4ZQLA

Crystal structure of trim24 with 3,4-dimethoxy-n-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
177
Chain Sequence
MNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Crystal structure of TRIM24 with 3,4-dimethoxy-N-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 49
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4zqlA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4zqlA01
3HCUA 2RI7A 4N4GA 4LLBA 4NUCA 4PCIA 3HCSA 5C87A 5CUDA 3PHDA 2LN0A 4A9JA 3KV5A 2MNYA 4QR5A 2IDAA 4GNGA 4NUDA 2CSYA 2M6MA 4GNEA 4AUQB 2KTBB 3MHHA 4PY6A 3ZPV1 5DKAA 5JWMA 2I50A 5EYAF 3O7AA 4HXNA 1V87A 4YBSA 5EK9A 4UYGA 4NR8A 2CKLA 4NR6A 2G6QA 4F3IA 1WILA 2ECJA 1WIMA 5FH8A 5EM3A 2ECVA 5LKZA 4A9NA 2BAYA 5C89A 5ETDA 2L0BA 5TDWA 1FP0A 5TRBA 2YHNA 4YYDA 5D3JA 5IGKA 2DVVA 4O7BA 5DFDA 4QSRA 4MEOA 1N72A 5DW1A 3M99A 5CQ5A 4CL9A 4QR4A 2LXHC 5CP5A 5G4SA 2R0VA 2VPBA 3UV4A 3U5OA 4C66A 1RMDA 2LV9A 5E74A 5A5PA 4A0CD 5IBNA 3JVJA 2YW5A 5FFWA 3UVDA 1N87A 2DVQA 5FE1A 3UVYA 4XUAA 5CGPA 4NUEA 4B7YC 5C11A 5E7DA 1VFYA 1WEWA 5CUBA 5D3SA 3LQHA 4Q0OA 2D8SA 4QSUA 4YY6A 1F68A 2LGLA 2C2LA 4QUTA 3KV6A 3NXBA 3L1XA 2QIZA 4CCGX 5I80A 4MEQA 5E9LA 4R2YA 4NN2A 4LK9A 2KE1A 5HQ7A 5J3XA 1WEUA 4AYCB 5CQ3A 3MXFA 2DKWA 3O35A 5TABA 5BT4A 2I7KA 2R10A 3M63A 3P1FA 4HBXA 2YREA 5DX4A 5HLSA 4IORA 5A5OA 2DVRA 5AD3A 1Z60A 4TZ8A 4UIUA 5E9VA 5L97A 5F25A 4O71A 5CU8A 2KFTA 5DLZA 4A9KA 4QSVA 4A4BA 3UVWA 4A9LA 2MNZA 5G4RA 2R0SA 2EA6A 4CUTA 5FE6A 4YYNA 4FO9A 4CLBA 5ACYA 2G4AA 1ZS5A 5CQ6A 5F61A 5F60A 4O7FA 5FE2A 5DFCA 3ONIA 4YAXA 3SVHA 2MA6A 5HRVA 2NAAA 4HXPA 5LJ0A 4S3OC 5EQ1A 4XY8A 4YK0A 5DW2A 3TLPA 2MT5A 3AQAA 4AVXA 4HXMA 4QBMA 4O7AA 4YC9A 3V43A 5L96A 2Y1MA 4C9ZA 4TZ2A 1X4UA 4O70A 1WEMA 2RO1A 4A9OA 1G25A 3G0JA 4Q0NA 2L5EA 5B79A 2ECWA 5H1UA 2VNFA 2KWOA 4V3KC 5CTLA 5D26A 2OXQC 4A9EA 4YYIA 2Y43A 4GNDA 5C13A 3MUKA 5DFBA 4Z1SA 4NXJA 1WGMA 5A85A 4KCXA 4TT4A 4UYHA 5G04B 5D3HA 4NYXA 5I88A 3QZSA 2WP2A 4QNSA 4QSQA 4XYAA 4XUBA 4O74A 5EICA 5II2A 4CURA 4WZ0A 3HTKC 5D3TA 5D1LB 2YUCA 2YEKA 4O7EA 1Z2QA 2JMJA 5KHMA 4A9MA 3C6WA 5E0RA 4YYHA 5C8GA 3IU6A 4QUUA 4YBTA 3NG2A 5BT3A 3N9OA 5LJ1A 2VJFA 3DPLR 2LSPB 4ZUXU 5CY9A 4UIVA 5I86A 2MD7B 5EWWA 2VPGA 1HYJA 5KH7A 4NQNA 4LKAA 4FLPA 4A9FA 4W4UA 2KGIA 1Z6UA 4MEPA 4YBMA 2RSDA 4CUPA 5E9IA 5FFYA 5CRMA 5ENJA 2G45A 5EI4A 5K29A 3P1DA 2YQMA 4QF3A 1MM2A 3GL6A 4X3GA 2GRCA 1EQFA 2EODA 5EWHA 5LVRA 4L7XA 4UIZA 4FJCA 2RS9B 5FE5A 5ETBA 4BW1A 5G05B 3S91A 4F52B 4QF2A 4UP0A 4I7DA 4LYWA 4QY4A 2QJ0A 4NYWA 3LJWA 2D82A 4HXKA 2M1RA 5L99A 4CUSA 2YURA 4UIWA 2RNWA 4LJNA 4O75A 4QYLA 5D1MB 5A7CA 3ZVYA 4PKLA 5KO4A 3RPGB 2VP7A 4UYFA 2LRIC 5HM0A 3T7LA 3LQJA 4WIVA 3K2JA 2ECGA 3AADA 4LDFA 3ZNIA 4O76A 4Z6HA 1BORA 4YATA 2ECIA 1WESA 4QSTA 3P5OA 4PTBA 2YHOA 5TDRA 5CQ4A 3KNVA 3FKMX 5FDZA 5HEMA 3DQVR 3KQIA 5D3PA 5B8DA 4YYKA 2MD8C 2K17A 3RCWA 5FG5A 3LXJA 5E73A 2XEUA 5H1VA 4A9IA 4Z1QA 3U5JA 2LGVA 4MENA 1MM3A 4I7CA 5CS8A 3ZVZB 4HXRA 1JSPB 1WE9A 3N9LA 4NRCA 3U5PA 2R0YA 3HMEA 4HBYA 4O78A 5ENBA 5DYUA 4CFLA 2LGGA 5A81A 1WEOA 5D1KB 2YW8A 4WA6A 5J0DA 5KH9A 5D3RA 5DYAA 2KIZA 4YABA 5A5RA 4IC2A 3IHPA 5CQ7A 5IIDA 2OUOA 4IOOA 4TQNA 2DVSA 1WFKA 3L1ZB 4TKPB 4BJXA 4CA1A 5H9MA 4LZRA 4BHWA 5IGMA 2YELA 5TCMA 4YH4A 4BW2A 1FBVA 3Q2EA 5CZGA 4A4CA 2DWWA 3MULA 1WEPA 2UZGA 5ENGA 4Z6IA 3O34A 5A83A 4YYMA 4MR4A 3U5KA 3SOWA 4NRBA 5FG6A 2RFJA 3O37A 4IR3A 2JMDA 2VJEA 5I3LA 2AN6A 4C67A 5F36A 5KTXA 3GV4A 5B75A 4LZSA 5L8UA 5C85A 2KYUA 2C2VS 4OGIA 3HCTA 4N4IA 5CQAA 3S92A 3U5NA 3MB4A 2KR4A 5DINA 4BBQA 1JM7A 3ZYUA 5DKHA 2MA5A 4PCEA 4WHUA 5LVQA 2LQ6A 3P1EA 2D9EA 5F3AA 5AMFA 1CHCA 3UW9A 5I1QA 2N9GA 4IOQA 3RTRB 5FH6A 5FERA 5FE9A 3HMHA 5EGUA 5HJCA 2VJFB 5HENA 4MR5A 4GNFA 5HQ5A 1LDKC 5I89A 5JI8A 2NXBA 2MJVB 5ENEA 2H0DA 4MSXA 5HFRA 4YYGA 4IR6A 4J0SA 4O72A 2K1JA 2YSMA 1WENA 3EB6A 5FE0A 4QYDA 2YYRA 5EWDA 5D25A 2MIQA 3P1CA 4YYJA 5CUGA 4NQMA 5LCWB 1X4JA 3HMFA 5EP7A 3L11A 4HXLA 2E6RA 2L5UA 4B86C 2LGKA 4I7BA 5ENHA 5I7YA 5EPBA 5F63A 1XWHA 5C4QA 5FEYA 5EPRA 3UV5A 1WEEA 2DX8A 1HYIA 2CKLB 3SOUA 2YDWA 4BW3A 2L84A 2E7OA 4KV1A 4O7CA 5D0CA 3Q2FA 2KWJA 5KTWA 4UYFB 5E3GA 1E4UA 4HBVA 4ALGA 4QEUA 5CUCA 1JOCA 2DATA 1LDJB 5LKUA 5EA1A 4TT2A 4LYIA 3DWYA 3SVFA 2KWKA 5D3LA 4J0RA 5A5SA 2L43A 2YU4A 2XB1A 4BW4A 2F6JA 3SHBA 3JVMA 2ECNA 5DYCA 4LRGA 4X2IA 5E3DA 5DKCA 5CUAA 2L75A 4UYDA 5FE7A 2H60A 4ZQLA 4UI9B 5I29A 4GPJA 5A82A 4TU4A 5EISA 5FB0A 3N9QA 4XY9A 5EU1A 4UIYA 3N9PA 5E9MA 3U5LA 4TTEA 2HYED 4HXSA 5CUEA 5FH7A 2PNXA 4PPEA 5HQ6A 4XI1A 3C5KA 4KV4A 5AITA 2G43A 4QEWA 4A49A 1WEQA 5C7NA 3ZYQA 5DLXA 1X4IA 4YY4A 2FSAA 5D24A 4WZ2A 5HCLA 1JM4B 4QSWA 5COIA 2K4DA 3O33A 3QZTA 5IGNA 2E3KA 5FB1A 4IR4A 5CQ8A 3M62A 2CT2A 5B76A 1K2FA 2F6NA 4MR3A 5AD2A 2CSZA 4S3OB 2VPDA 3LRQA 4R7EA 2E6SA 3PUQA 5BT5A 2M3HA 2MUMA 5B77A 5KH3A 2KREA 4LR6A 4NR4A 2ZETC 5A5QA 3O36A 3N9NA 4IC3A 2YT5A 4N4HA 2K16A 4L58A 4LYSA 5TBNA 2RNYA 5HRXA 2PUYA 2VJEB 5CRZA 3D7CA 5ENIA 4WZ3B 4YH3A 4RVRA 1WUMA 4QR3A 1ZBDB 3ZTGA 4QEVA 5LUUA 1VD4A 5FBXA 5ENFA 2YSJA 5FFVA 5F1LA 2QICA 2FUIA 4CUUA 1JM7B 2Y1NA 4DONA 4QC3A 2I8NA 5H1TA 4UP5A 4NYVA 4OUFA 1WUGA 5CFWA 4LADB 4TYLA 1WEVA 5G0FA 5F1HA 5AMEA 2EGPA 3ZPVE 5F5ZA 4TU6A 3G0LA 4QSSA 3O70A 3RPGC 5LKXA 5DY7A 2F42A 4AP4A 2RNXA 4QC1A 3LQIA 4QSXA 1U6GB 2HDPA 5KTUA 5JG6A 2H0DB 3JVLA 4P5OB 4QZSA 3VK6A 2OSSA 3UV2A 4N3WA 4AKNA 1DVPA 2LDRA 4GB0A 5IGLA 5FE4A 5EVAA 3EB5A 3SVGA 5LKTA 3SOXA 4UITA 4AYCA 5B78A 4NR9A 1X0JA 2YEMA 5A5NA 2VPEA 3I3JA 3QZVA 2KGGA 2YYNA 4MVTA 3JVKA 5KU3A 4HXOA 4J3IA 2JMIA 2OO1A 3DAIA 5H85A 3UVXA 5LJ2A 2ECTA 3N9MA 3GG3A 5HELA 4FIPA 4ALHA 5CPEA 4TT6A 5E9KA 5EWVA 5HRWA 5E9YA 5L8TA 4R8PK 4CUQA 5ENCA 5EPSA 2JRJA 4FK5A 2WP1A 4WHWA 4CFKA 3ASLA 2KWNA 5FE8A 5D3NA 2KU3A 3FL2A 5CQTA 4O64A 3T6RA 3MB3A 5L98A 3PURA 4QB3A 4Y03A 5FE3A 2FUUA 1VYXA 5F62A 5HFQA 2YQLA 4Z93A 5I7XA 3MHSA 4ZW1A 5AIUA 5EWCA 4HBWA 4LC2A 4Q6FA 1F62A 1E6IA 2E7NA 4LZ2A 5II1A 4A9HA 4ZDTA 5TB6A 4OGJA 5EV9A 2LXPC 5DBMA 4YADA 4NR7A 3I2DA 4V3LC 5FG4A 2YQDA 3U5MA 3IU5A 4NR5A 5I40A 2M85A 4O77A 2L85A 4NS5A 4ZC9A 1T1HA 4N4FA 5I83A 4UYEA 4J1PA 4UIXA 5D7XA 4NRAA 5DKDA 4MR6A 5DYXA 2L80A 1IYMA 4QSPA 5F2PA 3MQMA 4IR5A 4TS8A 4E96A 5IG6A 4PS5A
chains in the Genus database with same CATH superfamily
3HCUA 2RI7A 4N4GA 4LLBA 4NUCA 4PCIA 3HCSA 2DSMA 5C87A 5CUDA 3PHDA 2LN0A 4A9JA 3KV5A 2MNYA 4QR5A 2IDAA 4GNGA 4NUDA 2CSYA 2M6MA 4GNEA 4AUQB 2KTBB 3MHHA 4PY6A 3VKHA 2CRWA 5DKAA 5JWMA 2I50A 3ZPV1 5EYAF 3O7AA 4HXNA 1V87A 4OGCA 4YBSA 5EK9A 4UYGA 4NR8A 2CKLA 4NR6A 2G6QA 4F3IA 1WILA 2ECJA 1WIMA 5FH8A 5EM3A 2ECVA 5LKZA 4A9NA 3LVQE 2BAYA 5C89A 2KKYA 5ETDA 2L0BA 5TDWA 1FP0A 5TRBA 3Q1DA 2YHNA 4YYDA 3MDBC 5D3JA 5IGKA 2DVVA 4O7BA 5DFDA 4QSRA 4MEOA 1N72A 5DW1A 3M99A 5CQ5A 4CL9A 4QR4A 3LDYA 2LXHC 5CP5A 5G4SA 2R0VA 2VPBA 3UV4A 3U5OA 4C66A 1RMDA 2LV9A 5E74A 5A5PA 4A0CD 5IBNA 3JVJA 2YW5A 5FFWA 3UVDA 1N87A 2DVQA 5FE1A 3UVYA 4XUAA 5CGPA 4NUEA 2EJNA 4B7YC 5C11A 3D1BA 5E7DA 1VFYA 5CUBA 1WEWA 5D3SA 3LQHA 3FJUB 3VKGA 4Q0OA 2D8SA 4QSUA 4YY6A 1F68A 2LGLA 2C2LA 4QUTA 3KV6A 3NXBA 3L1XA 2QIZA 2KKXA 4CCGX 5I80A 4MEQA 5E9LA 4R2YA 4NN2A 4LK9A 2KE1A 5HQ7A 5J3XA 1WEUA 4AYCB 5CQ3A 2M13A 3MXFA 2DKWA 3O35A 5TABA 5BT4A 2I7KA 2R10A 3M63A 3P1FA 4HBXA 2YREA 5DX4A 5HLSA 4IORA 5A5OA 2DVRA 5AD3A 1Z60A 4TZ8A 4UIUA 5E9VA 5L97A 2OWAA 5F25A 4O71A 5CU8A 2KFTA 5DLZA 4A9KA 4QSVA 4A4BA 3UVWA 4A9LA 2MNZA 5G4RA 2R0SA 2EA6A 4CUTA 5FE6A 4YYNA 4FO9A 4CLBA 5ACYA 2G4AA 3JUEA 1ZS5A 5CQ6A 5F61A 3FM8C 5F60A 4O7FA 5FE2A 5DFCA 3ONIA 4YAXA 3SVHA 2MA6A 5HRVA 2NAAA 4HXPA 3D1DA 5LJ0A 4S3OC 5EQ1A 4XY8A 4YK0A 5DW2A 3TLPA 2MT5A 3AQAA 5SVIA 4HXMA 4AVXA 4QBMA 4O7AA 4YC9A 4H9DA 3V43A 5L96A 2Y1MA 4C9ZA 4TZ2A 1X4UA 4O70A 1WEMA 2RO1A 4A9OA 1G25A 3G0JA 4Q0NA 2L5EA 5B79A 2ECWA 5H1UA 2VNFA 2KWOA 2DJAA 4V3KC 5CTLA 5D26A 2OXQC 3LJUX 4A9EA 4YYIA 2Y43A 4GNDA 5C13A 3MUKA 5DFBA 4Z1SA 4NXJA 1WGMA 5A85A 4KCXA 4TT4A 4UYHA 5G04B 5D3HA 4NYXA 5I88A 3QZSA 2WP2A 4QNSA 2XOZA 4QSQA 4XYAA 4XUBA 4O74A 5EICA 5II2A 4CURA 4WZ0A 3HTKC 5D3TA 5D1LB 2YUCA 2YEKA 4O7EA 1Z2QA 2JMJA 5KHMA 4A9MA 3DWDA 3C6WA 5E0RA 4YYHA 5C8GA 3IU6A 4QUUA 4YBTA 3NG2A 5BT3A 3N9OA 5LJ1A 2VJFA 3DPLR 2LSPB 4ZUXU 5CY9A 4UIVA 5I86A 2MD7B 5EWWA 2VPGA 1HYJA 5KH7A 4NQNA 4LKAA 4FLPA 4A9FA 4W4UA 2KGIA 1Z6UA 4MEPA 4YBMA 2RSDA 4CUPA 5E9IA 5FFYA 5CRMA 5ENJA 2G45A 5EI4A 5K29A 3P1DA 2YQMA 4QF3A 1MM2A 3GL6A 4X3GA 2GRCA 1EQFA 2EODA 3DDTA 5EWHA 5LVRA 4L7XA 4UIZA 4FJCA 2RS9B 5FE5A 5ETBA 4BW1A 5G05B 3S91A 3E2DA 4F52B 4QF2A 4UP0A 4I7DA 4LYWA 4QY4A 2QJ0A 4NYWA 3LJWA 2D82A 4HXKA 2M1RA 5L99A 4CUSA 2YURA 4UIWA 2RNWA 4LJNA 4O75A 4QYLA 5D1MB 5A7CA 3ZVYA 4PKLA 5KO4A 3RPGB 2VP7A 4UYFA 2LRIC 3FEHA 5HM0A 3T7LA 3LQJA 4WIVA 2CSVA 3K2JA 4AKGA 3AADA 4LDFA 2ECGA 4O76A 4Z6HA 3ZNIA 1BORA 4YATA 2ECIA 1WESA 4QSTA 3P5OA 4PTBA 2YHOA 2XOYA 5TDRA 5CQ4A 3KNVA 2MKEA 3FKMX 5FDZA 5HEMA 3DQVR 3KQIA 5D3PA 5B8DA 4AKHA 4YYKA 2MD8C 2K17A 3RCWA 5FG5A 3LXJA 5E73A 2XEUA 5H1VA 4A9IA 4Z1QA 3U5JA 2LGVA 4MENA 1MM3A 4I7CA 5CS8A 3ZVZB 4HXRA 1JSPB 1WE9A 3N9LA 4NRCA 3U5PA 2R0YA 3HMEA 4HBYA 4O78A 5ENBA 5DYUA 4CFLA 2LGGA 5A81A 1WEOA 5D1KB 5SVXA 2YW8A 4WA6A 5J0DA 5KH9A 5D3RA 5DYAA 2KIZA 4YABA 5A5RA 4IC2A 3IHPA 5CQ7A 5IIDA 2EGMA 3FAOA 2OUOA 4IOOA 4TQNA 4OGEA 2DVSA 1WFKA 3L1ZB 4TKPB 1PUOA 4BJXA 4CA1A 3SUBA 5H9MA 4LZRA 4BHWA 5IGMA 2YELA 5TCMA 4YH4A 4BW2A 1FBVA 3Q2EA 5CZGA 4A4CA 2DWWA 3MULA 1WEPA 2UZGA 5ENGA 4Z6IA 3O34A 5A83A 4YYMA 4MR4A 3U5KA 4F1PA 3SOWA 4NRBA 5FG6A 2RFJA 3O37A 4IR3A 2JMDA 2VJEA 5I3LA 3M7KA 2AN6A 4C67A 5F36A 5KTXA 3GV4A 5B75A 4LZSA 5L8UA 5C85A 2KYUA 2C2VS 4OGIA 3HCTA 4N4IA 5CQAA 3S92A 3U5NA 3MB4A 2KR4A 5DINA 4BBQA 1JM7A 3ZYUA 5DKHA 2MA5A 4PCEA 4WHUA 5LVQA 3LVRE 2LQ6A 3P1EA 2D9EA 5F3AA 5AMFA 1CHCA 3UW9A 5I1QA 2N9GA 4IOQA 3RTRB 5FH6A 5FERA 5FE9A 3HMHA 5EGUA 5HJCA 2VJFB 5HENA 4MR5A 4GNFA 5HQ5A 1LDKC 5I89A 5JI8A 2NXBA 2MJVB 5ENEA 2H0DA 4MSXA 2YVRA 5HFRA 4YYGA 4IR6A 4J0SA 4O72A 2K1JA 2YSMA 1WENA 3EB6A 5FE0A 4QYDA 2YYRA 5EWDA 5D25A 2MIQA 3P1CA 4YYJA 5CUGA 4NQMA 5LCWB 1X4JA 3HMFA 5EP7A 3L11A 4HXLA 2E6RA 2L5UA 4B86C 2LGKA 4I7BA 5ENHA 5I7YA 5EPBA 5F63A 1XWHA 5C4QA 5FEYA 5EPRA 3UV5A 1WEEA 2DX8A 1HYIA 2CKLB 3SOUA 2YDWA 4BW3A 2IQJA 2L84A 3O47A 2E7OA 4KV1A 2XP0A 4O7CA 5D0CA 3Q2FA 2KWJA 5KTWA 4UYFB 5E3GA 1E4UA 4HBVA 4ALGA 2FD4A 4QEUA 5CUCA 1JOCA 2DATA 1LDJB 5LKUA 4Z0RA 5EA1A 4TT2A 4LYIA 3DWYA 1MBMA 3SVFA 2CONA 2KWKA 5D3LA 4J0RA 5A5SA 2L43A 2YU4A 2XB1A 4BW4A 2D8UA 2EXUA 2F6JA 3SHBA 3JVMA 2ECNA 5DYCA 4LRGA 4X2IA 5E3DA 5DKCA 5CUAA 2L75A 4UYDA 5FE7A 2H60A 4ZQLA 4UI9B 5I29A 4GPJA 5A82A 4TU4A 5EISA 5FB0A 3N9QA 4XY9A 5EU1A 4UIYA 2JM3A 3N9PA 5E9MA 3U5LA 4TTEA 2HYED 4HXSA 5CUEA 5FH7A 2PNXA 4PPEA 3ERRA 5HQ6A 2P57A 4XI1A 3C5KA 4KV4A 5AITA 2G43A 4QEWA 4A49A 1WEQA 5C7NA 3ZYQA 5DLXA 1X4IA 4YY4A 2FSAA 5D24A 4WZ2A 5HCLA 1JM4B 4QSWA 5COIA 5K3QA 2K4DA 3O33A 3QZTA 5IGNA 2E3KA 5FB1A 4IR4A 5CQ8A 2XOCA 3M62A 2CT2A 2E61A 5B76A 4O62A 1K2FA 2F6NA 4MR3A 5AD2A 2CSZA 4S3OB 2VPDA 3LRQA 4R7EA 2E6SA 3PUQA 5BT5A 2M3HA 2MUMA 5B77A 5KH3A 2LAUA 2KREA 4LR6A 4NR4A 2ZETC 5A5QA 4QQ4A 3O36A 3N9NA 3FANA 2YT5A 4N4HA 2K16A 4IC3A 4LYSA 4L58A 5TBNA 2RNYA 5HRXA 2PUYA 2VJEB 5CRZA 3D7CA 5ENIA 4WZ3B 5SVIB 4YH3A 4RVRA 1WUMA 4QR3A 1ZBDB 2RR4A 3ZTGA 4QEVA 1DCQA 5LUUA 1VD4A 5FBXA 5ENFA 2YSJA 5FFVA 5F1LA 2QICA 2FUIA 4CUUA 1JM7B 2Y1NA 4DONA 4QC3A 2I8NA 3KDEC 5H1TA 4UP5A 4NYVA 1ZKRA 1WUGA 4OUFA 5CFWA 4LADB 4TYLA 1WEVA 5G0FA 3T9KA 5F1HA 5AMEA 2EGPA 2B0OE 3ZPVE 5F5ZA 4TU6A 3G0LA 4QSSA 3O70A 3RPGC 5LKXA 5DY7A 2F42A 4AP4A 2RNXA 4AI6A 4QC1A 3LQIA 4QSXA 1U6GB 2HDPA 5KTUA 2FFWA 2H0DB 5JG6A 3JVLA 4P5OB 4QZSA 3VK6A 2OSSA 3UV2A 4N3WA 4AKNA 1DVPA 2LDRA 4GB0A 5IGLA 5FE4A 5EVAA 3EB5A 3SVGA 5LKTA 3SOXA 4UITA 4AYCA 5B78A 4NR9A 1X0JA 2YEMA 5A5NA 2VPEA 3I3JA 3QZVA 2KGGA 2YYNA 4MVTA 3JVKA 5KU3A 4HXOA 4J3IA 2JMIA 2OO1A 3DAIA 5H85A 3UVXA 5LJ2A 2ECTA 2JUNA 3GG3A 5HELA 3N9MA 4ALHA 5CPEA 4TT6A 4FIPA 5E9KA 5EWVA 5HRWA 5E9YA 5L8TA 4R8PK 4CUQA 4Z0OA 5ENCA 5EPSA 2JRJA 4FK5A 2WP1A 4WHWA 4CFKA 3ASLA 2KWNA 5FE8A 5D3NA 2KU3A 3FL2A 5CQTA 4O64A 3T6RA 3MB3A 5L98A 3PURA 4QB3A 4Y03A 5FE3A 2L7PA 2FUUA 1VYXA 5F62A 5HFQA 2YQLA 4Z93A 5I7XA 3MHSA 4ZW1A 5AIUA 5EWCA 4HBWA 4LC2A 4Q6FA 4AKIA 1F62A 1E6IA 2E7NA 4LZ2A 5II1A 4A9HA 5SVYA 4ZDTA 5TB6A 4OGJA 5EV9A 2LXPC 5DBMA 4YADA 4NR7A 3I2DA 4V3LC 5FG4A 2CRRA 2YQDA 3U5MA 3IU5A 4NR5A 5I40A 2M85A 4O77A 2L85A 4NS5A 4ZC9A 1T1HA 4N4FA 5I83A 4UYEA 4J1PA 4UIXA 5D7XA 4NRAA 5DKDA 4MR6A 3H7HA 5DYXA 2L80A 1IYMA 4QSPA 5F2PA 3MQMA 4IR5A 3PLWA 4TS8A 4E96A 5IG6A 4PS5A
chains in the Genus database with same CATH topology
3HCUA 2RI7A 4N4GA 4LLBA 4NUCA 4PCIA 3HCSA 5C87A 5CUDA 3PHDA 2LN0A 4A9JA 3KV5A 2MNYA 4QR5A 2IDAA 4GNGA 4NUDA 2CSYA 2M6MA 4GNEA 4AUQB 2KTBB 3MHHA 4PY6A 3ZPV1 5DKAA 5JWMA 2I50A 5EYAF 3O7AA 4HXNA 1V87A 4YBSA 5EK9A 4UYGA 4NR8A 2CKLA 4NR6A 2G6QA 4F3IA 1WILA 2ECJA 1WIMA 5FH8A 5EM3A 2ECVA 5LKZA 4A9NA 2BAYA 5C89A 5ETDA 2L0BA 5TDWA 1FP0A 5TRBA 2YHNA 4YYDA 5D3JA 5IGKA 2DVVA 4O7BA 5DFDA 4QSRA 4MEOA 1N72A 5DW1A 3M99A 5CQ5A 4CL9A 4QR4A 2LXHC 5CP5A 5G4SA 2R0VA 2VPBA 3UV4A 3U5OA 4C66A 1RMDA 2LV9A 5E74A 5A5PA 4A0CD 5IBNA 3JVJA 2YW5A 5FFWA 3UVDA 1N87A 2DVQA 5FE1A 3UVYA 4XUAA 5CGPA 4NUEA 4B7YC 5C11A 5E7DA 1VFYA 1WEWA 5CUBA 5D3SA 3LQHA 4Q0OA 2D8SA 4QSUA 4YY6A 1F68A 2LGLA 2C2LA 4QUTA 3KV6A 3NXBA 3L1XA 2QIZA 4CCGX 5I80A 4MEQA 5E9LA 4R2YA 4NN2A 4LK9A 2KE1A 5HQ7A 5J3XA 1WEUA 4AYCB 5CQ3A 3MXFA 2DKWA 3O35A 5TABA 5BT4A 2I7KA 2R10A 3M63A 3P1FA 4HBXA 2YREA 5DX4A 5HLSA 4IORA 5A5OA 2DVRA 5AD3A 1Z60A 4TZ8A 4UIUA 5E9VA 5L97A 5F25A 4O71A 5CU8A 2KFTA 5DLZA 4A9KA 4QSVA 4A4BA 3UVWA 4A9LA 2MNZA 5G4RA 2R0SA 2EA6A 4CUTA 5FE6A 4YYNA 4FO9A 4CLBA 5ACYA 2G4AA 1ZS5A 5CQ6A 5F61A 5F60A 4O7FA 5FE2A 5DFCA 3ONIA 4YAXA 3SVHA 2MA6A 5HRVA 2NAAA 4HXPA 5LJ0A 4S3OC 5EQ1A 4XY8A 4YK0A 5DW2A 3TLPA 2MT5A 3AQAA 4AVXA 4HXMA 4QBMA 4O7AA 4YC9A 3V43A 5L96A 2Y1MA 4C9ZA 4TZ2A 1X4UA 4O70A 1WEMA 2RO1A 4A9OA 1G25A 3G0JA 4Q0NA 2L5EA 5B79A 2ECWA 5H1UA 2VNFA 2KWOA 4V3KC 5CTLA 5D26A 2OXQC 4A9EA 4YYIA 2Y43A 4GNDA 5C13A 3MUKA 5DFBA 4Z1SA 4NXJA 1WGMA 5A85A 4KCXA 4TT4A 4UYHA 5G04B 5D3HA 4NYXA 5I88A 3QZSA 2WP2A 4QNSA 4QSQA 4XYAA 4XUBA 4O74A 5EICA 5II2A 4CURA 4WZ0A 3HTKC 5D3TA 5D1LB 2YUCA 2YEKA 4O7EA 1Z2QA 2JMJA 5KHMA 4A9MA 3C6WA 5E0RA 4YYHA 5C8GA 3IU6A 4QUUA 4YBTA 3NG2A 5BT3A 3N9OA 5LJ1A 2VJFA 3DPLR 2LSPB 4ZUXU 5CY9A 4UIVA 5I86A 2MD7B 5EWWA 2VPGA 1HYJA 5KH7A 4NQNA 4LKAA 4FLPA 4A9FA 4W4UA 2KGIA 1Z6UA 4MEPA 4YBMA 2RSDA 4CUPA 5E9IA 5FFYA 5CRMA 5ENJA 2G45A 5EI4A 5K29A 3P1DA 2YQMA 4QF3A 1MM2A 3GL6A 4X3GA 2GRCA 1EQFA 2EODA 5EWHA 5LVRA 4L7XA 4UIZA 4FJCA 2RS9B 5FE5A 5ETBA 4BW1A 5G05B 3S91A 4F52B 4QF2A 4UP0A 4I7DA 4LYWA 4QY4A 2QJ0A 4NYWA 3LJWA 2D82A 4HXKA 2M1RA 5L99A 4CUSA 2YURA 4UIWA 2RNWA 4LJNA 4O75A 4QYLA 5D1MB 5A7CA 3ZVYA 4PKLA 5KO4A 3RPGB 2VP7A 4UYFA 2LRIC 5HM0A 3T7LA 3LQJA 4WIVA 3K2JA 2ECGA 3AADA 4LDFA 3ZNIA 4O76A 4Z6HA 1BORA 4YATA 2ECIA 1WESA 4QSTA 3P5OA 4PTBA 2YHOA 5TDRA 5CQ4A 3KNVA 3FKMX 5FDZA 5HEMA 3DQVR 3KQIA 5D3PA 5B8DA 4YYKA 2MD8C 2K17A 3RCWA 5FG5A 3LXJA 5E73A 2XEUA 5H1VA 4A9IA 4Z1QA 3U5JA 2LGVA 4MENA 1MM3A 4I7CA 5CS8A 3ZVZB 4HXRA 1JSPB 1WE9A 3N9LA 4NRCA 3U5PA 2R0YA 3HMEA 4HBYA 4O78A 5ENBA 5DYUA 4CFLA 2LGGA 5A81A 1WEOA 5D1KB 2YW8A 4WA6A 5J0DA 5KH9A 5D3RA 5DYAA 2KIZA 4YABA 5A5RA 4IC2A 3IHPA 5CQ7A 5IIDA 2OUOA 4IOOA 4TQNA 2DVSA 1WFKA 3L1ZB 4TKPB 4BJXA 4CA1A 5H9MA 4LZRA 4BHWA 5IGMA 2YELA 5TCMA 4YH4A 4BW2A 1FBVA 3Q2EA 5CZGA 4A4CA 2DWWA 3MULA 1WEPA 2UZGA 5ENGA 4Z6IA 3O34A 5A83A 4YYMA 4MR4A 3U5KA 3SOWA 4NRBA 5FG6A 2RFJA 3O37A 4IR3A 2JMDA 2VJEA 5I3LA 2AN6A 4C67A 5F36A 5KTXA 3GV4A 5B75A 4LZSA 5L8UA 5C85A 2KYUA 2C2VS 4OGIA 3HCTA 4N4IA 5CQAA 3S92A 3U5NA 3MB4A 2KR4A 5DINA 4BBQA 1JM7A 3ZYUA 5DKHA 2MA5A 4PCEA 4WHUA 5LVQA 2LQ6A 3P1EA 2D9EA 5F3AA 5AMFA 1CHCA 3UW9A 5I1QA 2N9GA 4IOQA 3RTRB 5FH6A 5FERA 5FE9A 3HMHA 5EGUA 5HJCA 2VJFB 5HENA 4MR5A 4GNFA 5HQ5A 1LDKC 5I89A 5JI8A 2NXBA 2MJVB 5ENEA 2H0DA 4MSXA 5HFRA 4YYGA 4IR6A 4J0SA 4O72A 2K1JA 2YSMA 1WENA 3EB6A 5FE0A 4QYDA 2YYRA 5EWDA 5D25A 2MIQA 3P1CA 4YYJA 5CUGA 4NQMA 5LCWB 1X4JA 3HMFA 5EP7A 3L11A 4HXLA 2E6RA 2L5UA 4B86C 2LGKA 4I7BA 5ENHA 5I7YA 5EPBA 5F63A 1XWHA 5C4QA 5FEYA 5EPRA 3UV5A 1WEEA 2DX8A 1HYIA 2CKLB 3SOUA 2YDWA 4BW3A 2L84A 2E7OA 4KV1A 4O7CA 5D0CA 3Q2FA 2KWJA 5KTWA 4UYFB 5E3GA 1E4UA 4HBVA 4ALGA 4QEUA 5CUCA 1JOCA 2DATA 1LDJB 5LKUA 5EA1A 4TT2A 4LYIA 3DWYA 3SVFA 2KWKA 5D3LA 4J0RA 5A5SA 2L43A 2YU4A 2XB1A 4BW4A 2F6JA 3SHBA 3JVMA 2ECNA 5DYCA 4LRGA 4X2IA 5E3DA 5DKCA 5CUAA 2L75A 4UYDA 5FE7A 2H60A 4ZQLA 4UI9B 5I29A 4GPJA 5A82A 4TU4A 5EISA 5FB0A 3N9QA 4XY9A 5EU1A 4UIYA 3N9PA 5E9MA 3U5LA 4TTEA 2HYED 4HXSA 5CUEA 5FH7A 2PNXA 4PPEA 5HQ6A 4XI1A 3C5KA 4KV4A 5AITA 2G43A 4QEWA 4A49A 1WEQA 5C7NA 3ZYQA 5DLXA 1X4IA 4YY4A 2FSAA 5D24A 4WZ2A 5HCLA 1JM4B 4QSWA 5COIA 2K4DA 3O33A 3QZTA 5IGNA 2E3KA 5FB1A 4IR4A 5CQ8A 3M62A 2CT2A 5B76A 1K2FA 2F6NA 4MR3A 5AD2A 2CSZA 4S3OB 2VPDA 3LRQA 4R7EA 2E6SA 3PUQA 5BT5A 2M3HA 2MUMA 5B77A 5KH3A 2KREA 4LR6A 4NR4A 2ZETC 5A5QA 3O36A 3N9NA 4IC3A 2YT5A 4N4HA 2K16A 4L58A 4LYSA 5TBNA 2RNYA 5HRXA 2PUYA 2VJEB 5CRZA 3D7CA 5ENIA 4WZ3B 4YH3A 4RVRA 1WUMA 4QR3A 1ZBDB 3ZTGA 4QEVA 5LUUA 1VD4A 5FBXA 5ENFA 2YSJA 5FFVA 5F1LA 2QICA 2FUIA 4CUUA 1JM7B 2Y1NA 4DONA 4QC3A 2I8NA 5H1TA 4UP5A 4NYVA 4OUFA 1WUGA 5CFWA 4LADB 4TYLA 1WEVA 5G0FA 5F1HA 5AMEA 2EGPA 3ZPVE 5F5ZA 4TU6A 3G0LA 4QSSA 3O70A 3RPGC 5LKXA 5DY7A 2F42A 4AP4A 2RNXA 4QC1A 3LQIA 4QSXA 1U6GB 2HDPA 5KTUA 5JG6A 2H0DB 3JVLA 4P5OB 4QZSA 3VK6A 2OSSA 3UV2A 4N3WA 4AKNA 1DVPA 2LDRA 4GB0A 5IGLA 5FE4A 5EVAA 3EB5A 3SVGA 5LKTA 3SOXA 4UITA 4AYCA 5B78A 4NR9A 1X0JA 2YEMA 5A5NA 2VPEA 3I3JA 3QZVA 2KGGA 2YYNA 4MVTA 3JVKA 5KU3A 4HXOA 4J3IA 2JMIA 2OO1A 3DAIA 5H85A 3UVXA 5LJ2A 2ECTA 3N9MA 3GG3A 5HELA 4FIPA 4ALHA 5CPEA 4TT6A 5E9KA 5EWVA 5HRWA 5E9YA 5L8TA 4R8PK 4CUQA 5ENCA 5EPSA 2JRJA 4FK5A 2WP1A 4WHWA 4CFKA 3ASLA 2KWNA 5FE8A 5D3NA 2KU3A 3FL2A 5CQTA 4O64A 3T6RA 3MB3A 5L98A 3PURA 4QB3A 4Y03A 5FE3A 2FUUA 1VYXA 5F62A 5HFQA 2YQLA 4Z93A 5I7XA 3MHSA 4ZW1A 5AIUA 5EWCA 4HBWA 4LC2A 4Q6FA 1F62A 1E6IA 2E7NA 4LZ2A 5II1A 4A9HA 4ZDTA 5TB6A 4OGJA 5EV9A 2LXPC 5DBMA 4YADA 4NR7A 3I2DA 4V3LC 5FG4A 2YQDA 3U5MA 3IU5A 4NR5A 5I40A 2M85A 4O77A 2L85A 4NS5A 4ZC9A 1T1HA 4N4FA 5I83A 4UYEA 4J1PA 4UIXA 5D7XA 4NRAA 5DKDA 4MR6A 5DYXA 2L80A 1IYMA 4QSPA 5F2PA 3MQMA 4IR5A 4TS8A 4E96A 5IG6A 4PS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCU A;  2RI7 A;  4N4G A;  4LLB A;  4NUC A;  4PCI A;  3HCS A;  5C87 A;  5CUD A;  3PHD A;  2LN0 A;  4A9J A;  3KV5 A;  2MNY A;  4QR5 A;  2IDA A;  4GNG A;  4NUD A;  2CSY A;  2M6M A;  4GNE A;  4AUQ B;  2KTB B;  3MHH A;  4PY6 A;  3ZPV 1;  5DKA A;  5JWM A;  2I50 A;  5EYA F;  3O7A A;  4HXN A;  1V87 A;  4YBS A;  5EK9 A;  4UYG A;  4NR8 A;  2CKL A;  4NR6 A;  2G6Q A;  4F3I A;  1WIL A;  2ECJ A;  1WIM A;  5FH8 A;  5EM3 A;  2ECV A;  5LKZ A;  4A9N A;  2BAY A;  5C89 A;  5ETD A;  2L0B A;  5TDW A;  1FP0 A;  5TRB A;  2YHN A;  4YYD A;  5D3J A;  5IGK A;  2DVV A;  4O7B A;  5DFD A;  4QSR A;  4MEO A;  1N72 A;  5DW1 A;  3M99 A;  5CQ5 A;  4CL9 A;  4QR4 A;  2LXH C;  5CP5 A;  5G4S A;  2R0V A;  2VPB A;  3UV4 A;  3U5O A;  4C66 A;  1RMD A;  2LV9 A;  5E74 A;  5A5P A;  4A0C D;  5IBN A;  3JVJ A;  2YW5 A;  5FFW A;  3UVD A;  1N87 A;  2DVQ A;  5FE1 A;  3UVY A;  4XUA A;  5CGP A;  4NUE A;  4B7Y C;  5C11 A;  5E7D A;  1VFY A;  1WEW A;  5CUB A;  5D3S A;  3LQH A;  4Q0O A;  2D8S A;  4QSU A;  4YY6 A;  1F68 A;  2LGL A;  2C2L A;  4QUT A;  3KV6 A;  3NXB A;  3L1X A;  2QIZ A;  4CCG X;  5I80 A;  4MEQ A;  5E9L A;  4R2Y A;  4NN2 A;  4LK9 A;  2KE1 A;  5HQ7 A;  5J3X A;  1WEU A;  4AYC B;  5CQ3 A;  3MXF A;  2DKW A;  3O35 A;  5TAB A;  5BT4 A;  2I7K A;  2R10 A;  3M63 A;  3P1F A;  4HBX A;  2YRE A;  5DX4 A;  5HLS A;  4IOR A;  5A5O A;  2DVR A;  5AD3 A;  1Z60 A;  4TZ8 A;  4UIU A;  5E9V A;  5L97 A;  5F25 A;  4O71 A;  5CU8 A;  2KFT A;  5DLZ A;  4A9K A;  4QSV A;  4A4B A;  3UVW A;  4A9L A;  2MNZ A;  5G4R A;  2R0S A;  2EA6 A;  4CUT A;  5FE6 A;  4YYN A;  4FO9 A;  4CLB A;  5ACY A;  2G4A A;  1ZS5 A;  5CQ6 A;  5F61 A;  5F60 A;  4O7F A;  5FE2 A;  5DFC A;  3ONI A;  4YAX A;  3SVH A;  2MA6 A;  5HRV A;  2NAA A;  4HXP A;  5LJ0 A;  4S3O C;  5EQ1 A;  4XY8 A;  4YK0 A;  5DW2 A;  3TLP A;  2MT5 A;  3AQA A;  4AVX A;  4HXM A;  4QBM A;  4O7A A;  4YC9 A;  3V43 A;  5L96 A;  2Y1M A;  4C9Z A;  4TZ2 A;  1X4U A;  4O70 A;  1WEM A;  2RO1 A;  4A9O A;  1G25 A;  3G0J A;  4Q0N A;  2L5E A;  5B79 A;  2ECW A;  5H1U A;  2VNF A;  2KWO A;  4V3K C;  5CTL A;  5D26 A;  2OXQ C;  4A9E A;  4YYI A;  2Y43 A;  4GND A;  5C13 A;  3MUK A;  5DFB A;  4Z1S A;  4NXJ A;  1WGM A;  5A85 A;  4KCX A;  4TT4 A;  4UYH A;  5G04 B;  5D3H A;  4NYX A;  5I88 A;  3QZS A;  2WP2 A;  4QNS A;  4QSQ A;  4XYA A;  4XUB A;  4O74 A;  5EIC A;  5II2 A;  4CUR A;  4WZ0 A;  3HTK C;  5D3T A;  5D1L B;  2YUC A;  2YEK A;  4O7E A;  1Z2Q A;  2JMJ A;  5KHM A;  4A9M A;  3C6W A;  5E0R A;  4YYH A;  5C8G A;  3IU6 A;  4QUU A;  4YBT A;  3NG2 A;  5BT3 A;  3N9O A;  5LJ1 A;  2VJF A;  3DPL R;  2LSP B;  4ZUX U;  5CY9 A;  4UIV A;  5I86 A;  2MD7 B;  5EWW A;  2VPG A;  1HYJ A;  5KH7 A;  4NQN A;  4LKA A;  4FLP A;  4A9F A;  4W4U A;  2KGI A;  1Z6U A;  4MEP A;  4YBM A;  2RSD A;  4CUP A;  5E9I A;  5FFY A;  5CRM A;  5ENJ A;  2G45 A;  5EI4 A;  5K29 A;  3P1D A;  2YQM A;  4QF3 A;  1MM2 A;  3GL6 A;  4X3G A;  2GRC A;  1EQF A;  2EOD A;  5EWH A;  5LVR A;  4L7X A;  4UIZ A;  4FJC A;  2RS9 B;  5FE5 A;  5ETB A;  4BW1 A;  5G05 B;  3S91 A;  4F52 B;  4QF2 A;  4UP0 A;  4I7D A;  4LYW A;  4QY4 A;  2QJ0 A;  4NYW A;  3LJW A;  2D82 A;  4HXK A;  2M1R A;  5L99 A;  4CUS A;  2YUR A;  4UIW A;  2RNW A;  4LJN A;  4O75 A;  4QYL A;  5D1M B;  5A7C A;  3ZVY A;  4PKL A;  5KO4 A;  3RPG B;  2VP7 A;  4UYF A;  2LRI C;  5HM0 A;  3T7L A;  3LQJ A;  4WIV A;  3K2J A;  2ECG A;  3AAD A;  4LDF A;  3ZNI A;  4O76 A;  4Z6H A;  1BOR A;  4YAT A;  2ECI A;  1WES A;  4QST A;  3P5O A;  4PTB A;  2YHO A;  5TDR A;  5CQ4 A;  3KNV A;  3FKM X;  5FDZ A;  5HEM A;  3DQV R;  3KQI A;  5D3P A;  5B8D A;  4YYK A;  2MD8 C;  2K17 A;  3RCW A;  5FG5 A;  3LXJ A;  5E73 A;  2XEU A;  5H1V A;  4A9I A;  4Z1Q A;  3U5J A;  2LGV A;  4MEN A;  1MM3 A;  4I7C A;  5CS8 A;  3ZVZ B;  4HXR A;  1JSP B;  1WE9 A;  3N9L A;  4NRC A;  3U5P A;  2R0Y A;  3HME A;  4HBY A;  4O78 A;  5ENB A;  5DYU A;  4CFL A;  2LGG A;  5A81 A;  1WEO A;  5D1K B;  2YW8 A;  4WA6 A;  5J0D A;  5KH9 A;  5D3R A;  5DYA A;  2KIZ A;  4YAB A;  5A5R A;  4IC2 A;  3IHP A;  5CQ7 A;  5IID A;  2OUO A;  4IOO A;  4TQN A;  2DVS A;  1WFK A;  3L1Z B;  4TKP B;  4BJX A;  4CA1 A;  5H9M A;  4LZR A;  4BHW A;  5IGM A;  2YEL A;  5TCM A;  4YH4 A;  4BW2 A;  1FBV A;  3Q2E A;  5CZG A;  4A4C A;  2DWW A;  3MUL A;  1WEP A;  2UZG A;  5ENG A;  4Z6I A;  3O34 A;  5A83 A;  4YYM A;  4MR4 A;  3U5K A;  3SOW A;  4NRB A;  5FG6 A;  2RFJ A;  3O37 A;  4IR3 A;  2JMD A;  2VJE A;  5I3L A;  2AN6 A;  4C67 A;  5F36 A;  5KTX A;  3GV4 A;  5B75 A;  4LZS A;  5L8U A;  5C85 A;  2KYU A;  2C2V S;  4OGI A;  3HCT A;  4N4I A;  5CQA A;  3S92 A;  3U5N A;  3MB4 A;  2KR4 A;  5DIN A;  4BBQ A;  1JM7 A;  3ZYU A;  5DKH A;  2MA5 A;  4PCE A;  4WHU A;  5LVQ A;  2LQ6 A;  3P1E A;  2D9E A;  5F3A A;  5AMF A;  1CHC A;  3UW9 A;  5I1Q A;  2N9G A;  4IOQ A;  3RTR B;  5FH6 A;  5FER A;  5FE9 A;  3HMH A;  5EGU A;  5HJC A;  2VJF B;  5HEN A;  4MR5 A;  4GNF A;  5HQ5 A;  1LDK C;  5I89 A;  5JI8 A;  2NXB A;  2MJV B;  5ENE A;  2H0D A;  4MSX A;  5HFR A;  4YYG A;  4IR6 A;  4J0S A;  4O72 A;  2K1J A;  2YSM A;  1WEN A;  3EB6 A;  5FE0 A;  4QYD A;  2YYR A;  5EWD A;  5D25 A;  2MIQ A;  3P1C A;  4YYJ A;  5CUG A;  4NQM A;  5LCW B;  1X4J A;  3HMF A;  5EP7 A;  3L11 A;  4HXL A;  2E6R A;  2L5U A;  4B86 C;  2LGK A;  4I7B A;  5ENH A;  5I7Y A;  5EPB A;  5F63 A;  1XWH A;  5C4Q A;  5FEY A;  5EPR A;  3UV5 A;  1WEE A;  2DX8 A;  1HYI A;  2CKL B;  3SOU A;  2YDW A;  4BW3 A;  2L84 A;  2E7O A;  4KV1 A;  4O7C A;  5D0C A;  3Q2F A;  2KWJ A;  5KTW A;  4UYF B;  5E3G A;  1E4U A;  4HBV A;  4ALG A;  4QEU A;  5CUC A;  1JOC A;  2DAT A;  1LDJ B;  5LKU A;  5EA1 A;  4TT2 A;  4LYI A;  3DWY A;  3SVF A;  2KWK A;  5D3L A;  4J0R A;  5A5S A;  2L43 A;  2YU4 A;  2XB1 A;  4BW4 A;  2F6J A;  3SHB A;  3JVM A;  2ECN A;  5DYC A;  4LRG A;  4X2I A;  5E3D A;  5DKC A;  5CUA A;  2L75 A;  4UYD A;  5FE7 A;  2H60 A;  4ZQL A;  4UI9 B;  5I29 A;  4GPJ A;  5A82 A;  4TU4 A;  5EIS A;  5FB0 A;  3N9Q A;  4XY9 A;  5EU1 A;  4UIY A;  3N9P A;  5E9M A;  3U5L A;  4TTE A;  2HYE D;  4HXS A;  5CUE A;  5FH7 A;  2PNX A;  4PPE A;  5HQ6 A;  4XI1 A;  3C5K A;  4KV4 A;  5AIT A;  2G43 A;  4QEW A;  4A49 A;  1WEQ A;  5C7N A;  3ZYQ A;  5DLX A;  1X4I A;  4YY4 A;  2FSA A;  5D24 A;  4WZ2 A;  5HCL A;  1JM4 B;  4QSW A;  5COI A;  2K4D A;  3O33 A;  3QZT A;  5IGN A;  2E3K A;  5FB1 A;  4IR4 A;  5CQ8 A;  3M62 A;  2CT2 A;  5B76 A;  1K2F A;  2F6N A;  4MR3 A;  5AD2 A;  2CSZ A;  4S3O B;  2VPD A;  3LRQ A;  4R7E A;  2E6S A;  3PUQ A;  5BT5 A;  2M3H A;  2MUM A;  5B77 A;  5KH3 A;  2KRE A;  4LR6 A;  4NR4 A;  2ZET C;  5A5Q A;  3O36 A;  3N9N A;  4IC3 A;  2YT5 A;  4N4H A;  2K16 A;  4L58 A;  4LYS A;  5TBN A;  2RNY A;  5HRX A;  2PUY A;  2VJE B;  5CRZ A;  3D7C A;  5ENI A;  4WZ3 B;  4YH3 A;  4RVR A;  1WUM A;  4QR3 A;  1ZBD B;  3ZTG A;  4QEV A;  5LUU A;  1VD4 A;  5FBX A;  5ENF A;  2YSJ A;  5FFV A;  5F1L A;  2QIC A;  2FUI A;  4CUU A;  1JM7 B;  2Y1N A;  4DON A;  4QC3 A;  2I8N A;  5H1T A;  4UP5 A;  4NYV A;  4OUF A;  1WUG A;  5CFW A;  4LAD B;  4TYL A;  1WEV A;  5G0F A;  5F1H A;  5AME A;  2EGP A;  3ZPV E;  5F5Z A;  4TU6 A;  3G0L A;  4QSS A;  3O70 A;  3RPG C;  5LKX A;  5DY7 A;  2F42 A;  4AP4 A;  2RNX A;  4QC1 A;  3LQI A;  4QSX A;  1U6G B;  2HDP A;  5KTU A;  5JG6 A;  2H0D B;  3JVL A;  4P5O B;  4QZS A;  3VK6 A;  2OSS A;  3UV2 A;  4N3W A;  4AKN A;  1DVP A;  2LDR A;  4GB0 A;  5IGL A;  5FE4 A;  5EVA A;  3EB5 A;  3SVG A;  5LKT A;  3SOX A;  4UIT A;  4AYC A;  5B78 A;  4NR9 A;  1X0J A;  2YEM A;  5A5N A;  2VPE A;  3I3J A;  3QZV A;  2KGG A;  2YYN A;  4MVT A;  3JVK A;  5KU3 A;  4HXO A;  4J3I A;  2JMI A;  2OO1 A;  3DAI A;  5H85 A;  3UVX A;  5LJ2 A;  2ECT A;  3N9M A;  3GG3 A;  5HEL A;  4FIP A;  4ALH A;  5CPE A;  4TT6 A;  5E9K A;  5EWV A;  5HRW A;  5E9Y A;  5L8T A;  4R8P K;  4CUQ A;  5ENC A;  5EPS A;  2JRJ A;  4FK5 A;  2WP1 A;  4WHW A;  4CFK A;  3ASL A;  2KWN A;  5FE8 A;  5D3N A;  2KU3 A;  3FL2 A;  5CQT A;  4O64 A;  3T6R A;  3MB3 A;  5L98 A;  3PUR A;  4QB3 A;  4Y03 A;  5FE3 A;  2FUU A;  1VYX A;  5F62 A;  5HFQ A;  2YQL A;  4Z93 A;  5I7X A;  3MHS A;  4ZW1 A;  5AIU A;  5EWC A;  4HBW A;  4LC2 A;  4Q6F A;  1F62 A;  1E6I A;  2E7N A;  4LZ2 A;  5II1 A;  4A9H A;  4ZDT A;  5TB6 A;  4OGJ A;  5EV9 A;  2LXP C;  5DBM A;  4YAD A;  4NR7 A;  3I2D A;  4V3L C;  5FG4 A;  2YQD A;  3U5M A;  3IU5 A;  4NR5 A;  5I40 A;  2M85 A;  4O77 A;  2L85 A;  4NS5 A;  4ZC9 A;  1T1H A;  4N4F A;  5I83 A;  4UYE A;  4J1P A;  4UIX A;  5D7X A;  4NRA A;  5DKD A;  4MR6 A;  5DYX A;  2L80 A;  1IYM A;  4QSP A;  5F2P A;  3MQM A;  4IR5 A;  4TS8 A;  4E96 A;  5IG6 A;  4PS5 A; 
#chains in the Genus database with same CATH topology
 3HCU A;  2RI7 A;  4N4G A;  4LLB A;  4NUC A;  4PCI A;  3HCS A;  2DSM A;  5C87 A;  5CUD A;  3PHD A;  2LN0 A;  4A9J A;  3KV5 A;  2MNY A;  4QR5 A;  2IDA A;  4GNG A;  4NUD A;  2CSY A;  2M6M A;  4GNE A;  4AUQ B;  2KTB B;  3MHH A;  4PY6 A;  3VKH A;  2CRW A;  5DKA A;  5JWM A;  2I50 A;  3ZPV 1;  5EYA F;  3O7A A;  4HXN A;  1V87 A;  4OGC A;  4YBS A;  5EK9 A;  4UYG A;  4NR8 A;  2CKL A;  4NR6 A;  2G6Q A;  4F3I A;  1WIL A;  2ECJ A;  1WIM A;  5FH8 A;  5EM3 A;  2ECV A;  5LKZ A;  4A9N A;  3LVQ E;  2BAY A;  5C89 A;  2KKY A;  5ETD A;  2L0B A;  5TDW A;  1FP0 A;  5TRB A;  3Q1D A;  2YHN A;  4YYD A;  3MDB C;  5D3J A;  5IGK A;  2DVV A;  4O7B A;  5DFD A;  4QSR A;  4MEO A;  1N72 A;  5DW1 A;  3M99 A;  5CQ5 A;  4CL9 A;  4QR4 A;  3LDY A;  2LXH C;  5CP5 A;  5G4S A;  2R0V A;  2VPB A;  3UV4 A;  3U5O A;  4C66 A;  1RMD A;  2LV9 A;  5E74 A;  5A5P A;  4A0C D;  5IBN A;  3JVJ A;  2YW5 A;  5FFW A;  3UVD A;  1N87 A;  2DVQ A;  5FE1 A;  3UVY A;  4XUA A;  5CGP A;  4NUE A;  2EJN A;  4B7Y C;  5C11 A;  3D1B A;  5E7D A;  1VFY A;  5CUB A;  1WEW A;  5D3S A;  3LQH A;  3FJU B;  3VKG A;  4Q0O A;  2D8S A;  4QSU A;  4YY6 A;  1F68 A;  2LGL A;  2C2L A;  4QUT A;  3KV6 A;  3NXB A;  3L1X A;  2QIZ A;  2KKX A;  4CCG X;  5I80 A;  4MEQ A;  5E9L A;  4R2Y A;  4NN2 A;  4LK9 A;  2KE1 A;  5HQ7 A;  5J3X A;  1WEU A;  4AYC B;  5CQ3 A;  2M13 A;  3MXF A;  2DKW A;  3O35 A;  5TAB A;  5BT4 A;  2I7K A;  2R10 A;  3M63 A;  3P1F A;  4HBX A;  2YRE A;  5DX4 A;  5HLS A;  4IOR A;  5A5O A;  2DVR A;  5AD3 A;  1Z60 A;  4TZ8 A;  4UIU A;  5E9V A;  5L97 A;  2OWA A;  5F25 A;  4O71 A;  5CU8 A;  2KFT A;  5DLZ A;  4A9K A;  4QSV A;  4A4B A;  3UVW A;  4A9L A;  2MNZ A;  5G4R A;  2R0S A;  2EA6 A;  4CUT A;  5FE6 A;  4YYN A;  4FO9 A;  4CLB A;  5ACY A;  2G4A A;  3JUE A;  1ZS5 A;  5CQ6 A;  5F61 A;  3FM8 C;  5F60 A;  4O7F A;  5FE2 A;  5DFC A;  3ONI A;  4YAX A;  3SVH A;  2MA6 A;  5HRV A;  2NAA A;  4HXP A;  3D1D A;  5LJ0 A;  4S3O C;  5EQ1 A;  4XY8 A;  4YK0 A;  5DW2 A;  3TLP A;  2MT5 A;  3AQA A;  5SVI A;  4HXM A;  4AVX A;  4QBM A;  4O7A A;  4YC9 A;  4H9D A;  3V43 A;  5L96 A;  2Y1M A;  4C9Z A;  4TZ2 A;  1X4U A;  4O70 A;  1WEM A;  2RO1 A;  4A9O A;  1G25 A;  3G0J A;  4Q0N A;  2L5E A;  5B79 A;  2ECW A;  5H1U A;  2VNF A;  2KWO A;  2DJA A;  4V3K C;  5CTL A;  5D26 A;  2OXQ C;  3LJU X;  4A9E A;  4YYI A;  2Y43 A;  4GND A;  5C13 A;  3MUK A;  5DFB A;  4Z1S A;  4NXJ A;  1WGM A;  5A85 A;  4KCX A;  4TT4 A;  4UYH A;  5G04 B;  5D3H A;  4NYX A;  5I88 A;  3QZS A;  2WP2 A;  4QNS A;  2XOZ A;  4QSQ A;  4XYA A;  4XUB A;  4O74 A;  5EIC A;  5II2 A;  4CUR A;  4WZ0 A;  3HTK C;  5D3T A;  5D1L B;  2YUC A;  2YEK A;  4O7E A;  1Z2Q A;  2JMJ A;  5KHM A;  4A9M A;  3DWD A;  3C6W A;  5E0R A;  4YYH A;  5C8G A;  3IU6 A;  4QUU A;  4YBT A;  3NG2 A;  5BT3 A;  3N9O A;  5LJ1 A;  2VJF A;  3DPL R;  2LSP B;  4ZUX U;  5CY9 A;  4UIV A;  5I86 A;  2MD7 B;  5EWW A;  2VPG A;  1HYJ A;  5KH7 A;  4NQN A;  4LKA A;  4FLP A;  4A9F A;  4W4U A;  2KGI A;  1Z6U A;  4MEP A;  4YBM A;  2RSD A;  4CUP A;  5E9I A;  5FFY A;  5CRM A;  5ENJ A;  2G45 A;  5EI4 A;  5K29 A;  3P1D A;  2YQM A;  4QF3 A;  1MM2 A;  3GL6 A;  4X3G A;  2GRC A;  1EQF A;  2EOD A;  3DDT A;  5EWH A;  5LVR A;  4L7X A;  4UIZ A;  4FJC A;  2RS9 B;  5FE5 A;  5ETB A;  4BW1 A;  5G05 B;  3S91 A;  3E2D A;  4F52 B;  4QF2 A;  4UP0 A;  4I7D A;  4LYW A;  4QY4 A;  2QJ0 A;  4NYW A;  3LJW A;  2D82 A;  4HXK A;  2M1R A;  5L99 A;  4CUS A;  2YUR A;  4UIW A;  2RNW A;  4LJN A;  4O75 A;  4QYL A;  5D1M B;  5A7C A;  3ZVY A;  4PKL A;  5KO4 A;  3RPG B;  2VP7 A;  4UYF A;  2LRI C;  3FEH A;  5HM0 A;  3T7L A;  3LQJ A;  4WIV A;  2CSV A;  3K2J A;  4AKG A;  3AAD A;  4LDF A;  2ECG A;  4O76 A;  4Z6H A;  3ZNI A;  1BOR A;  4YAT A;  2ECI A;  1WES A;  4QST A;  3P5O A;  4PTB A;  2YHO A;  2XOY A;  5TDR A;  5CQ4 A;  3KNV A;  2MKE A;  3FKM X;  5FDZ A;  5HEM A;  3DQV R;  3KQI A;  5D3P A;  5B8D A;  4AKH A;  4YYK A;  2MD8 C;  2K17 A;  3RCW A;  5FG5 A;  3LXJ A;  5E73 A;  2XEU A;  5H1V A;  4A9I A;  4Z1Q A;  3U5J A;  2LGV A;  4MEN A;  1MM3 A;  4I7C A;  5CS8 A;  3ZVZ B;  4HXR A;  1JSP B;  1WE9 A;  3N9L A;  4NRC A;  3U5P A;  2R0Y A;  3HME A;  4HBY A;  4O78 A;  5ENB A;  5DYU A;  4CFL A;  2LGG A;  5A81 A;  1WEO A;  5D1K B;  5SVX A;  2YW8 A;  4WA6 A;  5J0D A;  5KH9 A;  5D3R A;  5DYA A;  2KIZ A;  4YAB A;  5A5R A;  4IC2 A;  3IHP A;  5CQ7 A;  5IID A;  2EGM A;  3FAO A;  2OUO A;  4IOO A;  4TQN A;  4OGE A;  2DVS A;  1WFK A;  3L1Z B;  4TKP B;  1PUO A;  4BJX A;  4CA1 A;  3SUB A;  5H9M A;  4LZR A;  4BHW A;  5IGM A;  2YEL A;  5TCM A;  4YH4 A;  4BW2 A;  1FBV A;  3Q2E A;  5CZG A;  4A4C A;  2DWW A;  3MUL A;  1WEP A;  2UZG A;  5ENG A;  4Z6I A;  3O34 A;  5A83 A;  4YYM A;  4MR4 A;  3U5K A;  4F1P A;  3SOW A;  4NRB A;  5FG6 A;  2RFJ A;  3O37 A;  4IR3 A;  2JMD A;  2VJE A;  5I3L A;  3M7K A;  2AN6 A;  4C67 A;  5F36 A;  5KTX A;  3GV4 A;  5B75 A;  4LZS A;  5L8U A;  5C85 A;  2KYU A;  2C2V S;  4OGI A;  3HCT A;  4N4I A;  5CQA A;  3S92 A;  3U5N A;  3MB4 A;  2KR4 A;  5DIN A;  4BBQ A;  1JM7 A;  3ZYU A;  5DKH A;  2MA5 A;  4PCE A;  4WHU A;  5LVQ A;  3LVR E;  2LQ6 A;  3P1E A;  2D9E A;  5F3A A;  5AMF A;  1CHC A;  3UW9 A;  5I1Q A;  2N9G A;  4IOQ A;  3RTR B;  5FH6 A;  5FER A;  5FE9 A;  3HMH A;  5EGU A;  5HJC A;  2VJF B;  5HEN A;  4MR5 A;  4GNF A;  5HQ5 A;  1LDK C;  5I89 A;  5JI8 A;  2NXB A;  2MJV B;  5ENE A;  2H0D A;  4MSX A;  2YVR A;  5HFR A;  4YYG A;  4IR6 A;  4J0S A;  4O72 A;  2K1J A;  2YSM A;  1WEN A;  3EB6 A;  5FE0 A;  4QYD A;  2YYR A;  5EWD A;  5D25 A;  2MIQ A;  3P1C A;  4YYJ A;  5CUG A;  4NQM A;  5LCW B;  1X4J A;  3HMF A;  5EP7 A;  3L11 A;  4HXL A;  2E6R A;  2L5U A;  4B86 C;  2LGK A;  4I7B A;  5ENH A;  5I7Y A;  5EPB A;  5F63 A;  1XWH A;  5C4Q A;  5FEY A;  5EPR A;  3UV5 A;  1WEE A;  2DX8 A;  1HYI A;  2CKL B;  3SOU A;  2YDW A;  4BW3 A;  2IQJ A;  2L84 A;  3O47 A;  2E7O A;  4KV1 A;  2XP0 A;  4O7C A;  5D0C A;  3Q2F A;  2KWJ A;  5KTW A;  4UYF B;  5E3G A;  1E4U A;  4HBV A;  4ALG A;  2FD4 A;  4QEU A;  5CUC A;  1JOC A;  2DAT A;  1LDJ B;  5LKU A;  4Z0R A;  5EA1 A;  4TT2 A;  4LYI A;  3DWY A;  1MBM A;  3SVF A;  2CON A;  2KWK A;  5D3L A;  4J0R A;  5A5S A;  2L43 A;  2YU4 A;  2XB1 A;  4BW4 A;  2D8U A;  2EXU A;  2F6J A;  3SHB A;  3JVM A;  2ECN A;  5DYC A;  4LRG A;  4X2I A;  5E3D A;  5DKC A;  5CUA A;  2L75 A;  4UYD A;  5FE7 A;  2H60 A;  4ZQL A;  4UI9 B;  5I29 A;  4GPJ A;  5A82 A;  4TU4 A;  5EIS A;  5FB0 A;  3N9Q A;  4XY9 A;  5EU1 A;  4UIY A;  2JM3 A;  3N9P A;  5E9M A;  3U5L A;  4TTE A;  2HYE D;  4HXS A;  5CUE A;  5FH7 A;  2PNX A;  4PPE A;  3ERR A;  5HQ6 A;  2P57 A;  4XI1 A;  3C5K A;  4KV4 A;  5AIT A;  2G43 A;  4QEW A;  4A49 A;  1WEQ A;  5C7N A;  3ZYQ A;  5DLX A;  1X4I A;  4YY4 A;  2FSA A;  5D24 A;  4WZ2 A;  5HCL A;  1JM4 B;  4QSW A;  5COI A;  5K3Q A;  2K4D A;  3O33 A;  3QZT A;  5IGN A;  2E3K A;  5FB1 A;  4IR4 A;  5CQ8 A;  2XOC A;  3M62 A;  2CT2 A;  2E61 A;  5B76 A;  4O62 A;  1K2F A;  2F6N A;  4MR3 A;  5AD2 A;  2CSZ A;  4S3O B;  2VPD A;  3LRQ A;  4R7E A;  2E6S A;  3PUQ A;  5BT5 A;  2M3H A;  2MUM A;  5B77 A;  5KH3 A;  2LAU A;  2KRE A;  4LR6 A;  4NR4 A;  2ZET C;  5A5Q A;  4QQ4 A;  3O36 A;  3N9N A;  3FAN A;  2YT5 A;  4N4H A;  2K16 A;  4IC3 A;  4LYS A;  4L58 A;  5TBN A;  2RNY A;  5HRX A;  2PUY A;  2VJE B;  5CRZ A;  3D7C A;  5ENI A;  4WZ3 B;  5SVI B;  4YH3 A;  4RVR A;  1WUM A;  4QR3 A;  1ZBD B;  2RR4 A;  3ZTG A;  4QEV A;  1DCQ A;  5LUU A;  1VD4 A;  5FBX A;  5ENF A;  2YSJ A;  5FFV A;  5F1L A;  2QIC A;  2FUI A;  4CUU A;  1JM7 B;  2Y1N A;  4DON A;  4QC3 A;  2I8N A;  3KDE C;  5H1T A;  4UP5 A;  4NYV A;  1ZKR A;  1WUG A;  4OUF A;  5CFW A;  4LAD B;  4TYL A;  1WEV A;  5G0F A;  3T9K A;  5F1H A;  5AME A;  2EGP A;  2B0O E;  3ZPV E;  5F5Z A;  4TU6 A;  3G0L A;  4QSS A;  3O70 A;  3RPG C;  5LKX A;  5DY7 A;  2F42 A;  4AP4 A;  2RNX A;  4AI6 A;  4QC1 A;  3LQI A;  4QSX A;  1U6G B;  2HDP A;  5KTU A;  2FFW A;  2H0D B;  5JG6 A;  3JVL A;  4P5O B;  4QZS A;  3VK6 A;  2OSS A;  3UV2 A;  4N3W A;  4AKN A;  1DVP A;  2LDR A;  4GB0 A;  5IGL A;  5FE4 A;  5EVA A;  3EB5 A;  3SVG A;  5LKT A;  3SOX A;  4UIT A;  4AYC A;  5B78 A;  4NR9 A;  1X0J A;  2YEM A;  5A5N A;  2VPE A;  3I3J A;  3QZV A;  2KGG A;  2YYN A;  4MVT A;  3JVK A;  5KU3 A;  4HXO A;  4J3I A;  2JMI A;  2OO1 A;  3DAI A;  5H85 A;  3UVX A;  5LJ2 A;  2ECT A;  2JUN A;  3GG3 A;  5HEL A;  3N9M A;  4ALH A;  5CPE A;  4TT6 A;  4FIP A;  5E9K A;  5EWV A;  5HRW A;  5E9Y A;  5L8T A;  4R8P K;  4CUQ A;  4Z0O A;  5ENC A;  5EPS A;  2JRJ A;  4FK5 A;  2WP1 A;  4WHW A;  4CFK A;  3ASL A;  2KWN A;  5FE8 A;  5D3N A;  2KU3 A;  3FL2 A;  5CQT A;  4O64 A;  3T6R A;  3MB3 A;  5L98 A;  3PUR A;  4QB3 A;  4Y03 A;  5FE3 A;  2L7P A;  2FUU A;  1VYX A;  5F62 A;  5HFQ A;  2YQL A;  4Z93 A;  5I7X A;  3MHS A;  4ZW1 A;  5AIU A;  5EWC A;  4HBW A;  4LC2 A;  4Q6F A;  4AKI A;  1F62 A;  1E6I A;  2E7N A;  4LZ2 A;  5II1 A;  4A9H A;  5SVY A;  4ZDT A;  5TB6 A;  4OGJ A;  5EV9 A;  2LXP C;  5DBM A;  4YAD A;  4NR7 A;  3I2D A;  4V3L C;  5FG4 A;  2CRR A;  2YQD A;  3U5M A;  3IU5 A;  4NR5 A;  5I40 A;  2M85 A;  4O77 A;  2L85 A;  4NS5 A;  4ZC9 A;  1T1H A;  4N4F A;  5I83 A;  4UYE A;  4J1P A;  4UIX A;  5D7X A;  4NRA A;  5DKD A;  4MR6 A;  3H7H A;  5DYX A;  2L80 A;  1IYM A;  4QSP A;  5F2P A;  3MQM A;  4IR5 A;  3PLW A;  4TS8 A;  4E96 A;  5IG6 A;  4PS5 A; 
#chains in the Genus database with same CATH homology
 3HCU A;  2RI7 A;  4N4G A;  4LLB A;  4NUC A;  4PCI A;  3HCS A;  5C87 A;  5CUD A;  3PHD A;  2LN0 A;  4A9J A;  3KV5 A;  2MNY A;  4QR5 A;  2IDA A;  4GNG A;  4NUD A;  2CSY A;  2M6M A;  4GNE A;  4AUQ B;  2KTB B;  3MHH A;  4PY6 A;  3ZPV 1;  5DKA A;  5JWM A;  2I50 A;  5EYA F;  3O7A A;  4HXN A;  1V87 A;  4YBS A;  5EK9 A;  4UYG A;  4NR8 A;  2CKL A;  4NR6 A;  2G6Q A;  4F3I A;  1WIL A;  2ECJ A;  1WIM A;  5FH8 A;  5EM3 A;  2ECV A;  5LKZ A;  4A9N A;  2BAY A;  5C89 A;  5ETD A;  2L0B A;  5TDW A;  1FP0 A;  5TRB A;  2YHN A;  4YYD A;  5D3J A;  5IGK A;  2DVV A;  4O7B A;  5DFD A;  4QSR A;  4MEO A;  1N72 A;  5DW1 A;  3M99 A;  5CQ5 A;  4CL9 A;  4QR4 A;  2LXH C;  5CP5 A;  5G4S A;  2R0V A;  2VPB A;  3UV4 A;  3U5O A;  4C66 A;  1RMD A;  2LV9 A;  5E74 A;  5A5P A;  4A0C D;  5IBN A;  3JVJ A;  2YW5 A;  5FFW A;  3UVD A;  1N87 A;  2DVQ A;  5FE1 A;  3UVY A;  4XUA A;  5CGP A;  4NUE A;  4B7Y C;  5C11 A;  5E7D A;  1VFY A;  1WEW A;  5CUB A;  5D3S A;  3LQH A;  4Q0O A;  2D8S A;  4QSU A;  4YY6 A;  1F68 A;  2LGL A;  2C2L A;  4QUT A;  3KV6 A;  3NXB A;  3L1X A;  2QIZ A;  4CCG X;  5I80 A;  4MEQ A;  5E9L A;  4R2Y A;  4NN2 A;  4LK9 A;  2KE1 A;  5HQ7 A;  5J3X A;  1WEU A;  4AYC B;  5CQ3 A;  3MXF A;  2DKW A;  3O35 A;  5TAB A;  5BT4 A;  2I7K A;  2R10 A;  3M63 A;  3P1F A;  4HBX A;  2YRE A;  5DX4 A;  5HLS A;  4IOR A;  5A5O A;  2DVR A;  5AD3 A;  1Z60 A;  4TZ8 A;  4UIU A;  5E9V A;  5L97 A;  5F25 A;  4O71 A;  5CU8 A;  2KFT A;  5DLZ A;  4A9K A;  4QSV A;  4A4B A;  3UVW A;  4A9L A;  2MNZ A;  5G4R A;  2R0S A;  2EA6 A;  4CUT A;  5FE6 A;  4YYN A;  4FO9 A;  4CLB A;  5ACY A;  2G4A A;  1ZS5 A;  5CQ6 A;  5F61 A;  5F60 A;  4O7F A;  5FE2 A;  5DFC A;  3ONI A;  4YAX A;  3SVH A;  2MA6 A;  5HRV A;  2NAA A;  4HXP A;  5LJ0 A;  4S3O C;  5EQ1 A;  4XY8 A;  4YK0 A;  5DW2 A;  3TLP A;  2MT5 A;  3AQA A;  4AVX A;  4HXM A;  4QBM A;  4O7A A;  4YC9 A;  3V43 A;  5L96 A;  2Y1M A;  4C9Z A;  4TZ2 A;  1X4U A;  4O70 A;  1WEM A;  2RO1 A;  4A9O A;  1G25 A;  3G0J A;  4Q0N A;  2L5E A;  5B79 A;  2ECW A;  5H1U A;  2VNF A;  2KWO A;  4V3K C;  5CTL A;  5D26 A;  2OXQ C;  4A9E A;  4YYI A;  2Y43 A;  4GND A;  5C13 A;  3MUK A;  5DFB A;  4Z1S A;  4NXJ A;  1WGM A;  5A85 A;  4KCX A;  4TT4 A;  4UYH A;  5G04 B;  5D3H A;  4NYX A;  5I88 A;  3QZS A;  2WP2 A;  4QNS A;  4QSQ A;  4XYA A;  4XUB A;  4O74 A;  5EIC A;  5II2 A;  4CUR A;  4WZ0 A;  3HTK C;  5D3T A;  5D1L B;  2YUC A;  2YEK A;  4O7E A;  1Z2Q A;  2JMJ A;  5KHM A;  4A9M A;  3C6W A;  5E0R A;  4YYH A;  5C8G A;  3IU6 A;  4QUU A;  4YBT A;  3NG2 A;  5BT3 A;  3N9O A;  5LJ1 A;  2VJF A;  3DPL R;  2LSP B;  4ZUX U;  5CY9 A;  4UIV A;  5I86 A;  2MD7 B;  5EWW A;  2VPG A;  1HYJ A;  5KH7 A;  4NQN A;  4LKA A;  4FLP A;  4A9F A;  4W4U A;  2KGI A;  1Z6U A;  4MEP A;  4YBM A;  2RSD A;  4CUP A;  5E9I A;  5FFY A;  5CRM A;  5ENJ A;  2G45 A;  5EI4 A;  5K29 A;  3P1D A;  2YQM A;  4QF3 A;  1MM2 A;  3GL6 A;  4X3G A;  2GRC A;  1EQF A;  2EOD A;  5EWH A;  5LVR A;  4L7X A;  4UIZ A;  4FJC A;  2RS9 B;  5FE5 A;  5ETB A;  4BW1 A;  5G05 B;  3S91 A;  4F52 B;  4QF2 A;  4UP0 A;  4I7D A;  4LYW A;  4QY4 A;  2QJ0 A;  4NYW A;  3LJW A;  2D82 A;  4HXK A;  2M1R A;  5L99 A;  4CUS A;  2YUR A;  4UIW A;  2RNW A;  4LJN A;  4O75 A;  4QYL A;  5D1M B;  5A7C A;  3ZVY A;  4PKL A;  5KO4 A;  3RPG B;  2VP7 A;  4UYF A;  2LRI C;  5HM0 A;  3T7L A;  3LQJ A;  4WIV A;  3K2J A;  2ECG A;  3AAD A;  4LDF A;  3ZNI A;  4O76 A;  4Z6H A;  1BOR A;  4YAT A;  2ECI A;  1WES A;  4QST A;  3P5O A;  4PTB A;  2YHO A;  5TDR A;  5CQ4 A;  3KNV A;  3FKM X;  5FDZ A;  5HEM A;  3DQV R;  3KQI A;  5D3P A;  5B8D A;  4YYK A;  2MD8 C;  2K17 A;  3RCW A;  5FG5 A;  3LXJ A;  5E73 A;  2XEU A;  5H1V A;  4A9I A;  4Z1Q A;  3U5J A;  2LGV A;  4MEN A;  1MM3 A;  4I7C A;  5CS8 A;  3ZVZ B;  4HXR A;  1JSP B;  1WE9 A;  3N9L A;  4NRC A;  3U5P A;  2R0Y A;  3HME A;  4HBY A;  4O78 A;  5ENB A;  5DYU A;  4CFL A;  2LGG A;  5A81 A;  1WEO A;  5D1K B;  2YW8 A;  4WA6 A;  5J0D A;  5KH9 A;  5D3R A;  5DYA A;  2KIZ A;  4YAB A;  5A5R A;  4IC2 A;  3IHP A;  5CQ7 A;  5IID A;  2OUO A;  4IOO A;  4TQN A;  2DVS A;  1WFK A;  3L1Z B;  4TKP B;  4BJX A;  4CA1 A;  5H9M A;  4LZR A;  4BHW A;  5IGM A;  2YEL A;  5TCM A;  4YH4 A;  4BW2 A;  1FBV A;  3Q2E A;  5CZG A;  4A4C A;  2DWW A;  3MUL A;  1WEP A;  2UZG A;  5ENG A;  4Z6I A;  3O34 A;  5A83 A;  4YYM A;  4MR4 A;  3U5K A;  3SOW A;  4NRB A;  5FG6 A;  2RFJ A;  3O37 A;  4IR3 A;  2JMD A;  2VJE A;  5I3L A;  2AN6 A;  4C67 A;  5F36 A;  5KTX A;  3GV4 A;  5B75 A;  4LZS A;  5L8U A;  5C85 A;  2KYU A;  2C2V S;  4OGI A;  3HCT A;  4N4I A;  5CQA A;  3S92 A;  3U5N A;  3MB4 A;  2KR4 A;  5DIN A;  4BBQ A;  1JM7 A;  3ZYU A;  5DKH A;  2MA5 A;  4PCE A;  4WHU A;  5LVQ A;  2LQ6 A;  3P1E A;  2D9E A;  5F3A A;  5AMF A;  1CHC A;  3UW9 A;  5I1Q A;  2N9G A;  4IOQ A;  3RTR B;  5FH6 A;  5FER A;  5FE9 A;  3HMH A;  5EGU A;  5HJC A;  2VJF B;  5HEN A;  4MR5 A;  4GNF A;  5HQ5 A;  1LDK C;  5I89 A;  5JI8 A;  2NXB A;  2MJV B;  5ENE A;  2H0D A;  4MSX A;  5HFR A;  4YYG A;  4IR6 A;  4J0S A;  4O72 A;  2K1J A;  2YSM A;  1WEN A;  3EB6 A;  5FE0 A;  4QYD A;  2YYR A;  5EWD A;  5D25 A;  2MIQ A;  3P1C A;  4YYJ A;  5CUG A;  4NQM A;  5LCW B;  1X4J A;  3HMF A;  5EP7 A;  3L11 A;  4HXL A;  2E6R A;  2L5U A;  4B86 C;  2LGK A;  4I7B A;  5ENH A;  5I7Y A;  5EPB A;  5F63 A;  1XWH A;  5C4Q A;  5FEY A;  5EPR A;  3UV5 A;  1WEE A;  2DX8 A;  1HYI A;  2CKL B;  3SOU A;  2YDW A;  4BW3 A;  2L84 A;  2E7O A;  4KV1 A;  4O7C A;  5D0C A;  3Q2F A;  2KWJ A;  5KTW A;  4UYF B;  5E3G A;  1E4U A;  4HBV A;  4ALG A;  4QEU A;  5CUC A;  1JOC A;  2DAT A;  1LDJ B;  5LKU A;  5EA1 A;  4TT2 A;  4LYI A;  3DWY A;  3SVF A;  2KWK A;  5D3L A;  4J0R A;  5A5S A;  2L43 A;  2YU4 A;  2XB1 A;  4BW4 A;  2F6J A;  3SHB A;  3JVM A;  2ECN A;  5DYC A;  4LRG A;  4X2I A;  5E3D A;  5DKC A;  5CUA A;  2L75 A;  4UYD A;  5FE7 A;  2H60 A;  4ZQL A;  4UI9 B;  5I29 A;  4GPJ A;  5A82 A;  4TU4 A;  5EIS A;  5FB0 A;  3N9Q A;  4XY9 A;  5EU1 A;  4UIY A;  3N9P A;  5E9M A;  3U5L A;  4TTE A;  2HYE D;  4HXS A;  5CUE A;  5FH7 A;  2PNX A;  4PPE A;  5HQ6 A;  4XI1 A;  3C5K A;  4KV4 A;  5AIT A;  2G43 A;  4QEW A;  4A49 A;  1WEQ A;  5C7N A;  3ZYQ A;  5DLX A;  1X4I A;  4YY4 A;  2FSA A;  5D24 A;  4WZ2 A;  5HCL A;  1JM4 B;  4QSW A;  5COI A;  2K4D A;  3O33 A;  3QZT A;  5IGN A;  2E3K A;  5FB1 A;  4IR4 A;  5CQ8 A;  3M62 A;  2CT2 A;  5B76 A;  1K2F A;  2F6N A;  4MR3 A;  5AD2 A;  2CSZ A;  4S3O B;  2VPD A;  3LRQ A;  4R7E A;  2E6S A;  3PUQ A;  5BT5 A;  2M3H A;  2MUM A;  5B77 A;  5KH3 A;  2KRE A;  4LR6 A;  4NR4 A;  2ZET C;  5A5Q A;  3O36 A;  3N9N A;  4IC3 A;  2YT5 A;  4N4H A;  2K16 A;  4L58 A;  4LYS A;  5TBN A;  2RNY A;  5HRX A;  2PUY A;  2VJE B;  5CRZ A;  3D7C A;  5ENI A;  4WZ3 B;  4YH3 A;  4RVR A;  1WUM A;  4QR3 A;  1ZBD B;  3ZTG A;  4QEV A;  5LUU A;  1VD4 A;  5FBX A;  5ENF A;  2YSJ A;  5FFV A;  5F1L A;  2QIC A;  2FUI A;  4CUU A;  1JM7 B;  2Y1N A;  4DON A;  4QC3 A;  2I8N A;  5H1T A;  4UP5 A;  4NYV A;  4OUF A;  1WUG A;  5CFW A;  4LAD B;  4TYL A;  1WEV A;  5G0F A;  5F1H A;  5AME A;  2EGP A;  3ZPV E;  5F5Z A;  4TU6 A;  3G0L A;  4QSS A;  3O70 A;  3RPG C;  5LKX A;  5DY7 A;  2F42 A;  4AP4 A;  2RNX A;  4QC1 A;  3LQI A;  4QSX A;  1U6G B;  2HDP A;  5KTU A;  5JG6 A;  2H0D B;  3JVL A;  4P5O B;  4QZS A;  3VK6 A;  2OSS A;  3UV2 A;  4N3W A;  4AKN A;  1DVP A;  2LDR A;  4GB0 A;  5IGL A;  5FE4 A;  5EVA A;  3EB5 A;  3SVG A;  5LKT A;  3SOX A;  4UIT A;  4AYC A;  5B78 A;  4NR9 A;  1X0J A;  2YEM A;  5A5N A;  2VPE A;  3I3J A;  3QZV A;  2KGG A;  2YYN A;  4MVT A;  3JVK A;  5KU3 A;  4HXO A;  4J3I A;  2JMI A;  2OO1 A;  3DAI A;  5H85 A;  3UVX A;  5LJ2 A;  2ECT A;  3N9M A;  3GG3 A;  5HEL A;  4FIP A;  4ALH A;  5CPE A;  4TT6 A;  5E9K A;  5EWV A;  5HRW A;  5E9Y A;  5L8T A;  4R8P K;  4CUQ A;  5ENC A;  5EPS A;  2JRJ A;  4FK5 A;  2WP1 A;  4WHW A;  4CFK A;  3ASL A;  2KWN A;  5FE8 A;  5D3N A;  2KU3 A;  3FL2 A;  5CQT A;  4O64 A;  3T6R A;  3MB3 A;  5L98 A;  3PUR A;  4QB3 A;  4Y03 A;  5FE3 A;  2FUU A;  1VYX A;  5F62 A;  5HFQ A;  2YQL A;  4Z93 A;  5I7X A;  3MHS A;  4ZW1 A;  5AIU A;  5EWC A;  4HBW A;  4LC2 A;  4Q6F A;  1F62 A;  1E6I A;  2E7N A;  4LZ2 A;  5II1 A;  4A9H A;  4ZDT A;  5TB6 A;  4OGJ A;  5EV9 A;  2LXP C;  5DBM A;  4YAD A;  4NR7 A;  3I2D A;  4V3L C;  5FG4 A;  2YQD A;  3U5M A;  3IU5 A;  4NR5 A;  5I40 A;  2M85 A;  4O77 A;  2L85 A;  4NS5 A;  4ZC9 A;  1T1H A;  4N4F A;  5I83 A;  4UYE A;  4J1P A;  4UIX A;  5D7X A;  4NRA A;  5DKD A;  4MR6 A;  5DYX A;  2L80 A;  1IYM A;  4QSP A;  5F2P A;  3MQM A;  4IR5 A;  4TS8 A;  4E96 A;  5IG6 A;  4PS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...