA 5EYAF 4J0SA 5IGNA 4O78A 4YYKA 4XUBA 5LUUA 4CA1A 1CHCA 2VPBA 4AKNA 5CRMA 1VD4A 4LZRA 4YH4A 5CQ7A 1LDKC 4YATA 4YY4A 5EISA 1X4IA 4UIXA 5IGKA 2G6QA 4S3OC 3ZTGA 2E6SA 4IR4A 5FE0A 4ALHA 3EB6A 5D1KB 4YBTA 3UV4A 4HXKA 4PKLA 5EICA 3C6WA 4O7EA 3MHHA 4ZUXU 2AN6A 1N87A 4Q0OA 5TRBA 2H0DB 3U5LA 2CT2A 5B79A 3N9OA 5H1TA 5EI4A 3HCSA 5EWVA 5E9YA 2VJEB 5HFRA 3N9NA 4ZC9A 5CRZA 2LRIC 1X0JA 5HEMA 5CPEA 4NQNA 4QC1A 4Q0NA 2H60A 5D3NA 4TTEA 4YYHA 2ZETC 4LLBA 5F25A 2WP1A 4A9FA 4S3OB 5DFBA 4Q6FA 5AD3A 1HYJA 3MQMA 4QSXA 5I7YA 3HMEA 5AMEA 4PPEA 4NR5A 4CUPA 5F62A 2DKWA 3S92A 3O70A 5D24A 5DLXA 5FFVA 5E73A 4CUTA 5E9KA 2KR4A 3GV4A 2LGGA 4QC3A 4GNEA 2L80A 4UIUA 4OUFA 3HMHA 5A81A 1WESA 2YU4A 4UYHA 4ZDTA 5CUCA 2ECIA 4YYJA 2LSPB 3RCWA 5AD2A 4MEQA 5A83A 3LQIA 5A7CA 2YSJA 4I7CA 4KV4A 5J0DA 5FE2A 4PCEA 5FE7A 1WEQA 5FG5A 2CSZA 4FIPA 5D3RA 2G45A 1ZBDB 5L96A 4HBYA 4XY8A 5HQ5A 1JSPB 4LYWA 3O34A 4QR4A 5FE3A 5FE8A 4FLPA 1JM7A 2PNXA 5DFCA 5FB0A 2KREA 5CQ4A 2YSMA 3KQIA 5E74A 4NN2A 4RVRA 2DVRA 2GRCA 4UIWA 4BW4A 4P5OB 1JM4B 3EB5A 2K1JA 5K29A 4NR6A 5L98A 5CQ6A 5ENFA 3LQJA 2DVSA 4YADA 5A5NA 2D8SA 4QR3A 4N4GA 5II2A 5D3HA 5I7XA 4IC3A 5LCWB 4O64A 5ENGA 4LRGA 4BJXA 5HQ6A 4A4BA 5KHMA 2VPDA 5EA1A 2QIZA 2PUYA 5DW1A 5C7NA 4HXOA 1WFKA 4PCIA 3S91A 3P1CA 4UIZA 5KU3A 4GNGA 2E3KA 4YK0A 5EV9A 2VJFB 4UP5A 2NXBA 4QYLA 5DYUA 3QZVA 5CQTA
chains in the Genus database with same CATH superfamily
5EK9A 5E7DA 5F3AA 2KFTA 3PHDA 4A9IA 2FD4A 3Q1DA 2KWOA 2QICA 3N9PA 5CS8A 3LVQE 5L8TA 3T7LA 5A5PA 4MENA 5FFWA 2WP2A 5FG6A 3LVRE 2DX8A 3PLWA 1XWHA 5BT4A 4BHWA 2DVVA 2DATA 5A5SA 3SVFA 4GPJA 4OGEA 4DONA 4Z1QA 1E4UA 1VFYA 4NR9A 4OGCA 1E6IA 5EVAA 2E6RA 5DX4A 3KNVA 4KV1A 5I88A 3U5MA 4MEOA 4UYDA 4N4IA 4IC2A 5D3TA 1V87A 5E9LA 4YYGA 1VYXA 2KGIA 2Y1MA 2RNWA 3MUKA 3MULA 4QSSA 5DFDA 2N9GA 3AQAA 3K2JA 5EWCA 4UYFB 2FUUA 2Y1NA 5AITA 4CCGX 5CUGA 2L84A 3Q2FA 4MEPA 4OGJA 5G4SA 4A9KA 2OWAA 5E3DA 3RPGB 5C13A 3MB3A 2XEUA 1WGMA 3LXJA 4O71A 5EPRA 3GG3A 3U5KA 4TZ8A 5F61A 4CURA 2XB1A 5F63A 4Z1SA 4IOOA 4LZSA 4UYGA 1WEUA 2R0VA 2D9EA 5E9IA 5TB6A 4YBSA 1JM7B 5CQ3A 2K16A 2LV9A 2ECVA 5FE9A 4QF2A 5LJ1A 4IR5A 2K4DA 2Y43A 4UYEA 3HMFA 4TS8A 4Y03A 2XOCA 4YYNA 5B78A 1Z6UA 3JVJA 3DPLR 3JUEA 4MVTA 5EQ1A 4YABA 3RTRB 5EPSA 3ZYQA 4V3LC 4PTBA 4PS5A 3ONIA 4YBMA 1WEWA 5JG6A 1Z2QA 1F68A 4GNFA 4XI1A 4QSPA 5DKDA 4MR4A 1N72A 1WUGA 3QZSA 5KH9A 4NYXA 5I86A 2MKEA 4NR8A 5DYXA 2MJVB 4O77A 2YREA 5A82A 3QZTA 5FE1A 4QEWA 3UV5A 3C5KA 3MB4A 3ZVZB 4A9HA 2L43A 3N9MA 1MM2A 4OGIA 4WIVA 5D1MB 5FH7A 3AADA 5EWDA 5G05B 3O33A 4J3IA 4L7XA 4HBXA 4A9JA 2IDAA 3M62A 2DVQA 5I3LA 4NS5A 5HELA 4UITA 4HXRA 3HCUA 4O70A 4TZ2A 2OXQC 4XUAA 5B76A 4N4FA 4XY9A 3FL2A 1DVPA 5G04B 4IR6A 2YDWA 4J1PA 3T6RA 3E2DA 4AYCA 5ETDA 2LDRA 4O7CA 4LYSA 2JM3A 5ENHA 1X4UA 5CUEA 3DQVR 3UVYA 5SVIB 2OSSA 2F42A 3IHPA 3N9QA 5CFWA 2EODA 4LKAA 5C8GA 2OO1A 4NXJA 3IU6A 4O7FA 1WEEA 5EU1A 4R8PK 4HBWA 4O76A 4V3KC 4QBMA 3DDTA 4YY6A 3L1XA 4LDFA 4LYIA 4NUCA 2K17A 3LJUX 3LQHA 4YH3A 4WZ2A 5C89A 1FBVA 5G0FA 4O7AA 2YYRA 4QSTA 2LGKA 3UW9A 2MT5A 2QJ0A 2D82A 3T9KA 4QEVA 2CRWA 1MM3A 5IIDA 5KO4A 1ZS5A 4AYCB 3ASLA 5CQ5A 2I8NA 3FKMX 4QEUA 3SOWA 4Z93A 5L8UA 4AI6A 5CTLA 3L11A 4BW2A 2LGVA 5D3SA 5FB1A 3ZYUA 2VPEA 5DKAA 4LR6A 5IGLA 2FSAA 2F6NA 3PUQA 5COIA 4B86C 5HENA 2CRRA 2KYUA 4O74A 2KE1A 2KU3A 1FP0A 2VPGA 4TYLA 3FM8C 5DW2A 2RR4A 3IU5A 5H9MA 3JVKA 5A85A 5KTWA 4QSWA 4LJNA 4A9EA 3M7KA 3JVLA 2JMJA 5JI8A 5EWHA 4A9NA 2YHOA 1F62A 5HM0A 4O7BA 1WUMA 4A9LA 3KV5A 4HXSA 5F60A 2C2LA 3SVHA 2YQDA 2BAYA 5A5QA 2KIZA 5CQ8A 3ZPVE 4NRAA 1RMDA 1WIMA 5TABA 5LKTA 4NQMA 4NUEA 3N9LA 4R7EA 4QUTA 5KH3A 4TU4A 5BT3A 4HXLA 3I3JA 5FG4A 4TT4A 5EGUA 2P57A 4GNDA 2MNYA 2ECTA 5IBNA 3U5JA 5ENJA 5I89A 3O37A 2R0SA 2LXPC 2L7PA 3SOXA 3LRQA 4J0RA 2E7OA 5I40A 4AP4A 4IR3A 5B75A 5E9MA 5DINA 2L5EA 4CFLA 3UVDA 4QSVA 1WEMA 2KTBB 3NXBA 4KCXA 5LVQA 2B0OE 5LVRA 2MA6A 3I2DA 4A9MA 4FK5A 3ZNIA 5D0CA 4CLBA 4ZQLA 3MXFA 1WILA 2EA6A 5ETBA 1BORA 4YYMA 2YW5A 5TDRA 4F52B 3MHSA 4PY6A 3Q2EA 2VJEA 3FAOA 2C2VS 4MSXA 2JRJA 2YQMA 5L99A 5FERA 2LN0A 4WZ3B 5DLZA 5LJ0A 2YQLA 4LK9A 5KH7A 5SVIA 4F3IA 2DJAA 2EXUA 3ZVYA 5BT5A 5F36A 5ENCA 3UVXA 1WENA 3VKHA 5FFYA 5HQ7A 5LKZA 2JMDA 5IG6A 5B8DA 1WEPA 4Z0OA 3P5OA 4BW1A 4BW3A 1U6GB 2ECGA 2HDPA 5H85A 2NAAA 1ZKRA 4UI9B 2I7KA 4QR5A 5CUDA 2UZGA 5LKXA 4N4HA 3HTKC 5EWWA 5II1A 1WEVA 4AUQB 2E7NA 4NR4A 5ENBA 3U5NA 3GL6A 3P1DA 5DYAA 2YURA 3DWYA 5HLSA 2CSVA 2RSDA 4NR7A 4UIYA 5L97A 1K2FA 5LKUA 2RI7A 4WA6A 4QSQA 3U5OA 4YAXA 2XOZA 5D26A 5B77A 4FJCA 4MR5A 3DAIA 4TT2A 2YHNA 2DWWA 2KWNA 5TDWA 4WHUA 5HFQA 5D3PA 1IYMA 3P1FA 3KV6A 5HRXA 3TLPA 2MNZA 2VJFA 2RO1A 4H9DA 2RS9B 3SOUA 4L58A 2LQ6A 2KWJA 5FH8A 1X4JA 2KWKA 4A4CA 4A0CD 1JOCA 5FE5A 2H0DA 4LZ2A 5AIUA 5HRVA 4XYAA 5FBXA 4WZ0A 2I50A 2D8UA 2FUIA 4QSRA 5F1LA 2OUOA 5CP5A 2R10A 5E3GA 4C9ZA 3HCTA 2YW8A 4YC9A 2HYED 4AKIA 5HJCA 4QB3A 5DKCA 2ECNA 4WHWA 2VP7A 5A5OA 3DWDA 2M1RA 3SVGA 4C66A 2L85A 4CL9A 4NYVA 4I7DA 3ZPV1 4HXNA 2ECJA 5HCLA 4YYIA 2MD8C 5KTXA 5H1VA 1DCQA 4W4UA 4B7YC 3NG2A 5ENEA 3O47A 2JMIA 5CUBA 4UYFA 5G4RA 3O35A 5C87A 1PUOA 2L5UA 5D7XA 3M99A 4IORA 2EJNA 5DKHA 2CKLB 4A49A 2RFJA 5CGPA 3VKGA 4AVXA 4HBVA 5TBNA 4FO9A 4HXMA 3D7CA 5FE4A 4TT6A 2F6JA 5J3XA 2L75A 4GB0A 2LGLA 4UP0A 5I29A 5CQAA 5I80A 4HXPA 4CUUA 4TU6A 4CUQA 1WEOA 3SHBA 2MA5A 3UVWA 3LDYA 3MDBC 4NRBA 4QF3A 2KGGA 5I1QA 4X3GA 2VNFA 3FEHA 4ZW1A 5CUAA 3U5PA 4QY4A 5EPBA 4CFKA 3RPGC 5SVYA 1MBMA 4TKPB 1G25A 4LADB 4E96A 4QQ4A 1LDJB 5FDZA 3JVMA 5F5ZA 4MR6A 3UV2A 4R2YA 4IOQA 2YEMA 5D25A 5F1HA 1T1HA 5E0RA 3PURA 3V43A 5C85A 5CU8A 4Z6IA 2G4AA 4N3WA 5AMFA 2YEKA 2YYNA 4LC2A 2CKLA 2FFWA 3KDEC 4ALGA 4I7BA 3H7HA 5DY7A 2YT5A 5K3QA 5DYCA 5IGMA 2LXHC 5H1UA 2EGPA 2L0BA 4MR3A 3O7AA 4TQNA 2XOYA 2M85A 4YYDA 2M6MA 4QYDA 2ECWA 2MD7B 4O72A 4QZSA 2R0YA 5C11A 2LAUA 2YUCA 3P1EA 4QNSA 1Z60A 4NUDA 4X2IA 5CY9A 2MUMA 3G0LA 1WE9A 4CUSA 5D3LA 4QUUA 5CZGA 5I83A 2M3HA 5LJ2A 2MIQA 2EGMA 4NYWA 2YVRA 3VK6A 5A5RA 5EP7A 5KTUA 4Z6HA 4A9OA 3L1ZB 5HRWA 4QSUA 4C67A 2RNYA 2XP0A 2KKXA 5ACYA 2CSYA 5TCMA 5FEYA 5E9VA 2CONA 4O75A 5FE6A 2M13A 5DBMA 2E61A 4NRCA 3O36A 2G43A 3M63A 1HYIA 3G0JA 5FH6A 5C4QA 5ENIA 4BBQA 4UIVA 3LJWA 5D3JA 1EQFA 2RNXA 5EM3A 5F2PA 2YELA 2JUNA 5JWMA 5D1LB 5EYAF 4Z0RA 4J0SA 5IGNA 4O78A 3ERRA 4YYKA 4XUBA 5LUUA 4CA1A 1CHCA 2VPBA 4AKNA 5CRMA 1VD4A 4LZRA 4YH4A 5CQ7A 1LDKC 4YATA 4YY4A 5EISA 1X4IA 4UIXA 5IGKA 2G6QA 4S3OC 3ZTGA 2E6SA 4IR4A 5FE0A 4AKHA 4ALHA 3EB6A 5D1KB 4YBTA 3UV4A 4HXKA 4PKLA 5EICA 3C6WA 4O7EA 3MHHA 4ZUXU 2AN6A 1N87A 4Q0OA 5TRBA 2H0DB 3U5LA 2CT2A 5B79A 2IQJA 3N9OA 5H1TA 5EI4A 3HCSA 5EWVA 5E9YA 2VJEB 5HFRA 3N9NA 4ZC9A 5CRZA 2LRIC 1X0JA 5HEMA 5CPEA 4NQNA 4QC1A 4Q0NA 2H60A 5D3NA 4TTEA 4YYHA 2ZETC 4LLBA 5F25A 2WP1A 4A9FA 4S3OB 5DFBA 4Q6FA 5AD3A 1HYJA 3MQMA 4QSXA 5I7YA 5SVXA 3HMEA 5AMEA 4O62A 4NR5A 4PPEA 4CUPA 5F62A 2DKWA 3S92A 3O70A 4AKGA 5D24A 5DLXA 5FFVA 5E73A 2DSMA 4CUTA 5E9KA 2KR4A 3GV4A 2LGGA 4QC3A 4GNEA 2L80A 4UIUA 4OUFA 3HMHA 5A81A 1WESA 2YU4A 4UYHA 4ZDTA 5CUCA 2ECIA 4YYJA 2LSPB 3RCWA 5AD2A 4MEQA 5A83A 3LQIA 5A7CA 2YSJA 4I7CA 4KV4A 5J0DA 5FE2A 4PCEA 5FE7A 1WEQA 5FG5A 2CSZA 4FIPA 5D3RA 2G45A 1ZBDB 5L96A 4HBYA 4XY8A 3FJUB 5HQ5A 1JSPB 4LYWA 3O34A 4QR4A 5FE3A 5FE8A 4FLPA 1JM7A 3D1BA 2PNXA 5DFCA 5FB0A 2KREA 5CQ4A 2YSMA 3SUBA 3KQIA 5E74A 4NN2A 4RVRA 2DVRA 2GRCA 4UIWA 4BW4A 4P5OB 1JM4B 2KKYA 3EB5A 2K1JA 5K29A 4NR6A 5L98A 5CQ6A 5ENFA 3LQJA 2DVSA 4YADA 5A5NA 2D8SA 4QR3A 4N4GA 5II2A 5D3HA 5I7XA 4IC3A 5LCWB 4O64A 5ENGA 4LRGA 4BJXA 5HQ6A 4A4BA 5KHMA 2VPDA 5EA1A 2QIZA 2PUYA 5DW1A 5C7NA 4HXOA 1WFKA 4F1PA 4PCIA 3S91A 3P1CA 4UIZA 5KU3A 4GNGA 2E3KA 4YK0A 5EV9A 2VJFB 3FANA 4UP5A 3D1DA 2NXBA 4QYLA 5DYUA 3QZVA 5CQTA
chains in the Genus database with same CATH topology
5EK9A 5E7DA 5F3AA 2KFTA 3PHDA 4A9IA 2KWOA 2QICA 3N9PA 5CS8A 5L8TA 3T7LA 5A5PA 4MENA 5FFWA 2WP2A 5FG6A 2DX8A 1XWHA 5BT4A 4BHWA 2DVVA 2DATA 5A5SA 3SVFA 4GPJA 4DONA 4Z1QA 1E4UA 1VFYA 4NR9A 1E6IA 5EVAA 2E6RA 5DX4A 3KNVA 4KV1A 5I88A 3U5MA 4MEOA 4UYDA 4N4IA 4IC2A 5D3TA 1V87A 5E9LA 4YYGA 1VYXA 2KGIA 2Y1MA 2RNWA 3MUKA 3MULA 4QSSA 5DFDA 2N9GA 3AQAA 3K2JA 5EWCA 4UYFB 2FUUA 2Y1NA 5AITA 4CCGX 5CUGA 2L84A 3Q2FA 4MEPA 4OGJA 5G4SA 4A9KA 5E3DA 3RPGB 5C13A 3MB3A 2XEUA 1WGMA 3LXJA 4O71A 5EPRA 3GG3A 3U5KA 4TZ8A 5F61A 4CURA 2XB1A 5F63A 4Z1SA 4IOOA 4LZSA 4UYGA 1WEUA 2R0VA 2D9EA 5E9IA 5TB6A 4YBSA 1JM7B 5CQ3A 2K16A 2LV9A 2ECVA 5FE9A 4QF2A 5LJ1A 4IR5A 2K4DA 2Y43A 4UYEA 3HMFA 4TS8A 4Y03A 4YYNA 5B78A 1Z6UA 3JVJA 3DPLR 4MVTA 3RTRB 5EQ1A 4YABA 5EPSA 3ZYQA 4V3LC 4PTBA 4PS5A 3ONIA 4YBMA 1WEWA 5JG6A 1Z2QA 1F68A 4GNFA 4XI1A 4QSPA 5DKDA 4MR4A 1N72A 1WUGA 3QZSA 5KH9A 4NYXA 5I86A 4NR8A 5DYXA 2MJVB 4O77A 2YREA 5A82A 3QZTA 5FE1A 4QEWA 3UV5A 3C5KA 3MB4A 3ZVZB 4A9HA 2L43A 3N9MA 1MM2A 4OGIA 4WIVA 5D1MB 5FH7A 3AADA 5EWDA 5G05B 3O33A 4J3IA 4L7XA 4HBXA 4A9JA 2IDAA 3M62A 2DVQA 5I3LA 4NS5A 5HELA 4UITA 4HXRA 3HCUA 4O70A 4TZ2A 2OXQC 4XUAA 5B76A 4N4FA 4XY9A 3FL2A 1DVPA 5G04B 4IR6A 2YDWA 4J1PA 3T6RA 4AYCA 5ETDA 2LDRA 4O7CA 4LYSA 5ENHA 1X4UA 5CUEA 3DQVR 3UVYA 2OSSA 2F42A 3IHPA 3N9QA 5CFWA 2EODA 4LKAA 5C8GA 2OO1A 4NXJA 3IU6A 4O7FA 1WEEA 5EU1A 4R8PK 4HBWA 4O76A 4V3KC 4QBMA 4YY6A 3L1XA 4LDFA 4LYIA 4NUCA 2K17A 3LQHA 4YH3A 4WZ2A 5C89A 1FBVA 5G0FA 4O7AA 2YYRA 4QSTA 2LGKA 3UW9A 2MT5A 2QJ0A 2D82A 4QEVA 1MM3A 5IIDA 5KO4A 1ZS5A 4AYCB 3ASLA 5CQ5A 2I8NA 3FKMX 4QEUA 3SOWA 4Z93A 5L8UA 5CTLA 3L11A 4BW2A 2LGVA 5D3SA 5FB1A 3ZYUA 2VPEA 5DKAA 4LR6A 5IGLA 2FSAA 2F6NA 3PUQA 5COIA 4B86C 5HENA 2KYUA 4O74A 2KE1A 2KU3A 1FP0A 2VPGA 4TYLA 5DW2A 3IU5A 5H9MA 3JVKA 5A85A 5KTWA 4QSWA 4LJNA 4A9EA 3JVLA 2JMJA 5JI8A 5EWHA 4A9NA 2YHOA 1F62A 5HM0A 4O7BA 1WUMA 4A9LA 3KV5A 4HXSA 5F60A 2C2LA 3SVHA 2YQDA 2BAYA 5A5QA 2KIZA 5CQ8A 3ZPVE 4NRAA 1RMDA 1WIMA 5TABA 5LKTA 4NQMA 4NUEA 3N9LA 4R7EA 4QUTA 5KH3A 4TU4A 5BT3A 4HXLA 3I3JA 5FG4A 4TT4A 5EGUA 4GNDA 2MNYA 2ECTA 5IBNA 3U5JA 5ENJA 5I89A 3O37A 2R0SA 2LXPC 3SOXA 3LRQA 4J0RA 2E7OA 5I40A 4AP4A 4IR3A 5B75A 5E9MA 5DINA 2L5EA 4CFLA 3UVDA 4QSVA 1WEMA 2KTBB 3NXBA 4KCXA 5LVQA 2MA6A 5LVRA 3I2DA 4FK5A 4A9MA 3ZNIA 5D0CA 4CLBA 4ZQLA 3MXFA 1WILA 2EA6A 5ETBA 1BORA 4YYMA 2YW5A 5TDRA 4F52B 3MHSA 4PY6A 3Q2EA 2VJEA 2C2VS 4MSXA 2JRJA 2YQMA 5L99A 5FERA 2LN0A 4WZ3B 5DLZA 5LJ0A 2YQLA 4LK9A 5KH7A 4F3IA 3ZVYA 5BT5A 5F36A 5ENCA 3UVXA 1WENA 5FFYA 5HQ7A 5LKZA 2JMDA 5IG6A 5B8DA 1WEPA 3P5OA 4BW1A 4BW3A 1U6GB 2ECGA 2HDPA 5H85A 2NAAA 4UI9B 2I7KA 4QR5A 5CUDA 2UZGA 5LKXA 4N4HA 3HTKC 5EWWA 5II1A 1WEVA 4AUQB 2E7NA 4NR4A 5ENBA 3U5NA 3GL6A 3P1DA 5DYAA 2YURA 3DWYA 5HLSA 2RSDA 4NR7A 4UIYA 5L97A 1K2FA 5LKUA 2RI7A 4WA6A 4QSQA 3U5OA 4YAXA 5B77A 5D26A 4FJCA 4MR5A 3DAIA 4TT2A 2YHNA 2DWWA 2KWNA 5TDWA 4WHUA 5HFQA 5D3PA 1IYMA 3P1FA 3KV6A 5HRXA 3TLPA 2MNZA 2VJFA 2RO1A 2RS9B 3SOUA 4L58A 2LQ6A 2KWJA 5FH8A 1X4JA 2KWKA 4A4CA 4A0CD 1JOCA 5FE5A 2H0DA 4LZ2A 5AIUA 5HRVA 4XYAA 5FBXA 4WZ0A 2I50A 2FUIA 4QSRA 5F1LA 2OUOA 5CP5A 2R10A 5E3GA 4C9ZA 3HCTA 2YW8A 4YC9A 2HYED 5HJCA 4QB3A 5DKCA 2ECNA 4WHWA 2VP7A 5A5OA 2M1RA 3SVGA 4C66A 2L85A 4CL9A 4NYVA 4I7DA 3ZPV1 4HXNA 2ECJA 5HCLA 4YYIA 2MD8C 5KTXA 5H1VA 4W4UA 4B7YC 3NG2A 5ENEA 2JMIA 5CUBA 4UYFA 5G4RA 3O35A 5C87A 2L5UA 5D7XA 3M99A 4IORA 5DKHA 2CKLB 4A49A 2RFJA 5CGPA 4AVXA 4HBVA 5TBNA 4FO9A 4HXMA 3D7CA 5FE4A 4TT6A 2F6JA 5J3XA 2L75A 4GB0A 2LGLA 4UP0A 5I29A 5CQAA 5I80A 4HXPA 4CUUA 4TU6A 4CUQA 1WEOA 3SHBA 2MA5A 3UVWA 4NRBA 4QF3A 2KGGA 5I1QA 4X3GA 2VNFA 4ZW1A 5CUAA 3U5PA 4QY4A 5EPBA 4CFKA 3RPGC 4TKPB 1G25A 4LADB 4E96A 1LDJB 5FDZA 3JVMA 5F5ZA 4MR6A 3UV2A 4R2YA 4IOQA 2YEMA 5D25A 5F1HA 1T1HA 5E0RA 3PURA 3V43A 5C85A 5CU8A 4Z6IA 2G4AA 4N3WA 5AMFA 2YEKA 2YYNA 4LC2A 2CKLA 4ALGA 4I7BA 5DY7A 2YT5A 5DYCA 5IGMA 2LXHC 5H1UA 2EGPA 2L0BA 4MR3A 3O7AA 4TQNA 2M85A 4YYDA 2M6MA 4QYDA 2ECWA 2MD7B 4O72A 4QZSA 2R0YA 5C11A 2YUCA 3P1EA 4QNSA 1Z60A 4NUDA 4X2IA 5CY9A 2MUMA 3G0LA 1WE9A 4CUSA 5D3LA 4QUUA 5CZGA 5I83A 2M3HA 5LJ2A 2MIQA 4NYWA 3VK6A 5A5RA 5EP7A 5KTUA 4Z6HA 4A9OA 3L1ZB 5HRWA 4QSUA 4C67A 2RNYA 5ACYA 2CSYA 5TCMA 5FEYA 5E9VA 4O75A 5FE6A 5DBMA 4NRCA 3O36A 2G43A 3M63A 1HYIA 3G0JA 5FH6A 5C4QA 5ENIA 4BBQA 4UIVA 3LJWA 5D3JA 1EQFA 2RNXA 5EM3A 5F2PA 2YELA 5D1LB 5JWMA 5EYAF 4J0SA 5IGNA 4O78A 4YYKA 4XUBA 5LUUA 4CA1A 1CHCA 2VPBA 4AKNA 5CRMA 1VD4A 4LZRA 4YH4A 5CQ7A 1LDKC 4YATA 4YY4A 5EISA 1X4IA 4UIXA 5IGKA 2G6QA 4S3OC 3ZTGA 2E6SA 4IR4A 5FE0A 4ALHA 3EB6A 5D1KB 4YBTA 3UV4A 4HXKA 4PKLA 5EICA 3C6WA 4O7EA 3MHHA 4ZUXU 2AN6A 1N87A 4Q0OA 5TRBA 2H0DB 3U5LA 2CT2A 5B79A 3N9OA 5H1TA 5EI4A 3HCSA 5EWVA 5E9YA 2VJEB 5HFRA 3N9NA 4ZC9A 5CRZA 2LRIC 1X0JA 5HEMA 5CPEA 4NQNA 4QC1A 4Q0NA 2H60A 5D3NA 4TTEA 4YYHA 2ZETC 4LLBA 5F25A 2WP1A 4A9FA 4S3OB 5DFBA 4Q6FA 5AD3A 1HYJA 3MQMA 4QSXA 5I7YA 3HMEA 5AMEA 4PPEA 4NR5A 4CUPA 5F62A 2DKWA 3S92A 3O70A 5D24A 5DLXA 5FFVA 5E73A 4CUTA 5E9KA 2KR4A 3GV4A 2LGGA 4QC3A 4GNEA 2L80A 4UIUA 4OUFA 3HMHA 5A81A 1WESA 2YU4A 4UYHA 4ZDTA 5CUCA 2ECIA 4YYJA 2LSPB 3RCWA 5AD2A 4MEQA 5A83A 3LQIA 5A7CA 2YSJA 4I7CA 4KV4A 5J0DA 5FE2A 4PCEA 5FE7A 1WEQA 5FG5A 2CSZA 4FIPA 5D3RA 2G45A 1ZBDB 5L96A 4HBYA 4XY8A 5HQ5A 1JSPB 4LYWA 3O34A 4QR4A 5FE3A 5FE8A 4FLPA 1JM7A 2PNXA 5DFCA 5FB0A 2KREA 5CQ4A 2YSMA 3KQIA 5E74A 4NN2A 4RVRA 2DVRA 2GRCA 4UIWA 4BW4A 4P5OB 1JM4B 3EB5A 2K1JA 5K29A 4NR6A 5L98A 5CQ6A 5ENFA 3LQJA 2DVSA 4YADA 5A5NA 2D8SA 4QR3A 4N4GA 5II2A 5D3HA 5I7XA 4IC3A 5LCWB 4O64A 5ENGA 4LRGA 4BJXA 5HQ6A 4A4BA 5KHMA 2VPDA 5EA1A 2QIZA 2PUYA 5DW1A 5C7NA 4HXOA 1WFKA 4PCIA 3S91A 3P1CA 4UIZA 5KU3A 4GNGA 2E3KA 4YK0A 5EV9A 2VJFB 4UP5A 2NXBA 4QYLA 5DYUA 3QZVA 5CQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK9 A;  5E7D A;  5F3A A;  2KFT A;  3PHD A;  4A9I A;  2KWO A;  2QIC A;  3N9P A;  5CS8 A;  5L8T A;  3T7L A;  5A5P A;  4MEN A;  5FFW A;  2WP2 A;  5FG6 A;  2DX8 A;  1XWH A;  5BT4 A;  4BHW A;  2DVV A;  2DAT A;  5A5S A;  3SVF A;  4GPJ A;  4DON A;  4Z1Q A;  1E4U A;  1VFY A;  4NR9 A;  1E6I A;  5EVA A;  2E6R A;  5DX4 A;  3KNV A;  4KV1 A;  5I88 A;  3U5M A;  4MEO A;  4UYD A;  4N4I A;  4IC2 A;  5D3T A;  1V87 A;  5E9L A;  4YYG A;  1VYX A;  2KGI A;  2Y1M A;  2RNW A;  3MUK A;  3MUL A;  4QSS A;  5DFD A;  2N9G A;  3AQA A;  3K2J A;  5EWC A;  4UYF B;  2FUU A;  2Y1N A;  5AIT A;  4CCG X;  5CUG A;  2L84 A;  3Q2F A;  4MEP A;  4OGJ A;  5G4S A;  4A9K A;  5E3D A;  3RPG B;  5C13 A;  3MB3 A;  2XEU A;  1WGM A;  3LXJ A;  4O71 A;  5EPR A;  3GG3 A;  3U5K A;  4TZ8 A;  5F61 A;  4CUR A;  2XB1 A;  5F63 A;  4Z1S A;  4IOO A;  4LZS A;  4UYG A;  1WEU A;  2R0V A;  2D9E A;  5E9I A;  5TB6 A;  4YBS A;  1JM7 B;  5CQ3 A;  2K16 A;  2LV9 A;  2ECV A;  5FE9 A;  4QF2 A;  5LJ1 A;  4IR5 A;  2K4D A;  2Y43 A;  4UYE A;  3HMF A;  4TS8 A;  4Y03 A;  4YYN A;  5B78 A;  1Z6U A;  3JVJ A;  3DPL R;  4MVT A;  3RTR B;  5EQ1 A;  4YAB A;  5EPS A;  3ZYQ A;  4V3L C;  4PTB A;  4PS5 A;  3ONI A;  4YBM A;  1WEW A;  5JG6 A;  1Z2Q A;  1F68 A;  4GNF A;  4XI1 A;  4QSP A;  5DKD A;  4MR4 A;  1N72 A;  1WUG A;  3QZS A;  5KH9 A;  4NYX A;  5I86 A;  4NR8 A;  5DYX A;  2MJV B;  4O77 A;  2YRE A;  5A82 A;  3QZT A;  5FE1 A;  4QEW A;  3UV5 A;  3C5K A;  3MB4 A;  3ZVZ B;  4A9H A;  2L43 A;  3N9M A;  1MM2 A;  4OGI A;  4WIV A;  5D1M B;  5FH7 A;  3AAD A;  5EWD A;  5G05 B;  3O33 A;  4J3I A;  4L7X A;  4HBX A;  4A9J A;  2IDA A;  3M62 A;  2DVQ A;  5I3L A;  4NS5 A;  5HEL A;  4UIT A;  4HXR A;  3HCU A;  4O70 A;  4TZ2 A;  2OXQ C;  4XUA A;  5B76 A;  4N4F A;  4XY9 A;  3FL2 A;  1DVP A;  5G04 B;  4IR6 A;  2YDW A;  4J1P A;  3T6R A;  4AYC A;  5ETD A;  2LDR A;  4O7C A;  4LYS A;  5ENH A;  1X4U A;  5CUE A;  3DQV R;  3UVY A;  2OSS A;  2F42 A;  3IHP A;  3N9Q A;  5CFW A;  2EOD A;  4LKA A;  5C8G A;  2OO1 A;  4NXJ A;  3IU6 A;  4O7F A;  1WEE A;  5EU1 A;  4R8P K;  4HBW A;  4O76 A;  4V3K C;  4QBM A;  4YY6 A;  3L1X A;  4LDF A;  4LYI A;  4NUC A;  2K17 A;  3LQH A;  4YH3 A;  4WZ2 A;  5C89 A;  1FBV A;  5G0F A;  4O7A A;  2YYR A;  4QST A;  2LGK A;  3UW9 A;  2MT5 A;  2QJ0 A;  2D82 A;  4QEV A;  1MM3 A;  5IID A;  5KO4 A;  1ZS5 A;  4AYC B;  3ASL A;  5CQ5 A;  2I8N A;  3FKM X;  4QEU A;  3SOW A;  4Z93 A;  5L8U A;  5CTL A;  3L11 A;  4BW2 A;  2LGV A;  5D3S A;  5FB1 A;  3ZYU A;  2VPE A;  5DKA A;  4LR6 A;  5IGL A;  2FSA A;  2F6N A;  3PUQ A;  5COI A;  4B86 C;  5HEN A;  2KYU A;  4O74 A;  2KE1 A;  2KU3 A;  1FP0 A;  2VPG A;  4TYL A;  5DW2 A;  3IU5 A;  5H9M A;  3JVK A;  5A85 A;  5KTW A;  4QSW A;  4LJN A;  4A9E A;  3JVL A;  2JMJ A;  5JI8 A;  5EWH A;  4A9N A;  2YHO A;  1F62 A;  5HM0 A;  4O7B A;  1WUM A;  4A9L A;  3KV5 A;  4HXS A;  5F60 A;  2C2L A;  3SVH A;  2YQD A;  2BAY A;  5A5Q A;  2KIZ A;  5CQ8 A;  3ZPV E;  4NRA A;  1RMD A;  1WIM A;  5TAB A;  5LKT A;  4NQM A;  4NUE A;  3N9L A;  4R7E A;  4QUT A;  5KH3 A;  4TU4 A;  5BT3 A;  4HXL A;  3I3J A;  5FG4 A;  4TT4 A;  5EGU A;  4GND A;  2MNY A;  2ECT A;  5IBN A;  3U5J A;  5ENJ A;  5I89 A;  3O37 A;  2R0S A;  2LXP C;  3SOX A;  3LRQ A;  4J0R A;  2E7O A;  5I40 A;  4AP4 A;  4IR3 A;  5B75 A;  5E9M A;  5DIN A;  2L5E A;  4CFL A;  3UVD A;  4QSV A;  1WEM A;  2KTB B;  3NXB A;  4KCX A;  5LVQ A;  2MA6 A;  5LVR A;  3I2D A;  4FK5 A;  4A9M A;  3ZNI A;  5D0C A;  4CLB A;  4ZQL A;  3MXF A;  1WIL A;  2EA6 A;  5ETB A;  1BOR A;  4YYM A;  2YW5 A;  5TDR A;  4F52 B;  3MHS A;  4PY6 A;  3Q2E A;  2VJE A;  2C2V S;  4MSX A;  2JRJ A;  2YQM A;  5L99 A;  5FER A;  2LN0 A;  4WZ3 B;  5DLZ A;  5LJ0 A;  2YQL A;  4LK9 A;  5KH7 A;  4F3I A;  3ZVY A;  5BT5 A;  5F36 A;  5ENC A;  3UVX A;  1WEN A;  5FFY A;  5HQ7 A;  5LKZ A;  2JMD A;  5IG6 A;  5B8D A;  1WEP A;  3P5O A;  4BW1 A;  4BW3 A;  1U6G B;  2ECG A;  2HDP A;  5H85 A;  2NAA A;  4UI9 B;  2I7K A;  4QR5 A;  5CUD A;  2UZG A;  5LKX A;  4N4H A;  3HTK C;  5EWW A;  5II1 A;  1WEV A;  4AUQ B;  2E7N A;  4NR4 A;  5ENB A;  3U5N A;  3GL6 A;  3P1D A;  5DYA A;  2YUR A;  3DWY A;  5HLS A;  2RSD A;  4NR7 A;  4UIY A;  5L97 A;  1K2F A;  5LKU A;  2RI7 A;  4WA6 A;  4QSQ A;  3U5O A;  4YAX A;  5B77 A;  5D26 A;  4FJC A;  4MR5 A;  3DAI A;  4TT2 A;  2YHN A;  2DWW A;  2KWN A;  5TDW A;  4WHU A;  5HFQ A;  5D3P A;  1IYM A;  3P1F A;  3KV6 A;  5HRX A;  3TLP A;  2MNZ A;  2VJF A;  2RO1 A;  2RS9 B;  3SOU A;  4L58 A;  2LQ6 A;  2KWJ A;  5FH8 A;  1X4J A;  2KWK A;  4A4C A;  4A0C D;  1JOC A;  5FE5 A;  2H0D A;  4LZ2 A;  5AIU A;  5HRV A;  4XYA A;  5FBX A;  4WZ0 A;  2I50 A;  2FUI A;  4QSR A;  5F1L A;  2OUO A;  5CP5 A;  2R10 A;  5E3G A;  4C9Z A;  3HCT A;  2YW8 A;  4YC9 A;  2HYE D;  5HJC A;  4QB3 A;  5DKC A;  2ECN A;  4WHW A;  2VP7 A;  5A5O A;  2M1R A;  3SVG A;  4C66 A;  2L85 A;  4CL9 A;  4NYV A;  4I7D A;  3ZPV 1;  4HXN A;  2ECJ A;  5HCL A;  4YYI A;  2MD8 C;  5KTX A;  5H1V A;  4W4U A;  4B7Y C;  3NG2 A;  5ENE A;  2JMI A;  5CUB A;  4UYF A;  5G4R A;  3O35 A;  5C87 A;  2L5U A;  5D7X A;  3M99 A;  4IOR A;  5DKH A;  2CKL B;  4A49 A;  2RFJ A;  5CGP A;  4AVX A;  4HBV A;  5TBN A;  4FO9 A;  4HXM A;  3D7C A;  5FE4 A;  4TT6 A;  2F6J A;  5J3X A;  2L75 A;  4GB0 A;  2LGL A;  4UP0 A;  5I29 A;  5CQA A;  5I80 A;  4HXP A;  4CUU A;  4TU6 A;  4CUQ A;  1WEO A;  3SHB A;  2MA5 A;  3UVW A;  4NRB A;  4QF3 A;  2KGG A;  5I1Q A;  4X3G A;  2VNF A;  4ZW1 A;  5CUA A;  3U5P A;  4QY4 A;  5EPB A;  4CFK A;  3RPG C;  4TKP B;  1G25 A;  4LAD B;  4E96 A;  1LDJ B;  5FDZ A;  3JVM A;  5F5Z A;  4MR6 A;  3UV2 A;  4R2Y A;  4IOQ A;  2YEM A;  5D25 A;  5F1H A;  1T1H A;  5E0R A;  3PUR A;  3V43 A;  5C85 A;  5CU8 A;  4Z6I A;  2G4A A;  4N3W A;  5AMF A;  2YEK A;  2YYN A;  4LC2 A;  2CKL A;  4ALG A;  4I7B A;  5DY7 A;  2YT5 A;  5DYC A;  5IGM A;  2LXH C;  5H1U A;  2EGP A;  2L0B A;  4MR3 A;  3O7A A;  4TQN A;  2M85 A;  4YYD A;  2M6M A;  4QYD A;  2ECW A;  2MD7 B;  4O72 A;  4QZS A;  2R0Y A;  5C11 A;  2YUC A;  3P1E A;  4QNS A;  1Z60 A;  4NUD A;  4X2I A;  5CY9 A;  2MUM A;  3G0L A;  1WE9 A;  4CUS A;  5D3L A;  4QUU A;  5CZG A;  5I83 A;  2M3H A;  5LJ2 A;  2MIQ A;  4NYW A;  3VK6 A;  5A5R A;  5EP7 A;  5KTU A;  4Z6H A;  4A9O A;  3L1Z B;  5HRW A;  4QSU A;  4C67 A;  2RNY A;  5ACY A;  2CSY A;  5TCM A;  5FEY A;  5E9V A;  4O75 A;  5FE6 A;  5DBM A;  4NRC A;  3O36 A;  2G43 A;  3M63 A;  1HYI A;  3G0J A;  5FH6 A;  5C4Q A;  5ENI A;  4BBQ A;  4UIV A;  3LJW A;  5D3J A;  1EQF A;  2RNX A;  5EM3 A;  5F2P A;  2YEL A;  5D1L B;  5JWM A;  5EYA F;  4J0S A;  5IGN A;  4O78 A;  4YYK A;  4XUB A;  5LUU A;  4CA1 A;  1CHC A;  2VPB A;  4AKN A;  5CRM A;  1VD4 A;  4LZR A;  4YH4 A;  5CQ7 A;  1LDK C;  4YAT A;  4YY4 A;  5EIS A;  1X4I A;  4UIX A;  5IGK A;  2G6Q A;  4S3O C;  3ZTG A;  2E6S A;  4IR4 A;  5FE0 A;  4ALH A;  3EB6 A;  5D1K B;  4YBT A;  3UV4 A;  4HXK A;  4PKL A;  5EIC A;  3C6W A;  4O7E A;  3MHH A;  4ZUX U;  2AN6 A;  1N87 A;  4Q0O A;  5TRB A;  2H0D B;  3U5L A;  2CT2 A;  5B79 A;  3N9O A;  5H1T A;  5EI4 A;  3HCS A;  5EWV A;  5E9Y A;  2VJE B;  5HFR A;  3N9N A;  4ZC9 A;  5CRZ A;  2LRI C;  1X0J A;  5HEM A;  5CPE A;  4NQN A;  4QC1 A;  4Q0N A;  2H60 A;  5D3N A;  4TTE A;  4YYH A;  2ZET C;  4LLB A;  5F25 A;  2WP1 A;  4A9F A;  4S3O B;  5DFB A;  4Q6F A;  5AD3 A;  1HYJ A;  3MQM A;  4QSX A;  5I7Y A;  3HME A;  5AME A;  4PPE A;  4NR5 A;  4CUP A;  5F62 A;  2DKW A;  3S92 A;  3O70 A;  5D24 A;  5DLX A;  5FFV A;  5E73 A;  4CUT A;  5E9K A;  2KR4 A;  3GV4 A;  2LGG A;  4QC3 A;  4GNE A;  2L80 A;  4UIU A;  4OUF A;  3HMH A;  5A81 A;  1WES A;  2YU4 A;  4UYH A;  4ZDT A;  5CUC A;  2ECI A;  4YYJ A;  2LSP B;  3RCW A;  5AD2 A;  4MEQ A;  5A83 A;  3LQI A;  5A7C A;  2YSJ A;  4I7C A;  4KV4 A;  5J0D A;  5FE2 A;  4PCE A;  5FE7 A;  1WEQ A;  5FG5 A;  2CSZ A;  4FIP A;  5D3R A;  2G45 A;  1ZBD B;  5L96 A;  4HBY A;  4XY8 A;  5HQ5 A;  1JSP B;  4LYW A;  3O34 A;  4QR4 A;  5FE3 A;  5FE8 A;  4FLP A;  1JM7 A;  2PNX A;  5DFC A;  5FB0 A;  2KRE A;  5CQ4 A;  2YSM A;  3KQI A;  5E74 A;  4NN2 A;  4RVR A;  2DVR A;  2GRC A;  4UIW A;  4BW4 A;  4P5O B;  1JM4 B;  3EB5 A;  2K1J A;  5K29 A;  4NR6 A;  5L98 A;  5CQ6 A;  5ENF A;  3LQJ A;  2DVS A;  4YAD A;  5A5N A;  2D8S A;  4QR3 A;  4N4G A;  5II2 A;  5D3H A;  5I7X A;  4IC3 A;  5LCW B;  4O64 A;  5ENG A;  4LRG A;  4BJX A;  5HQ6 A;  4A4B A;  5KHM A;  2VPD A;  5EA1 A;  2QIZ A;  2PUY A;  5DW1 A;  5C7N A;  4HXO A;  1WFK A;  4PCI A;  3S91 A;  3P1C A;  4UIZ A;  5KU3 A;  4GNG A;  2E3K A;  4YK0 A;  5EV9 A;  2VJF B;  4UP5 A;  2NXB A;  4QYL A;  5DYU A;  3QZV A;  5CQT A; 
#chains in the Genus database with same CATH topology
 5EK9 A;  5E7D A;  5F3A A;  2KFT A;  3PHD A;  4A9I A;  2FD4 A;  3Q1D A;  2KWO A;  2QIC A;  3N9P A;  5CS8 A;  3LVQ E;  5L8T A;  3T7L A;  5A5P A;  4MEN A;  5FFW A;  2WP2 A;  5FG6 A;  3LVR E;  2DX8 A;  3PLW A;  1XWH A;  5BT4 A;  4BHW A;  2DVV A;  2DAT A;  5A5S A;  3SVF A;  4GPJ A;  4OGE A;  4DON A;  4Z1Q A;  1E4U A;  1VFY A;  4NR9 A;  4OGC A;  1E6I A;  5EVA A;  2E6R A;  5DX4 A;  3KNV A;  4KV1 A;  5I88 A;  3U5M A;  4MEO A;  4UYD A;  4N4I A;  4IC2 A;  5D3T A;  1V87 A;  5E9L A;  4YYG A;  1VYX A;  2KGI A;  2Y1M A;  2RNW A;  3MUK A;  3MUL A;  4QSS A;  5DFD A;  2N9G A;  3AQA A;  3K2J A;  5EWC A;  4UYF B;  2FUU A;  2Y1N A;  5AIT A;  4CCG X;  5CUG A;  2L84 A;  3Q2F A;  4MEP A;  4OGJ A;  5G4S A;  4A9K A;  2OWA A;  5E3D A;  3RPG B;  5C13 A;  3MB3 A;  2XEU A;  1WGM A;  3LXJ A;  4O71 A;  5EPR A;  3GG3 A;  3U5K A;  4TZ8 A;  5F61 A;  4CUR A;  2XB1 A;  5F63 A;  4Z1S A;  4IOO A;  4LZS A;  4UYG A;  1WEU A;  2R0V A;  2D9E A;  5E9I A;  5TB6 A;  4YBS A;  1JM7 B;  5CQ3 A;  2K16 A;  2LV9 A;  2ECV A;  5FE9 A;  4QF2 A;  5LJ1 A;  4IR5 A;  2K4D A;  2Y43 A;  4UYE A;  3HMF A;  4TS8 A;  4Y03 A;  2XOC A;  4YYN A;  5B78 A;  1Z6U A;  3JVJ A;  3DPL R;  3JUE A;  4MVT A;  5EQ1 A;  4YAB A;  3RTR B;  5EPS A;  3ZYQ A;  4V3L C;  4PTB A;  4PS5 A;  3ONI A;  4YBM A;  1WEW A;  5JG6 A;  1Z2Q A;  1F68 A;  4GNF A;  4XI1 A;  4QSP A;  5DKD A;  4MR4 A;  1N72 A;  1WUG A;  3QZS A;  5KH9 A;  4NYX A;  5I86 A;  2MKE A;  4NR8 A;  5DYX A;  2MJV B;  4O77 A;  2YRE A;  5A82 A;  3QZT A;  5FE1 A;  4QEW A;  3UV5 A;  3C5K A;  3MB4 A;  3ZVZ B;  4A9H A;  2L43 A;  3N9M A;  1MM2 A;  4OGI A;  4WIV A;  5D1M B;  5FH7 A;  3AAD A;  5EWD A;  5G05 B;  3O33 A;  4J3I A;  4L7X A;  4HBX A;  4A9J A;  2IDA A;  3M62 A;  2DVQ A;  5I3L A;  4NS5 A;  5HEL A;  4UIT A;  4HXR A;  3HCU A;  4O70 A;  4TZ2 A;  2OXQ C;  4XUA A;  5B76 A;  4N4F A;  4XY9 A;  3FL2 A;  1DVP A;  5G04 B;  4IR6 A;  2YDW A;  4J1P A;  3T6R A;  3E2D A;  4AYC A;  5ETD A;  2LDR A;  4O7C A;  4LYS A;  2JM3 A;  5ENH A;  1X4U A;  5CUE A;  3DQV R;  3UVY A;  5SVI B;  2OSS A;  2F42 A;  3IHP A;  3N9Q A;  5CFW A;  2EOD A;  4LKA A;  5C8G A;  2OO1 A;  4NXJ A;  3IU6 A;  4O7F A;  1WEE A;  5EU1 A;  4R8P K;  4HBW A;  4O76 A;  4V3K C;  4QBM A;  3DDT A;  4YY6 A;  3L1X A;  4LDF A;  4LYI A;  4NUC A;  2K17 A;  3LJU X;  3LQH A;  4YH3 A;  4WZ2 A;  5C89 A;  1FBV A;  5G0F A;  4O7A A;  2YYR A;  4QST A;  2LGK A;  3UW9 A;  2MT5 A;  2QJ0 A;  2D82 A;  3T9K A;  4QEV A;  2CRW A;  1MM3 A;  5IID A;  5KO4 A;  1ZS5 A;  4AYC B;  3ASL A;  5CQ5 A;  2I8N A;  3FKM X;  4QEU A;  3SOW A;  4Z93 A;  5L8U A;  4AI6 A;  5CTL A;  3L11 A;  4BW2 A;  2LGV A;  5D3S A;  5FB1 A;  3ZYU A;  2VPE A;  5DKA A;  4LR6 A;  5IGL A;  2FSA A;  2F6N A;  3PUQ A;  5COI A;  4B86 C;  5HEN A;  2CRR A;  2KYU A;  4O74 A;  2KE1 A;  2KU3 A;  1FP0 A;  2VPG A;  4TYL A;  3FM8 C;  5DW2 A;  2RR4 A;  3IU5 A;  5H9M A;  3JVK A;  5A85 A;  5KTW A;  4QSW A;  4LJN A;  4A9E A;  3M7K A;  3JVL A;  2JMJ A;  5JI8 A;  5EWH A;  4A9N A;  2YHO A;  1F62 A;  5HM0 A;  4O7B A;  1WUM A;  4A9L A;  3KV5 A;  4HXS A;  5F60 A;  2C2L A;  3SVH A;  2YQD A;  2BAY A;  5A5Q A;  2KIZ A;  5CQ8 A;  3ZPV E;  4NRA A;  1RMD A;  1WIM A;  5TAB A;  5LKT A;  4NQM A;  4NUE A;  3N9L A;  4R7E A;  4QUT A;  5KH3 A;  4TU4 A;  5BT3 A;  4HXL A;  3I3J A;  5FG4 A;  4TT4 A;  5EGU A;  2P57 A;  4GND A;  2MNY A;  2ECT A;  5IBN A;  3U5J A;  5ENJ A;  5I89 A;  3O37 A;  2R0S A;  2LXP C;  2L7P A;  3SOX A;  3LRQ A;  4J0R A;  2E7O A;  5I40 A;  4AP4 A;  4IR3 A;  5B75 A;  5E9M A;  5DIN A;  2L5E A;  4CFL A;  3UVD A;  4QSV A;  1WEM A;  2KTB B;  3NXB A;  4KCX A;  5LVQ A;  2B0O E;  5LVR A;  2MA6 A;  3I2D A;  4A9M A;  4FK5 A;  3ZNI A;  5D0C A;  4CLB A;  4ZQL A;  3MXF A;  1WIL A;  2EA6 A;  5ETB A;  1BOR A;  4YYM A;  2YW5 A;  5TDR A;  4F52 B;  3MHS A;  4PY6 A;  3Q2E A;  2VJE A;  3FAO A;  2C2V S;  4MSX A;  2JRJ A;  2YQM A;  5L99 A;  5FER A;  2LN0 A;  4WZ3 B;  5DLZ A;  5LJ0 A;  2YQL A;  4LK9 A;  5KH7 A;  5SVI A;  4F3I A;  2DJA A;  2EXU A;  3ZVY A;  5BT5 A;  5F36 A;  5ENC A;  3UVX A;  1WEN A;  3VKH A;  5FFY A;  5HQ7 A;  5LKZ A;  2JMD A;  5IG6 A;  5B8D A;  1WEP A;  4Z0O A;  3P5O A;  4BW1 A;  4BW3 A;  1U6G B;  2ECG A;  2HDP A;  5H85 A;  2NAA A;  1ZKR A;  4UI9 B;  2I7K A;  4QR5 A;  5CUD A;  2UZG A;  5LKX A;  4N4H A;  3HTK C;  5EWW A;  5II1 A;  1WEV A;  4AUQ B;  2E7N A;  4NR4 A;  5ENB A;  3U5N A;  3GL6 A;  3P1D A;  5DYA A;  2YUR A;  3DWY A;  5HLS A;  2CSV A;  2RSD A;  4NR7 A;  4UIY A;  5L97 A;  1K2F A;  5LKU A;  2RI7 A;  4WA6 A;  4QSQ A;  3U5O A;  4YAX A;  2XOZ A;  5D26 A;  5B77 A;  4FJC A;  4MR5 A;  3DAI A;  4TT2 A;  2YHN A;  2DWW A;  2KWN A;  5TDW A;  4WHU A;  5HFQ A;  5D3P A;  1IYM A;  3P1F A;  3KV6 A;  5HRX A;  3TLP A;  2MNZ A;  2VJF A;  2RO1 A;  4H9D A;  2RS9 B;  3SOU A;  4L58 A;  2LQ6 A;  2KWJ A;  5FH8 A;  1X4J A;  2KWK A;  4A4C A;  4A0C D;  1JOC A;  5FE5 A;  2H0D A;  4LZ2 A;  5AIU A;  5HRV A;  4XYA A;  5FBX A;  4WZ0 A;  2I50 A;  2D8U A;  2FUI A;  4QSR A;  5F1L A;  2OUO A;  5CP5 A;  2R10 A;  5E3G A;  4C9Z A;  3HCT A;  2YW8 A;  4YC9 A;  2HYE D;  4AKI A;  5HJC A;  4QB3 A;  5DKC A;  2ECN A;  4WHW A;  2VP7 A;  5A5O A;  3DWD A;  2M1R A;  3SVG A;  4C66 A;  2L85 A;  4CL9 A;  4NYV A;  4I7D A;  3ZPV 1;  4HXN A;  2ECJ A;  5HCL A;  4YYI A;  2MD8 C;  5KTX A;  5H1V A;  1DCQ A;  4W4U A;  4B7Y C;  3NG2 A;  5ENE A;  3O47 A;  2JMI A;  5CUB A;  4UYF A;  5G4R A;  3O35 A;  5C87 A;  1PUO A;  2L5U A;  5D7X A;  3M99 A;  4IOR A;  2EJN A;  5DKH A;  2CKL B;  4A49 A;  2RFJ A;  5CGP A;  3VKG A;  4AVX A;  4HBV A;  5TBN A;  4FO9 A;  4HXM A;  3D7C A;  5FE4 A;  4TT6 A;  2F6J A;  5J3X A;  2L75 A;  4GB0 A;  2LGL A;  4UP0 A;  5I29 A;  5CQA A;  5I80 A;  4HXP A;  4CUU A;  4TU6 A;  4CUQ A;  1WEO A;  3SHB A;  2MA5 A;  3UVW A;  3LDY A;  3MDB C;  4NRB A;  4QF3 A;  2KGG A;  5I1Q A;  4X3G A;  2VNF A;  3FEH A;  4ZW1 A;  5CUA A;  3U5P A;  4QY4 A;  5EPB A;  4CFK A;  3RPG C;  5SVY A;  1MBM A;  4TKP B;  1G25 A;  4LAD B;  4E96 A;  4QQ4 A;  1LDJ B;  5FDZ A;  3JVM A;  5F5Z A;  4MR6 A;  3UV2 A;  4R2Y A;  4IOQ A;  2YEM A;  5D25 A;  5F1H A;  1T1H A;  5E0R A;  3PUR A;  3V43 A;  5C85 A;  5CU8 A;  4Z6I A;  2G4A A;  4N3W A;  5AMF A;  2YEK A;  2YYN A;  4LC2 A;  2CKL A;  2FFW A;  3KDE C;  4ALG A;  4I7B A;  3H7H A;  5DY7 A;  2YT5 A;  5K3Q A;  5DYC A;  5IGM A;  2LXH C;  5H1U A;  2EGP A;  2L0B A;  4MR3 A;  3O7A A;  4TQN A;  2XOY A;  2M85 A;  4YYD A;  2M6M A;  4QYD A;  2ECW A;  2MD7 B;  4O72 A;  4QZS A;  2R0Y A;  5C11 A;  2LAU A;  2YUC A;  3P1E A;  4QNS A;  1Z60 A;  4NUD A;  4X2I A;  5CY9 A;  2MUM A;  3G0L A;  1WE9 A;  4CUS A;  5D3L A;  4QUU A;  5CZG A;  5I83 A;  2M3H A;  5LJ2 A;  2MIQ A;  2EGM A;  4NYW A;  2YVR A;  3VK6 A;  5A5R A;  5EP7 A;  5KTU A;  4Z6H A;  4A9O A;  3L1Z B;  5HRW A;  4QSU A;  4C67 A;  2RNY A;  2XP0 A;  2KKX A;  5ACY A;  2CSY A;  5TCM A;  5FEY A;  5E9V A;  2CON A;  4O75 A;  5FE6 A;  2M13 A;  5DBM A;  2E61 A;  4NRC A;  3O36 A;  2G43 A;  3M63 A;  1HYI A;  3G0J A;  5FH6 A;  5C4Q A;  5ENI A;  4BBQ A;  4UIV A;  3LJW A;  5D3J A;  1EQF A;  2RNX A;  5EM3 A;  5F2P A;  2YEL A;  2JUN A;  5JWM A;  5D1L B;  5EYA F;  4Z0R A;  4J0S A;  5IGN A;  4O78 A;  3ERR A;  4YYK A;  4XUB A;  5LUU A;  4CA1 A;  1CHC A;  2VPB A;  4AKN A;  5CRM A;  1VD4 A;  4LZR A;  4YH4 A;  5CQ7 A;  1LDK C;  4YAT A;  4YY4 A;  5EIS A;  1X4I A;  4UIX A;  5IGK A;  2G6Q A;  4S3O C;  3ZTG A;  2E6S A;  4IR4 A;  5FE0 A;  4AKH A;  4ALH A;  3EB6 A;  5D1K B;  4YBT A;  3UV4 A;  4HXK A;  4PKL A;  5EIC A;  3C6W A;  4O7E A;  3MHH A;  4ZUX U;  2AN6 A;  1N87 A;  4Q0O A;  5TRB A;  2H0D B;  3U5L A;  2CT2 A;  5B79 A;  2IQJ A;  3N9O A;  5H1T A;  5EI4 A;  3HCS A;  5EWV A;  5E9Y A;  2VJE B;  5HFR A;  3N9N A;  4ZC9 A;  5CRZ A;  2LRI C;  1X0J A;  5HEM A;  5CPE A;  4NQN A;  4QC1 A;  4Q0N A;  2H60 A;  5D3N A;  4TTE A;  4YYH A;  2ZET C;  4LLB A;  5F25 A;  2WP1 A;  4A9F A;  4S3O B;  5DFB A;  4Q6F A;  5AD3 A;  1HYJ A;  3MQM A;  4QSX A;  5I7Y A;  5SVX A;  3HME A;  5AME A;  4O62 A;  4NR5 A;  4PPE A;  4CUP A;  5F62 A;  2DKW A;  3S92 A;  3O70 A;  4AKG A;  5D24 A;  5DLX A;  5FFV A;  5E73 A;  2DSM A;  4CUT A;  5E9K A;  2KR4 A;  3GV4 A;  2LGG A;  4QC3 A;  4GNE A;  2L80 A;  4UIU A;  4OUF A;  3HMH A;  5A81 A;  1WES A;  2YU4 A;  4UYH A;  4ZDT A;  5CUC A;  2ECI A;  4YYJ A;  2LSP B;  3RCW A;  5AD2 A;  4MEQ A;  5A83 A;  3LQI A;  5A7C A;  2YSJ A;  4I7C A;  4KV4 A;  5J0D A;  5FE2 A;  4PCE A;  5FE7 A;  1WEQ A;  5FG5 A;  2CSZ A;  4FIP A;  5D3R A;  2G45 A;  1ZBD B;  5L96 A;  4HBY A;  4XY8 A;  3FJU B;  5HQ5 A;  1JSP B;  4LYW A;  3O34 A;  4QR4 A;  5FE3 A;  5FE8 A;  4FLP A;  1JM7 A;  3D1B A;  2PNX A;  5DFC A;  5FB0 A;  2KRE A;  5CQ4 A;  2YSM A;  3SUB A;  3KQI A;  5E74 A;  4NN2 A;  4RVR A;  2DVR A;  2GRC A;  4UIW A;  4BW4 A;  4P5O B;  1JM4 B;  2KKY A;  3EB5 A;  2K1J A;  5K29 A;  4NR6 A;  5L98 A;  5CQ6 A;  5ENF A;  3LQJ A;  2DVS A;  4YAD A;  5A5N A;  2D8S A;  4QR3 A;  4N4G A;  5II2 A;  5D3H A;  5I7X A;  4IC3 A;  5LCW B;  4O64 A;  5ENG A;  4LRG A;  4BJX A;  5HQ6 A;  4A4B A;  5KHM A;  2VPD A;  5EA1 A;  2QIZ A;  2PUY A;  5DW1 A;  5C7N A;  4HXO A;  1WFK A;  4F1P A;  4PCI A;  3S91 A;  3P1C A;  4UIZ A;  5KU3 A;  4GNG A;  2E3K A;  4YK0 A;  5EV9 A;  2VJF B;  3FAN A;  4UP5 A;  3D1D A;  2NXB A;  4QYL A;  5DYU A;  3QZV A;  5CQT A; 
#chains in the Genus database with same CATH homology
 5EK9 A;  5E7D A;  5F3A A;  2KFT A;  3PHD A;  4A9I A;  2KWO A;  2QIC A;  3N9P A;  5CS8 A;  5L8T A;  3T7L A;  5A5P A;  4MEN A;  5FFW A;  2WP2 A;  5FG6 A;  2DX8 A;  1XWH A;  5BT4 A;  4BHW A;  2DVV A;  2DAT A;  5A5S A;  3SVF A;  4GPJ A;  4DON A;  4Z1Q A;  1E4U A;  1VFY A;  4NR9 A;  1E6I A;  5EVA A;  2E6R A;  5DX4 A;  3KNV A;  4KV1 A;  5I88 A;  3U5M A;  4MEO A;  4UYD A;  4N4I A;  4IC2 A;  5D3T A;  1V87 A;  5E9L A;  4YYG A;  1VYX A;  2KGI A;  2Y1M A;  2RNW A;  3MUK A;  3MUL A;  4QSS A;  5DFD A;  2N9G A;  3AQA A;  3K2J A;  5EWC A;  4UYF B;  2FUU A;  2Y1N A;  5AIT A;  4CCG X;  5CUG A;  2L84 A;  3Q2F A;  4MEP A;  4OGJ A;  5G4S A;  4A9K A;  5E3D A;  3RPG B;  5C13 A;  3MB3 A;  2XEU A;  1WGM A;  3LXJ A;  4O71 A;  5EPR A;  3GG3 A;  3U5K A;  4TZ8 A;  5F61 A;  4CUR A;  2XB1 A;  5F63 A;  4Z1S A;  4IOO A;  4LZS A;  4UYG A;  1WEU A;  2R0V A;  2D9E A;  5E9I A;  5TB6 A;  4YBS A;  1JM7 B;  5CQ3 A;  2K16 A;  2LV9 A;  2ECV A;  5FE9 A;  4QF2 A;  5LJ1 A;  4IR5 A;  2K4D A;  2Y43 A;  4UYE A;  3HMF A;  4TS8 A;  4Y03 A;  4YYN A;  5B78 A;  1Z6U A;  3JVJ A;  3DPL R;  4MVT A;  3RTR B;  5EQ1 A;  4YAB A;  5EPS A;  3ZYQ A;  4V3L C;  4PTB A;  4PS5 A;  3ONI A;  4YBM A;  1WEW A;  5JG6 A;  1Z2Q A;  1F68 A;  4GNF A;  4XI1 A;  4QSP A;  5DKD A;  4MR4 A;  1N72 A;  1WUG A;  3QZS A;  5KH9 A;  4NYX A;  5I86 A;  4NR8 A;  5DYX A;  2MJV B;  4O77 A;  2YRE A;  5A82 A;  3QZT A;  5FE1 A;  4QEW A;  3UV5 A;  3C5K A;  3MB4 A;  3ZVZ B;  4A9H A;  2L43 A;  3N9M A;  1MM2 A;  4OGI A;  4WIV A;  5D1M B;  5FH7 A;  3AAD A;  5EWD A;  5G05 B;  3O33 A;  4J3I A;  4L7X A;  4HBX A;  4A9J A;  2IDA A;  3M62 A;  2DVQ A;  5I3L A;  4NS5 A;  5HEL A;  4UIT A;  4HXR A;  3HCU A;  4O70 A;  4TZ2 A;  2OXQ C;  4XUA A;  5B76 A;  4N4F A;  4XY9 A;  3FL2 A;  1DVP A;  5G04 B;  4IR6 A;  2YDW A;  4J1P A;  3T6R A;  4AYC A;  5ETD A;  2LDR A;  4O7C A;  4LYS A;  5ENH A;  1X4U A;  5CUE A;  3DQV R;  3UVY A;  2OSS A;  2F42 A;  3IHP A;  3N9Q A;  5CFW A;  2EOD A;  4LKA A;  5C8G A;  2OO1 A;  4NXJ A;  3IU6 A;  4O7F A;  1WEE A;  5EU1 A;  4R8P K;  4HBW A;  4O76 A;  4V3K C;  4QBM A;  4YY6 A;  3L1X A;  4LDF A;  4LYI A;  4NUC A;  2K17 A;  3LQH A;  4YH3 A;  4WZ2 A;  5C89 A;  1FBV A;  5G0F A;  4O7A A;  2YYR A;  4QST A;  2LGK A;  3UW9 A;  2MT5 A;  2QJ0 A;  2D82 A;  4QEV A;  1MM3 A;  5IID A;  5KO4 A;  1ZS5 A;  4AYC B;  3ASL A;  5CQ5 A;  2I8N A;  3FKM X;  4QEU A;  3SOW A;  4Z93 A;  5L8U A;  5CTL A;  3L11 A;  4BW2 A;  2LGV A;  5D3S A;  5FB1 A;  3ZYU A;  2VPE A;  5DKA A;  4LR6 A;  5IGL A;  2FSA A;  2F6N A;  3PUQ A;  5COI A;  4B86 C;  5HEN A;  2KYU A;  4O74 A;  2KE1 A;  2KU3 A;  1FP0 A;  2VPG A;  4TYL A;  5DW2 A;  3IU5 A;  5H9M A;  3JVK A;  5A85 A;  5KTW A;  4QSW A;  4LJN A;  4A9E A;  3JVL A;  2JMJ A;  5JI8 A;  5EWH A;  4A9N A;  2YHO A;  1F62 A;  5HM0 A;  4O7B A;  1WUM A;  4A9L A;  3KV5 A;  4HXS A;  5F60 A;  2C2L A;  3SVH A;  2YQD A;  2BAY A;  5A5Q A;  2KIZ A;  5CQ8 A;  3ZPV E;  4NRA A;  1RMD A;  1WIM A;  5TAB A;  5LKT A;  4NQM A;  4NUE A;  3N9L A;  4R7E A;  4QUT A;  5KH3 A;  4TU4 A;  5BT3 A;  4HXL A;  3I3J A;  5FG4 A;  4TT4 A;  5EGU A;  4GND A;  2MNY A;  2ECT A;  5IBN A;  3U5J A;  5ENJ A;  5I89 A;  3O37 A;  2R0S A;  2LXP C;  3SOX A;  3LRQ A;  4J0R A;  2E7O A;  5I40 A;  4AP4 A;  4IR3 A;  5B75 A;  5E9M A;  5DIN A;  2L5E A;  4CFL A;  3UVD A;  4QSV A;  1WEM A;  2KTB B;  3NXB A;  4KCX A;  5LVQ A;  2MA6 A;  5LVR A;  3I2D A;  4FK5 A;  4A9M A;  3ZNI A;  5D0C A;  4CLB A;  4ZQL A;  3MXF A;  1WIL A;  2EA6 A;  5ETB A;  1BOR A;  4YYM A;  2YW5 A;  5TDR A;  4F52 B;  3MHS A;  4PY6 A;  3Q2E A;  2VJE A;  2C2V S;  4MSX A;  2JRJ A;  2YQM A;  5L99 A;  5FER A;  2LN0 A;  4WZ3 B;  5DLZ A;  5LJ0 A;  2YQL A;  4LK9 A;  5KH7 A;  4F3I A;  3ZVY A;  5BT5 A;  5F36 A;  5ENC A;  3UVX A;  1WEN A;  5FFY A;  5HQ7 A;  5LKZ A;  2JMD A;  5IG6 A;  5B8D A;  1WEP A;  3P5O A;  4BW1 A;  4BW3 A;  1U6G B;  2ECG A;  2HDP A;  5H85 A;  2NAA A;  4UI9 B;  2I7K A;  4QR5 A;  5CUD A;  2UZG A;  5LKX A;  4N4H A;  3HTK C;  5EWW A;  5II1 A;  1WEV A;  4AUQ B;  2E7N A;  4NR4 A;  5ENB A;  3U5N A;  3GL6 A;  3P1D A;  5DYA A;  2YUR A;  3DWY A;  5HLS A;  2RSD A;  4NR7 A;  4UIY A;  5L97 A;  1K2F A;  5LKU A;  2RI7 A;  4WA6 A;  4QSQ A;  3U5O A;  4YAX A;  5B77 A;  5D26 A;  4FJC A;  4MR5 A;  3DAI A;  4TT2 A;  2YHN A;  2DWW A;  2KWN A;  5TDW A;  4WHU A;  5HFQ A;  5D3P A;  1IYM A;  3P1F A;  3KV6 A;  5HRX A;  3TLP A;  2MNZ A;  2VJF A;  2RO1 A;  2RS9 B;  3SOU A;  4L58 A;  2LQ6 A;  2KWJ A;  5FH8 A;  1X4J A;  2KWK A;  4A4C A;  4A0C D;  1JOC A;  5FE5 A;  2H0D A;  4LZ2 A;  5AIU A;  5HRV A;  4XYA A;  5FBX A;  4WZ0 A;  2I50 A;  2FUI A;  4QSR A;  5F1L A;  2OUO A;  5CP5 A;  2R10 A;  5E3G A;  4C9Z A;  3HCT A;  2YW8 A;  4YC9 A;  2HYE D;  5HJC A;  4QB3 A;  5DKC A;  2ECN A;  4WHW A;  2VP7 A;  5A5O A;  2M1R A;  3SVG A;  4C66 A;  2L85 A;  4CL9 A;  4NYV A;  4I7D A;  3ZPV 1;  4HXN A;  2ECJ A;  5HCL A;  4YYI A;  2MD8 C;  5KTX A;  5H1V A;  4W4U A;  4B7Y C;  3NG2 A;  5ENE A;  2JMI A;  5CUB A;  4UYF A;  5G4R A;  3O35 A;  5C87 A;  2L5U A;  5D7X A;  3M99 A;  4IOR A;  5DKH A;  2CKL B;  4A49 A;  2RFJ A;  5CGP A;  4AVX A;  4HBV A;  5TBN A;  4FO9 A;  4HXM A;  3D7C A;  5FE4 A;  4TT6 A;  2F6J A;  5J3X A;  2L75 A;  4GB0 A;  2LGL A;  4UP0 A;  5I29 A;  5CQA A;  5I80 A;  4HXP A;  4CUU A;  4TU6 A;  4CUQ A;  1WEO A;  3SHB A;  2MA5 A;  3UVW A;  4NRB A;  4QF3 A;  2KGG A;  5I1Q A;  4X3G A;  2VNF A;  4ZW1 A;  5CUA A;  3U5P A;  4QY4 A;  5EPB A;  4CFK A;  3RPG C;  4TKP B;  1G25 A;  4LAD B;  4E96 A;  1LDJ B;  5FDZ A;  3JVM A;  5F5Z A;  4MR6 A;  3UV2 A;  4R2Y A;  4IOQ A;  2YEM A;  5D25 A;  5F1H A;  1T1H A;  5E0R A;  3PUR A;  3V43 A;  5C85 A;  5CU8 A;  4Z6I A;  2G4A A;  4N3W A;  5AMF A;  2YEK A;  2YYN A;  4LC2 A;  2CKL A;  4ALG A;  4I7B A;  5DY7 A;  2YT5 A;  5DYC A;  5IGM A;  2LXH C;  5H1U A;  2EGP A;  2L0B A;  4MR3 A;  3O7A A;  4TQN A;  2M85 A;  4YYD A;  2M6M A;  4QYD A;  2ECW A;  2MD7 B;  4O72 A;  4QZS A;  2R0Y A;  5C11 A;  2YUC A;  3P1E A;  4QNS A;  1Z60 A;  4NUD A;  4X2I A;  5CY9 A;  2MUM A;  3G0L A;  1WE9 A;  4CUS A;  5D3L A;  4QUU A;  5CZG A;  5I83 A;  2M3H A;  5LJ2 A;  2MIQ A;  4NYW A;  3VK6 A;  5A5R A;  5EP7 A;  5KTU A;  4Z6H A;  4A9O A;  3L1Z B;  5HRW A;  4QSU A;  4C67 A;  2RNY A;  5ACY A;  2CSY A;  5TCM A;  5FEY A;  5E9V A;  4O75 A;  5FE6 A;  5DBM A;  4NRC A;  3O36 A;  2G43 A;  3M63 A;  1HYI A;  3G0J A;  5FH6 A;  5C4Q A;  5ENI A;  4BBQ A;  4UIV A;  3LJW A;  5D3J A;  1EQF A;  2RNX A;  5EM3 A;  5F2P A;  2YEL A;  5D1L B;  5JWM A;  5EYA F;  4J0S A;  5IGN A;  4O78 A;  4YYK A;  4XUB A;  5LUU A;  4CA1 A;  1CHC A;  2VPB A;  4AKN A;  5CRM A;  1VD4 A;  4LZR A;  4YH4 A;  5CQ7 A;  1LDK C;  4YAT A;  4YY4 A;  5EIS A;  1X4I A;  4UIX A;  5IGK A;  2G6Q A;  4S3O C;  3ZTG A;  2E6S A;  4IR4 A;  5FE0 A;  4ALH A;  3EB6 A;  5D1K B;  4YBT A;  3UV4 A;  4HXK A;  4PKL A;  5EIC A;  3C6W A;  4O7E A;  3MHH A;  4ZUX U;  2AN6 A;  1N87 A;  4Q0O A;  5TRB A;  2H0D B;  3U5L A;  2CT2 A;  5B79 A;  3N9O A;  5H1T A;  5EI4 A;  3HCS A;  5EWV A;  5E9Y A;  2VJE B;  5HFR A;  3N9N A;  4ZC9 A;  5CRZ A;  2LRI C;  1X0J A;  5HEM A;  5CPE A;  4NQN A;  4QC1 A;  4Q0N A;  2H60 A;  5D3N A;  4TTE A;  4YYH A;  2ZET C;  4LLB A;  5F25 A;  2WP1 A;  4A9F A;  4S3O B;  5DFB A;  4Q6F A;  5AD3 A;  1HYJ A;  3MQM A;  4QSX A;  5I7Y A;  3HME A;  5AME A;  4PPE A;  4NR5 A;  4CUP A;  5F62 A;  2DKW A;  3S92 A;  3O70 A;  5D24 A;  5DLX A;  5FFV A;  5E73 A;  4CUT A;  5E9K A;  2KR4 A;  3GV4 A;  2LGG A;  4QC3 A;  4GNE A;  2L80 A;  4UIU A;  4OUF A;  3HMH A;  5A81 A;  1WES A;  2YU4 A;  4UYH A;  4ZDT A;  5CUC A;  2ECI A;  4YYJ A;  2LSP B;  3RCW A;  5AD2 A;  4MEQ A;  5A83 A;  3LQI A;  5A7C A;  2YSJ A;  4I7C A;  4KV4 A;  5J0D A;  5FE2 A;  4PCE A;  5FE7 A;  1WEQ A;  5FG5 A;  2CSZ A;  4FIP A;  5D3R A;  2G45 A;  1ZBD B;  5L96 A;  4HBY A;  4XY8 A;  5HQ5 A;  1JSP B;  4LYW A;  3O34 A;  4QR4 A;  5FE3 A;  5FE8 A;  4FLP A;  1JM7 A;  2PNX A;  5DFC A;  5FB0 A;  2KRE A;  5CQ4 A;  2YSM A;  3KQI A;  5E74 A;  4NN2 A;  4RVR A;  2DVR A;  2GRC A;  4UIW A;  4BW4 A;  4P5O B;  1JM4 B;  3EB5 A;  2K1J A;  5K29 A;  4NR6 A;  5L98 A;  5CQ6 A;  5ENF A;  3LQJ A;  2DVS A;  4YAD A;  5A5N A;  2D8S A;  4QR3 A;  4N4G A;  5II2 A;  5D3H A;  5I7X A;  4IC3 A;  5LCW B;  4O64 A;  5ENG A;  4LRG A;  4BJX A;  5HQ6 A;  4A4B A;  5KHM A;  2VPD A;  5EA1 A;  2QIZ A;  2PUY A;  5DW1 A;  5C7N A;  4HXO A;  1WFK A;  4PCI A;  3S91 A;  3P1C A;  4UIZ A;  5KU3 A;  4GNG A;  2E3K A;  4YK0 A;  5EV9 A;  2VJF B;  4UP5 A;  2NXB A;  4QYL A;  5DYU A;  3QZV A;  5CQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...