4ZQLA

Crystal structure of trim24 with 3,4-dimethoxy-n-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
177
Chain Sequence
MNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of TRIM24 with 3,4-dimethoxy-N-(6-(4-methoxyphenoxy)-1,3-dimethyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)benzenesulfonamide inhibitor
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription intermediary factor 1-alpha
total genus 49
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4zqlA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4zqlA01
2YSMA 5DY7A 5EA1A 5FB0A 5L99A 4GPJA 3TLPA 3UVDA 4O7EA 4UIUA 1WEVA 4C9ZA 3JVJA 5EPRA 3QZSA 5FFYA 3NXBA 2OXQC 4O7BA 4LYWA 4O71A 5A82A 5LVRA 4O70A 5C13A 4A9EA 5L8TA 5HQ6A 3C6WA 4QF2A 3I2DA 4AYCA 3M63A 5I3LA 4HXKA 2LSPB 5ETDA 3RPGB 4S3OC 3N9QA 5ENFA 4ZUXU 5D0CA 2VNFA 4A9LA 4YYIA 3LJWA 1WILA 2G45A 2R10A 4TT4A 5CQ7A 1ZBDB 2CT2A 3MXFA 4YBMA 5CQ8A 3P1EA 2DATA 2YUCA 5FE4A 5TB6A 5IG6A 4IC3A 4N4IA 4HBXA 4A9OA 2ZETC 3KNVA 5COIA 4J3IA 5JG6A 4WIVA 4MR6A 5IIDA 5DKDA 2DVVA 5LVQA 5H1UA 2G43A 5CQ3A 4HXRA 3MHSA 2D8SA 3ZTGA 4YYDA 5F5ZA 4QYDA 2ECNA 2EGPA 4LRGA 5FE3A 4LC2A 4QR5A 5F2PA 4YYMA 4IOOA 3G0JA 4MR3A 5HJCA 4QEUA 4BW4A 2CKLB 2L80A 5HQ7A 4FIPA 5EI4A 3ZVZB 5I29A 3N9LA 4MVTA 1G25A 4BBQA 5TABA 4XYAA 4KV1A 3O34A 4A9JA 5A5OA 4CURA 5HM0A 5CRZA 4R8PK 5LJ2A 4HXLA 4CFLA 4CA1A 2L84A 2YREA 4IR5A 5LKTA 5KH9A 4Z6IA 4UIVA 5G04B 4O7CA 5DYXA 5TDWA 4QSXA 1WE9A 5LKXA 5DYAA 2FUIA 1WEPA 4MENA 4BJXA 2LGVA 5HRVA 5I7XA 2LXPC 3JVLA 2R0SA 2QJ0A 2KTBB 5D3JA 2QIZA 5E3GA 2YDWA 5HENA 2HDPA 2YU4A 2DKWA 3M62A 4MR5A 5CY9A 2AN6A 5D7XA 4NRCA 2KREA 2VJEB 3ZYQA 4FLPA 5ENGA 5EVAA 5FG6A 3JVKA 2N9GA 4QSPA 4A9IA 5TBNA 3UV5A 3O70A 4TZ2A 2JMIA 2ECWA 4Z6HA 5FH7A 2MIQA 2PNXA 3JVMA 4NUCA 4YATA 5E7DA 1RMDA 5F61A 2MA6A 2JRJA 2XB1A 4J0RA 4TS8A 4HBYA 2R0YA 5HCLA 5L8UA 1T1HA 1Z60A 2K16A 3SVFA 4FJCA 4I7DA 1JM7A 5D3LA 3ZNIA 4OUFA 4ZW1A 5I7YA 1JSPB 5HLSA 2LXHC 3SOUA 2VJEA 2HYED 2ECTA 2RO1A 3LQJA 2CSZA 4TT6A 3O36A 2OSSA 4PTBA 5E9VA 3U5NA 2KFTA 4FK5A 2L43A 4ALHA 5HRXA 5TCMA 3NG2A 5DYUA 4IC2A 5FE8A 5DLZA 5AMEA 4ZC9A 3V43A 5CFWA 2I50A 4J1PA 4KV4A 5HQ5A 4NS5A 3HMHA 4LJNA 5CUEA 5F1LA 4V3LC 1V87A 2DVSA 2RNYA 3DQVR 4O76A 5CTLA 5FE5A 4A9KA 5AMFA 5FERA 4Z93A 4KCXA 4QC3A 4UP0A 4N4FA 4W4UA 3RCWA 1N87A 5DX4A 3P1CA 4LZSA 1WEOA 2E6SA 2LDRA 4O64A 1WIMA 2YHNA 5A81A 1X0JA 4NYWA 4CUSA 2L5EA 5EU1A 4O77A 4Q0OA 4S3OB 5D1LB 5EWWA 5E9YA 4QSVA 3AADA 4O74A 3UW9A 3IU5A 2KWJA 4A9FA 5I89A 4QNSA 5C89A 2MA5A 5LCWB 5D26A 4WZ0A 2F42A 2RFJA 5KTUA 5IGMA 4CFKA 2BAYA 5HFQA 2VP7A 5CUCA 4TYLA 1K2FA 4CLBA 1MM3A 4GNFA 4ZDTA 2PUYA 2ECGA 2L85A 4F3IA 5EPBA 5C4QA 4A4CA 2MUMA 2LQ6A 5DBMA 3UV2A 2DVRA 3UV4A 2E6RA 3KV6A 4I7BA 4IOQA 5I40A 5A5QA 1WUMA 2MD8C 2H0DA 5ACYA 1DVPA 5DLXA 5DKAA 5E9MA 2LGGA 2DWWA 4LLBA 4OGIA 5B77A 2JMJA 4C67A 4WA6A 5EICA 1WEQA 5D1KB 3HMEA 3U5LA 3U5KA 3UVXA 3RPGC 1EQFA 4WHWA 5FE2A 4PS5A 5CU8A 4NRBA 4QSTA 4WZ3B 5AD2A 5DW1A 5ENBA 5B79A 4O75A 5EISA 2MNYA 1ZS5A 4YYKA 4CCGX 4MEQA 4QSUA 5FG4A 4TKPB 2K4DA 2LN0A 2OUOA 4UYFB 4QUUA 4LYSA 4XUAA 5CPEA 3Q2EA 3SOXA 2VPGA 4XY9A 2GRCA 2YEMA 4HBVA 3D7CA 2L75A 4LK9A 3ONIA 4Q6FA 2R0VA 5HFRA 1LDKC 4YBSA 5CQAA 3PUQA 5EWHA 3N9MA 5CQ5A 5J0DA 2E7NA 4XUBA 5IGKA 4L7XA 4HXOA 5I88A 5D3TA 4O78A 5FFVA 2G6QA 2YQLA 3GV4A 4UIWA 5FH8A 1N72A 4QSRA 5A83A 4CUQA 3P1DA 4A9NA 3HCUA 2MNZA 5FH6A 5TDRA 1MM2A 5DKHA 4NXJA 4TU6A 2D9EA 4QR4A 2EA6A 3FL2A 5LKZA 4QBMA 4GNEA 4PY6A 5DFBA 5DKCA 1FBVA 2KYUA 4QSSA 4MEOA 5KTXA 4E96A 4AVXA 2KWOA 1XWHA 4V3KC 2YQMA 2FUUA 4J0SA 1WEMA 3O35A 4PCEA 2C2VS 2RS9B 2CKLA 3EB5A 2JMDA 3QZTA 4Y03A 2IDAA 2K1JA 5B75A 4NR4A 3L1ZB 5B78A 1LDJB 4IR4A 3UVWA 5I83A 5LKUA 4PKLA 4UYFA 3N9OA 1WGMA 4LZRA 4YC9A 5B76A 4TT2A 1CHCA 3IU6A 2M3HA 4CUPA 2Y43A 5II1A 4UP5A 3U5PA 5EP7A 5EYAF 5G4RA 5A85A 4PPEA 1E6IA 4HXNA 1BORA 4NR5A 3ZYUA 1WFKA 4TQNA 5E73A 5D3SA 4UYDA 5LJ0A 1E4UA 5D3PA 5A5SA 1VYXA 4N4HA 4NYXA 5C7NA 1X4IA 2LGLA 3N9PA 4XI1A 4AUQB 5C11A 4YADA 3C5KA 5E0RA 4UYEA 4QSQA 5HEMA 4GNDA 5L97A 4HXPA 5E3DA 5EWVA 1X4UA 5IGLA 5CUDA 4AYCB 3U5MA 5CZGA 2VPDA 3O37A 4YH4A 4NQMA 3SVHA 5L96A 3DAIA 4IORA 3K2JA 3L1XA 2C2LA 2KWNA 4R7EA 1WEUA 4NR7A 5CUBA 3U5OA 5FE7A 3GL6A 2E3KA 5CP5A 4LKAA 1F62A 2KGGA 5D3NA 1VFYA 5EGUA 4YABA 4CUUA 2F6NA 5IBNA 2DX8A 3DWYA 4IR6A 5F36A 4YY4A 2KR4A 4YBTA 4MR4A 1JM4B 2LGKA 5ETBA 4L58A 4CUTA 3UVYA 2MD7B 4AKNA 2NAAA 4UIXA 5CQTA 3S92A 4BW2A 5CGPA 4RVRA 4Z1QA 4YAXA 5ENHA 5H85A 4CL9A 5CS8A 5CQ6A 1IYMA 2VPEA 2KE1A 5C87A 2YYNA 2MT5A 5DINA 3O33A 5F1HA 5F60A 4MSXA 3QZVA 4HXMA 5KH7A 3LXJA 1FP0A 4NR8A 5ENIA 2ECJA 4UYHA 3GG3A 4WHUA 4XY8A 3S91A 3ZVYA 3HCSA 2K17A 4BW1A 3P1FA 5A7CA 2CSYA 5FEYA 3ZPV1 2VPBA 2YT5A 3ASLA 4F52B 5AIUA 5KH3A 5G05B 4NYVA 5E9LA 5FE1A 4YYGA 2KWKA 2FSAA 5F25A 4YYHA 1VD4A 4QR3A 3LQHA 4UITA 4NQNA 5D25A 2H60A 4A9MA 4NRAA 3U5JA 5AD3A 3VK6A 5HELA 2M85A 5DFCA 4UI9B 4N4GA 2NXBA 5A5PA 4O7FA 2KIZA 4LZ2A 5CUAA 2VJFA 4BW3A 1HYIA 5II2A 4A9HA 3LRQA 2L0BA 4YYNA 3DPLR 1Z2QA 2WP1A 4O7AA 3AQAA 5D24A 1WEWA 3HCTA 4QEWA 4P5OB 1JM7B 4GNGA 4ALGA 2M6MA 1Z6UA 4I7CA 5JWMA 5EQ1A 5DYCA 5ENCA 2KGIA 2YYRA 5EV9A 5A5RA 4DONA 5I86A 2E7OA 4LR6A 4QUTA 2VJFB 5A5NA 4QF3A 4YYJA 2MJVB 5FBXA 4BHWA 4TU4A 3MB4A 5K29A 4QYLA 4Z1SA 4IR3A 3MULA 3HMFA 5KO4A 3LQIA 4QEVA 5CUGA 5HRWA 5TRBA 3RTRB 2QICA 5FG5A 5LJ1A 4FO9A 1WUGA 2ECVA 2YSJA 4A4BA 2F6JA 4AP4A 4UIYA 4C66A 3KV5A 3T7LA 1HYJA 5E74A 5E9KA 5ENJA 2YHOA 3KQIA 4R2YA 4NR6A 3T6RA 4QY4A 3MHHA 2YURA 4QC1A 4YH3A 5I80A 2M1RA 5EWDA 1U6GB 4MEPA 5FE0A 2I8NA 1WESA 3I3JA 2YW8A 4O72A 1F68A 4NUDA 5ENEA 2H0DB 4LADB 4YY6A 4LYIA 5I1QA 2RI7A 3MB3A 3EB6A 3HTKC 5EPSA 5F3AA 2YEKA 4QSWA 5CRMA 3L11A 2RNXA 5G4SA 5KTWA 4WZ2A 1JOCA 5D3RA 4QB3A 4ZQLA 3SOWA 4NR9A 2EODA 2D82A 4LDFA 3PHDA 2YQDA 2RSDA 4X3GA 4A49A 5D3HA 4B7YC 5KHMA 2LV9A 5FFWA 5EK9A 3N9NA 4HBWA 3Q2FA 5F63A 2UZGA 5D1MB 5L98A 5BT4A 2I7KA 3MUKA 5DFDA 4TZ8A 4Q0NA 5H9MA 4YK0A 3SVGA 1WENA 4GB0A 4N3WA 3FKMX 5FE9A 4UIZA 5EWCA 2RNWA 3M99A 2Y1NA 5DW2A 5LUUA 5EM3A 5E9IA 1WEEA 5FE6A 5BT5A 4NN2A 3MQMA 4OGJA 3IHPA 5FDZA 2G4AA 4UYGA 5AITA 2LRIC 4X2IA 4B86C 5C8GA 1X4JA 5IGNA 2OO1A 3PURA 5H1VA 5C85A 3SHBA 5KU3A 3P5OA 5H1TA 5G0FA 2Y1MA 5B8DA 4QZSA 5CQ4A 4TTEA 2DVQA 5F62A 2XEUA 5FB1A 5BT3A 2WP2A 4NUEA 2ECIA 2YELA 2KU3A 4A0CD 3ZPVE 2L5UA 4PCIA 2YW5A 4HXSA 5JI8A 3O7AA 3G0LA 5J3XA
chains in the Genus database with same CATH superfamily
2YSMA 5DY7A 5EA1A 5FB0A 5L99A 4GPJA 3TLPA 3UVDA 4O7EA 4UIUA 1WEVA 4C9ZA 3JVJA 5EPRA 3QZSA 5FFYA 3NXBA 2OXQC 4O7BA 4LYWA 4O71A 5A82A 5LVRA 4O70A 5C13A 4A9EA 5L8TA 5HQ6A 3C6WA 4QF2A 3I2DA 4AYCA 3M63A 5I3LA 5SVYA 1MBMA 4HXKA 2LSPB 5ETDA 3RPGB 4S3OC 3N9QA 5ENFA 4ZUXU 5D0CA 2VNFA 4A9LA 4YYIA 3LJWA 1WILA 2G45A 2R10A 4TT4A 5CQ7A 1ZBDB 2CT2A 2XP0A 4F1PA 3MXFA 4YBMA 3D1DA 3P1EA 5CQ8A 2DATA 2YUCA 5FE4A 5TB6A 5IG6A 4IC3A 4N4IA 4HBXA 4A9OA 2ZETC 3KNVA 5COIA 4J3IA 5JG6A 4WIVA 4MR6A 5IIDA 5DKDA 2DVVA 5LVQA 2RR4A 5H1UA 2G43A 5CQ3A 4HXRA 3MHSA 2D8SA 3ZTGA 4YYDA 5F5ZA 4QYDA 2ECNA 2EGPA 4LRGA 3VKHA 5FE3A 4LC2A 4QR5A 5F2PA 4YYMA 4IOOA 3G0JA 4MR3A 5HJCA 4QEUA 3DWDA 4BW4A 2CKLB 2L80A 5HQ7A 3PLWA 4FIPA 5EI4A 3ZVZB 5I29A 3N9LA 4MVTA 1G25A 4BBQA 5TABA 4XYAA 4KV1A 3O34A 4A9JA 5A5OA 4CURA 5HM0A 4AI6A 2B0OE 5CRZA 4R8PK 5LJ2A 4HXLA 4CFLA 4CA1A 2L84A 2YREA 4IR5A 5LKTA 4AKIA 5KH9A 4Z6IA 4UIVA 5G04B 4O7CA 5DYXA 5TDWA 4QSXA 1WE9A 5LKXA 5DYAA 2MKEA 2FUIA 2KKXA 1WEPA 4MENA 4BJXA 2LGVA 5HRVA 5I7XA 2LXPC 3JVLA 2R0SA 2EJNA 2QJ0A 2KTBB 5D3JA 2QIZA 5E3GA 2YDWA 5HENA 2HDPA 2YU4A 2DKWA 3M62A 4MR5A 5CY9A 2AN6A 5D7XA 4NRCA 2KREA 2E61A 2VJEB 3ZYQA 3O47A 4FLPA 5ENGA 5EVAA 5FG6A 3JVKA 2N9GA 4QSPA 4A9IA 5TBNA 3UV5A 3O70A 4TZ2A 2JMIA 2ECWA 4Z6HA 5FH7A 2MIQA 2PNXA 3JVMA 4NUCA 4YATA 5E7DA 1RMDA 5F61A 2MA6A 2JRJA 2XB1A 4J0RA 5SVXA 4TS8A 4HBYA 2R0YA 5HCLA 5L8UA 1T1HA 1Z60A 2K16A 3SVFA 4FJCA 4I7DA 1JM7A 5D3LA 3ZNIA 4OUFA 4ZW1A 5I7YA 1JSPB 5HLSA 2LXHC 3SOUA 2VJEA 2HYED 2ECTA 2RO1A 3LQJA 2CSZA 4TT6A 3O36A 2OSSA 3LDYA 4PTBA 5E9VA 3U5NA 2KFTA 3FM8C 4FK5A 2L43A 4ALHA 5HRXA 5TCMA 3NG2A 5DYUA 4IC2A 5FE8A 5DLZA 5AMEA 4ZC9A 2XOZA 3V43A 5CFWA 2I50A 4J1PA 4KV4A 5HQ5A 4NS5A 3HMHA 4LJNA 5CUEA 5F1LA 4V3LC 1V87A 2DVSA 2RNYA 3DQVR 4O76A 5CTLA 5FE5A 4A9KA 5AMFA 5FERA 4Z93A 4KCXA 4QC3A 4UP0A 4N4FA 4W4UA 3RCWA 1N87A 5DX4A 3P1CA 4LZSA 1WEOA 2E6SA 2LDRA 4O64A 1WIMA 2YHNA 5A81A 3JUEA 1X0JA 4NYWA 4CUSA 4Z0RA 2L5EA 5EU1A 4O77A 4Q0OA 4S3OB 5D1LB 5EWWA 5E9YA 4QSVA 3AADA 4O74A 3UW9A 3IU5A 2KWJA 4A9FA 5I89A 4QNSA 5C89A 2MA5A 5LCWB 5D26A 4WZ0A 2F42A 2RFJA 5KTUA 5IGMA 2EXUA 4CFKA 2BAYA 5HFQA 2VP7A 5CUCA 4TYLA 2M13A 1K2FA 4CLBA 1MM3A 3FANA 4GNFA 4ZDTA 2PUYA 2ECGA 2L85A 4F3IA 5EPBA 5C4QA 4A4CA 2MUMA 2LQ6A 5DBMA 3UV2A 2DVRA 3UV4A 5SVIB 2E6RA 3KV6A 4I7BA 4IOQA 5I40A 5A5QA 1WUMA 2JUNA 2MD8C 2H0DA 5ACYA 1DVPA 5DLXA 5DKAA 5E9MA 2LGGA 2DWWA 3FJUB 4OGIA 4LLBA 5B77A 2JMJA 4C67A 4WA6A 5EICA 4H9DA 1WEQA 5D1KB 3HMEA 3U5LA 3U5KA 3UVXA 3RPGC 1EQFA 4WHWA 5FE2A 4PS5A 5CU8A 4NRBA 4QSTA 4WZ3B 5AD2A 5DW1A 5ENBA 5B79A 4O75A 3LJUX 5EISA 2MNYA 1ZS5A 4YYKA 4CCGX 4MEQA 4QSUA 5FG4A 4TKPB 2K4DA 2LN0A 2OUOA 4UYFB 4QUUA 4LYSA 4XUAA 5CPEA 2CSVA 3Q2EA 3SOXA 2VPGA 4XY9A 2DJAA 2GRCA 2YEMA 4HBVA 3D7CA 2L75A 4LK9A 3ONIA 4Q6FA 2R0VA 5HFRA 1LDKC 4YBSA 2CRRA 5CQAA 3PUQA 5EWHA 3N9MA 5CQ5A 5J0DA 2E7NA 2XOCA 4XUBA 5IGKA 4L7XA 4HXOA 5I88A 5D3TA 4O78A 5FFVA 2G6QA 2YQLA 3GV4A 4UIWA 5FH8A 1N72A 4QSRA 5A83A 4CUQA 3P1DA 3D1BA 4A9NA 3HCUA 3LVQE 4Z0OA 2MNZA 2FFWA 5FH6A 5TDRA 1MM2A 5DKHA 4NXJA 4TU6A 2D9EA 4QR4A 2EA6A 3FL2A 5LKZA 4QBMA 4GNEA 4OGEA 4PY6A 5DFBA 5DKCA 1FBVA 2KYUA 4QSSA 4MEOA 5KTXA 4E96A 4AVXA 2KWOA 1XWHA 4V3KC 2YQMA 2FUUA 4J0SA 1WEMA 3O35A 4PCEA 2C2VS 2RS9B 2CKLA 3EB5A 2JMDA 3QZTA 4Y03A 2IDAA 2K1JA 5B75A 4NR4A 3L1ZB 5B78A 1LDJB 4IR4A 3UVWA 5I83A 5LKUA 4PKLA 4UYFA 3N9OA 1WGMA 4LZRA 4YC9A 5B76A 3SUBA 4TT2A 1CHCA 3IU6A 2M3HA 4CUPA 2Y43A 5II1A 4UP5A 3U5PA 5EP7A 3VKGA 5EYAF 5G4RA 5A85A 3E2DA 4PPEA 1E6IA 4HXNA 1BORA 4NR5A 3ZYUA 1WFKA 3DDTA 3T9KA 4TQNA 5E73A 5D3SA 4UYDA 5LJ0A 1E4UA 5D3PA 5A5SA 1VYXA 4N4HA 4NYXA 5C7NA 1X4IA 2LGLA 3N9PA 4XI1A 4AUQB 5C11A 4YADA 3C5KA 5E0RA 3ERRA 4UYEA 4QSQA 5HEMA 3LVRE 4GNDA 5L97A 4HXPA 2IQJA 5E3DA 5EWVA 1X4UA 5IGLA 5CUDA 4AYCB 3U5MA 2CRWA 5CZGA 2VPDA 3O37A 4YH4A 4NQMA 3SVHA 4QQ4A 5L96A 3DAIA 1ZKRA 4IORA 3K2JA 3L1XA 2C2LA 2KWNA 4R7EA 1WEUA 4NR7A 5CUBA 3U5OA 5FE7A 3GL6A 2E3KA 5CP5A 4LKAA 1F62A 2KGGA 5D3NA 1VFYA 5EGUA 4YABA 4CUUA 4AKGA 2F6NA 5IBNA 2DX8A 3DWYA 4IR6A 5F36A 4YY4A 2KR4A 3Q1DA 4YBTA 4MR4A 1JM4B 2LGKA 5ETBA 4L58A 4CUTA 3UVYA 2MD7B 4AKNA 2NAAA 4UIXA 5CQTA 3S92A 4BW2A 5CGPA 1DCQA 4RVRA 4Z1QA 4YAXA 5ENHA 5H85A 4CL9A 5CS8A 5CQ6A 4AKHA 1IYMA 2VPEA 2KE1A 5C87A 2YYNA 2MT5A 5DINA 2EGMA 3O33A 5F1HA 5F60A 4MSXA 3FEHA 3QZVA 4HXMA 5KH7A 3LXJA 1FP0A 5SVIA 3H7HA 4NR8A 5ENIA 2ECJA 4UYHA 3GG3A 3FAOA 4WHUA 3M7KA 4XY8A 3S91A 2XOYA 3ZVYA 3HCSA 2K17A 4BW1A 3P1FA 5A7CA 2CSYA 5FEYA 3ZPV1 2VPBA 2YT5A 3ASLA 4F52B 5AIUA 5KH3A 5G05B 4NYVA 5E9LA 2JM3A 5FE1A 4YYGA 2KWKA 2FSAA 5F25A 4YYHA 1VD4A 3MDBC 4QR3A 3LQHA 4UITA 4NQNA 5D25A 2H60A 4A9MA 2CONA 4NRAA 1PUOA 3U5JA 5AD3A 3VK6A 5HELA 2M85A 5DFCA 4UI9B 4N4GA 2NXBA 5A5PA 4O7FA 2KIZA 4LZ2A 5CUAA 2VJFA 4O62A 4BW3A 1HYIA 5II2A 4A9HA 2LAUA 2L0BA 3LRQA 4YYNA 2FD4A 3DPLR 1Z2QA 2WP1A 4O7AA 3AQAA 5D24A 1WEWA 3HCTA 4QEWA 4P5OB 1JM7B 4GNGA 4ALGA 2M6MA 1Z6UA 2OWAA 4I7CA 5JWMA 5EQ1A 2YVRA 5DYCA 5ENCA 2KGIA 2YYRA 5EV9A 3KDEC 5A5RA 4DONA 5I86A 2E7OA 4LR6A 4QUTA 2VJFB 5A5NA 4QF3A 4YYJA 2MJVB 5FBXA 4BHWA 4TU4A 3MB4A 5K29A 4QYLA 4Z1SA 2D8UA 4IR3A 3MULA 3HMFA 5KO4A 3LQIA 4QEVA 5CUGA 5HRWA 5TRBA 2P57A 2QICA 3RTRB 5FG5A 5LJ1A 4FO9A 1WUGA 2ECVA 2YSJA 4A4BA 2F6JA 4AP4A 4UIYA 4C66A 3KV5A 2DSMA 3T7LA 1HYJA 5E74A 5E9KA 5ENJA 2YHOA 3KQIA 4R2YA 2L7PA 4NR6A 3T6RA 4QY4A 3MHHA 2YURA 4QC1A 4YH3A 5K3QA 5I80A 2M1RA 5EWDA 1U6GB 4MEPA 5FE0A 2I8NA 1WESA 3I3JA 2YW8A 4O72A 1F68A 4NUDA 5ENEA 2H0DB 4LADB 4YY6A 4LYIA 5I1QA 2RI7A 3MB3A 3EB6A 3HTKC 5EPSA 5F3AA 4OGCA 2YEKA 4QSWA 5CRMA 3L11A 2RNXA 5G4SA 5KTWA 4WZ2A 1JOCA 5D3RA 4QB3A 4ZQLA 3SOWA 4NR9A 2EODA 2D82A 4LDFA 3PHDA 2YQDA 2RSDA 4X3GA 4A49A 5D3HA 4B7YC 5KHMA 2LV9A 5FFWA 5EK9A 3N9NA 4HBWA 3Q2FA 5F63A 2UZGA 5D1MB 5L98A 5BT4A 2I7KA 3MUKA 2KKYA 5DFDA 4TZ8A 4Q0NA 5H9MA 4YK0A 3SVGA 1WENA 4GB0A 4N3WA 3FKMX 5FE9A 4UIZA 5EWCA 2RNWA 3M99A 2Y1NA 5DW2A 5LUUA 5EM3A 5E9IA 1WEEA 5FE6A 5BT5A 4NN2A 3MQMA 4OGJA 3IHPA 5FDZA 2G4AA 4UYGA 5AITA 2LRIC 4X2IA 4B86C 5C8GA 1X4JA 5IGNA 2OO1A 3PURA 5H1VA 5C85A 3SHBA 5KU3A 3P5OA 5H1TA 5G0FA 2Y1MA 5B8DA 4QZSA 5CQ4A 4TTEA 2DVQA 5F62A 2XEUA 5FB1A 5BT3A 2WP2A 4NUEA 2ECIA 2YELA 2KU3A 4A0CD 3ZPVE 2L5UA 4PCIA 2YW5A 4HXSA 5JI8A 3O7AA 3G0LA 5J3XA
chains in the Genus database with same CATH topology
2YSMA 5DY7A 5EA1A 5FB0A 5L99A 4GPJA 3TLPA 3UVDA 4O7EA 4UIUA 1WEVA 4C9ZA 3JVJA 5EPRA 3QZSA 5FFYA 3NXBA 2OXQC 4O7BA 4LYWA 4O71A 5A82A 5LVRA 4O70A 5C13A 4A9EA 5L8TA 5HQ6A 3C6WA 4QF2A 3I2DA 4AYCA 3M63A 5I3LA 4HXKA 2LSPB 5ETDA 3RPGB 4S3OC 3N9QA 5ENFA 4ZUXU 5D0CA 2VNFA 4A9LA 4YYIA 3LJWA 1WILA 2G45A 2R10A 4TT4A 5CQ7A 1ZBDB 2CT2A 3MXFA 4YBMA 5CQ8A 3P1EA 2DATA 2YUCA 5FE4A 5TB6A 5IG6A 4IC3A 4N4IA 4HBXA 4A9OA 2ZETC 3KNVA 5COIA 4J3IA 5JG6A 4WIVA 4MR6A 5IIDA 5DKDA 2DVVA 5LVQA 5H1UA 2G43A 5CQ3A 4HXRA 3MHSA 2D8SA 3ZTGA 4YYDA 5F5ZA 4QYDA 2ECNA 2EGPA 4LRGA 5FE3A 4LC2A 4QR5A 5F2PA 4YYMA 4IOOA 3G0JA 4MR3A 5HJCA 4QEUA 4BW4A 2CKLB 2L80A 5HQ7A 4FIPA 5EI4A 3ZVZB 5I29A 3N9LA 4MVTA 1G25A 4BBQA 5TABA 4XYAA 4KV1A 3O34A 4A9JA 5A5OA 4CURA 5HM0A 5CRZA 4R8PK 5LJ2A 4HXLA 4CFLA 4CA1A 2L84A 2YREA 4IR5A 5LKTA 5KH9A 4Z6IA 4UIVA 5G04B 4O7CA 5DYXA 5TDWA 4QSXA 1WE9A 5LKXA 5DYAA 2FUIA 1WEPA 4MENA 4BJXA 2LGVA 5HRVA 5I7XA 2LXPC 3JVLA 2R0SA 2QJ0A 2KTBB 5D3JA 2QIZA 5E3GA 2YDWA 5HENA 2HDPA 2YU4A 2DKWA 3M62A 4MR5A 5CY9A 2AN6A 5D7XA 4NRCA 2KREA 2VJEB 3ZYQA 4FLPA 5ENGA 5EVAA 5FG6A 3JVKA 2N9GA 4QSPA 4A9IA 5TBNA 3UV5A 3O70A 4TZ2A 2JMIA 2ECWA 4Z6HA 5FH7A 2MIQA 2PNXA 3JVMA 4NUCA 4YATA 5E7DA 1RMDA 5F61A 2MA6A 2JRJA 2XB1A 4J0RA 4TS8A 4HBYA 2R0YA 5HCLA 5L8UA 1T1HA 1Z60A 2K16A 3SVFA 4FJCA 4I7DA 1JM7A 5D3LA 3ZNIA 4OUFA 4ZW1A 5I7YA 1JSPB 5HLSA 2LXHC 3SOUA 2VJEA 2HYED 2ECTA 2RO1A 3LQJA 2CSZA 4TT6A 3O36A 2OSSA 4PTBA 5E9VA 3U5NA 2KFTA 4FK5A 2L43A 4ALHA 5HRXA 5TCMA 3NG2A 5DYUA 4IC2A 5FE8A 5DLZA 5AMEA 4ZC9A 3V43A 5CFWA 2I50A 4J1PA 4KV4A 5HQ5A 4NS5A 3HMHA 4LJNA 5CUEA 5F1LA 4V3LC 1V87A 2DVSA 2RNYA 3DQVR 4O76A 5CTLA 5FE5A 4A9KA 5AMFA 5FERA 4Z93A 4KCXA 4QC3A 4UP0A 4N4FA 4W4UA 3RCWA 1N87A 5DX4A 3P1CA 4LZSA 1WEOA 2E6SA 2LDRA 4O64A 1WIMA 2YHNA 5A81A 1X0JA 4NYWA 4CUSA 2L5EA 5EU1A 4O77A 4Q0OA 4S3OB 5D1LB 5EWWA 5E9YA 4QSVA 3AADA 4O74A 3UW9A 3IU5A 2KWJA 4A9FA 5I89A 4QNSA 5C89A 2MA5A 5LCWB 5D26A 4WZ0A 2F42A 2RFJA 5KTUA 5IGMA 4CFKA 2BAYA 5HFQA 2VP7A 5CUCA 4TYLA 1K2FA 4CLBA 1MM3A 4GNFA 4ZDTA 2PUYA 2ECGA 2L85A 4F3IA 5EPBA 5C4QA 4A4CA 2MUMA 2LQ6A 5DBMA 3UV2A 2DVRA 3UV4A 2E6RA 3KV6A 4I7BA 4IOQA 5I40A 5A5QA 1WUMA 2MD8C 2H0DA 5ACYA 1DVPA 5DLXA 5DKAA 5E9MA 2LGGA 2DWWA 4LLBA 4OGIA 5B77A 2JMJA 4C67A 4WA6A 5EICA 1WEQA 5D1KB 3HMEA 3U5LA 3U5KA 3UVXA 3RPGC 1EQFA 4WHWA 5FE2A 4PS5A 5CU8A 4NRBA 4QSTA 4WZ3B 5AD2A 5DW1A 5ENBA 5B79A 4O75A 5EISA 2MNYA 1ZS5A 4YYKA 4CCGX 4MEQA 4QSUA 5FG4A 4TKPB 2K4DA 2LN0A 2OUOA 4UYFB 4QUUA 4LYSA 4XUAA 5CPEA 3Q2EA 3SOXA 2VPGA 4XY9A 2GRCA 2YEMA 4HBVA 3D7CA 2L75A 4LK9A 3ONIA 4Q6FA 2R0VA 5HFRA 1LDKC 4YBSA 5CQAA 3PUQA 5EWHA 3N9MA 5CQ5A 5J0DA 2E7NA 4XUBA 5IGKA 4L7XA 4HXOA 5I88A 5D3TA 4O78A 5FFVA 2G6QA 2YQLA 3GV4A 4UIWA 5FH8A 1N72A 4QSRA 5A83A 4CUQA 3P1DA 4A9NA 3HCUA 2MNZA 5FH6A 5TDRA 1MM2A 5DKHA 4NXJA 4TU6A 2D9EA 4QR4A 2EA6A 3FL2A 5LKZA 4QBMA 4GNEA 4PY6A 5DFBA 5DKCA 1FBVA 2KYUA 4QSSA 4MEOA 5KTXA 4E96A 4AVXA 2KWOA 1XWHA 4V3KC 2YQMA 2FUUA 4J0SA 1WEMA 3O35A 4PCEA 2C2VS 2RS9B 2CKLA 3EB5A 2JMDA 3QZTA 4Y03A 2IDAA 2K1JA 5B75A 4NR4A 3L1ZB 5B78A 1LDJB 4IR4A 3UVWA 5I83A 5LKUA 4PKLA 4UYFA 3N9OA 1WGMA 4LZRA 4YC9A 5B76A 4TT2A 1CHCA 3IU6A 2M3HA 4CUPA 2Y43A 5II1A 4UP5A 3U5PA 5EP7A 5EYAF 5G4RA 5A85A 4PPEA 1E6IA 4HXNA 1BORA 4NR5A 3ZYUA 1WFKA 4TQNA 5E73A 5D3SA 4UYDA 5LJ0A 1E4UA 5D3PA 5A5SA 1VYXA 4N4HA 4NYXA 5C7NA 1X4IA 2LGLA 3N9PA 4XI1A 4AUQB 5C11A 4YADA 3C5KA 5E0RA 4UYEA 4QSQA 5HEMA 4GNDA 5L97A 4HXPA 5E3DA 5EWVA 1X4UA 5IGLA 5CUDA 4AYCB 3U5MA 5CZGA 2VPDA 3O37A 4YH4A 4NQMA 3SVHA 5L96A 3DAIA 4IORA 3K2JA 3L1XA 2C2LA 2KWNA 4R7EA 1WEUA 4NR7A 5CUBA 3U5OA 5FE7A 3GL6A 2E3KA 5CP5A 4LKAA 1F62A 2KGGA 5D3NA 1VFYA 5EGUA 4YABA 4CUUA 2F6NA 5IBNA 2DX8A 3DWYA 4IR6A 5F36A 4YY4A 2KR4A 4YBTA 4MR4A 1JM4B 2LGKA 5ETBA 4L58A 4CUTA 3UVYA 2MD7B 4AKNA 2NAAA 4UIXA 5CQTA 3S92A 4BW2A 5CGPA 4RVRA 4Z1QA 4YAXA 5ENHA 5H85A 4CL9A 5CS8A 5CQ6A 1IYMA 2VPEA 2KE1A 5C87A 2YYNA 2MT5A 5DINA 3O33A 5F1HA 5F60A 4MSXA 3QZVA 4HXMA 5KH7A 3LXJA 1FP0A 4NR8A 5ENIA 2ECJA 4UYHA 3GG3A 4WHUA 4XY8A 3S91A 3ZVYA 3HCSA 2K17A 4BW1A 3P1FA 5A7CA 2CSYA 5FEYA 3ZPV1 2VPBA 2YT5A 3ASLA 4F52B 5AIUA 5KH3A 5G05B 4NYVA 5E9LA 5FE1A 4YYGA 2KWKA 2FSAA 5F25A 4YYHA 1VD4A 4QR3A 3LQHA 4UITA 4NQNA 5D25A 2H60A 4A9MA 4NRAA 3U5JA 5AD3A 3VK6A 5HELA 2M85A 5DFCA 4UI9B 4N4GA 2NXBA 5A5PA 4O7FA 2KIZA 4LZ2A 5CUAA 2VJFA 4BW3A 1HYIA 5II2A 4A9HA 3LRQA 2L0BA 4YYNA 3DPLR 1Z2QA 2WP1A 4O7AA 3AQAA 5D24A 1WEWA 3HCTA 4QEWA 4P5OB 1JM7B 4GNGA 4ALGA 2M6MA 1Z6UA 4I7CA 5JWMA 5EQ1A 5DYCA 5ENCA 2KGIA 2YYRA 5EV9A 5A5RA 4DONA 5I86A 2E7OA 4LR6A 4QUTA 2VJFB 5A5NA 4QF3A 4YYJA 2MJVB 5FBXA 4BHWA 4TU4A 3MB4A 5K29A 4QYLA 4Z1SA 4IR3A 3MULA 3HMFA 5KO4A 3LQIA 4QEVA 5CUGA 5HRWA 5TRBA 3RTRB 2QICA 5FG5A 5LJ1A 4FO9A 1WUGA 2ECVA 2YSJA 4A4BA 2F6JA 4AP4A 4UIYA 4C66A 3KV5A 3T7LA 1HYJA 5E74A 5E9KA 5ENJA 2YHOA 3KQIA 4R2YA 4NR6A 3T6RA 4QY4A 3MHHA 2YURA 4QC1A 4YH3A 5I80A 2M1RA 5EWDA 1U6GB 4MEPA 5FE0A 2I8NA 1WESA 3I3JA 2YW8A 4O72A 1F68A 4NUDA 5ENEA 2H0DB 4LADB 4YY6A 4LYIA 5I1QA 2RI7A 3MB3A 3EB6A 3HTKC 5EPSA 5F3AA 2YEKA 4QSWA 5CRMA 3L11A 2RNXA 5G4SA 5KTWA 4WZ2A 1JOCA 5D3RA 4QB3A 4ZQLA 3SOWA 4NR9A 2EODA 2D82A 4LDFA 3PHDA 2YQDA 2RSDA 4X3GA 4A49A 5D3HA 4B7YC 5KHMA 2LV9A 5FFWA 5EK9A 3N9NA 4HBWA 3Q2FA 5F63A 2UZGA 5D1MB 5L98A 5BT4A 2I7KA 3MUKA 5DFDA 4TZ8A 4Q0NA 5H9MA 4YK0A 3SVGA 1WENA 4GB0A 4N3WA 3FKMX 5FE9A 4UIZA 5EWCA 2RNWA 3M99A 2Y1NA 5DW2A 5LUUA 5EM3A 5E9IA 1WEEA 5FE6A 5BT5A 4NN2A 3MQMA 4OGJA 3IHPA 5FDZA 2G4AA 4UYGA 5AITA 2LRIC 4X2IA 4B86C 5C8GA 1X4JA 5IGNA 2OO1A 3PURA 5H1VA 5C85A 3SHBA 5KU3A 3P5OA 5H1TA 5G0FA 2Y1MA 5B8DA 4QZSA 5CQ4A 4TTEA 2DVQA 5F62A 2XEUA 5FB1A 5BT3A 2WP2A 4NUEA 2ECIA 2YELA 2KU3A 4A0CD 3ZPVE 2L5UA 4PCIA 2YW5A 4HXSA 5JI8A 3O7AA 3G0LA 5J3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSM A;  5DY7 A;  5EA1 A;  5FB0 A;  5L99 A;  4GPJ A;  3TLP A;  3UVD A;  4O7E A;  4UIU A;  1WEV A;  4C9Z A;  3JVJ A;  5EPR A;  3QZS A;  5FFY A;  3NXB A;  2OXQ C;  4O7B A;  4LYW A;  4O71 A;  5A82 A;  5LVR A;  4O70 A;  5C13 A;  4A9E A;  5L8T A;  5HQ6 A;  3C6W A;  4QF2 A;  3I2D A;  4AYC A;  3M63 A;  5I3L A;  4HXK A;  2LSP B;  5ETD A;  3RPG B;  4S3O C;  3N9Q A;  5ENF A;  4ZUX U;  5D0C A;  2VNF A;  4A9L A;  4YYI A;  3LJW A;  1WIL A;  2G45 A;  2R10 A;  4TT4 A;  5CQ7 A;  1ZBD B;  2CT2 A;  3MXF A;  4YBM A;  5CQ8 A;  3P1E A;  2DAT A;  2YUC A;  5FE4 A;  5TB6 A;  5IG6 A;  4IC3 A;  4N4I A;  4HBX A;  4A9O A;  2ZET C;  3KNV A;  5COI A;  4J3I A;  5JG6 A;  4WIV A;  4MR6 A;  5IID A;  5DKD A;  2DVV A;  5LVQ A;  5H1U A;  2G43 A;  5CQ3 A;  4HXR A;  3MHS A;  2D8S A;  3ZTG A;  4YYD A;  5F5Z A;  4QYD A;  2ECN A;  2EGP A;  4LRG A;  5FE3 A;  4LC2 A;  4QR5 A;  5F2P A;  4YYM A;  4IOO A;  3G0J A;  4MR3 A;  5HJC A;  4QEU A;  4BW4 A;  2CKL B;  2L80 A;  5HQ7 A;  4FIP A;  5EI4 A;  3ZVZ B;  5I29 A;  3N9L A;  4MVT A;  1G25 A;  4BBQ A;  5TAB A;  4XYA A;  4KV1 A;  3O34 A;  4A9J A;  5A5O A;  4CUR A;  5HM0 A;  5CRZ A;  4R8P K;  5LJ2 A;  4HXL A;  4CFL A;  4CA1 A;  2L84 A;  2YRE A;  4IR5 A;  5LKT A;  5KH9 A;  4Z6I A;  4UIV A;  5G04 B;  4O7C A;  5DYX A;  5TDW A;  4QSX A;  1WE9 A;  5LKX A;  5DYA A;  2FUI A;  1WEP A;  4MEN A;  4BJX A;  2LGV A;  5HRV A;  5I7X A;  2LXP C;  3JVL A;  2R0S A;  2QJ0 A;  2KTB B;  5D3J A;  2QIZ A;  5E3G A;  2YDW A;  5HEN A;  2HDP A;  2YU4 A;  2DKW A;  3M62 A;  4MR5 A;  5CY9 A;  2AN6 A;  5D7X A;  4NRC A;  2KRE A;  2VJE B;  3ZYQ A;  4FLP A;  5ENG A;  5EVA A;  5FG6 A;  3JVK A;  2N9G A;  4QSP A;  4A9I A;  5TBN A;  3UV5 A;  3O70 A;  4TZ2 A;  2JMI A;  2ECW A;  4Z6H A;  5FH7 A;  2MIQ A;  2PNX A;  3JVM A;  4NUC A;  4YAT A;  5E7D A;  1RMD A;  5F61 A;  2MA6 A;  2JRJ A;  2XB1 A;  4J0R A;  4TS8 A;  4HBY A;  2R0Y A;  5HCL A;  5L8U A;  1T1H A;  1Z60 A;  2K16 A;  3SVF A;  4FJC A;  4I7D A;  1JM7 A;  5D3L A;  3ZNI A;  4OUF A;  4ZW1 A;  5I7Y A;  1JSP B;  5HLS A;  2LXH C;  3SOU A;  2VJE A;  2HYE D;  2ECT A;  2RO1 A;  3LQJ A;  2CSZ A;  4TT6 A;  3O36 A;  2OSS A;  4PTB A;  5E9V A;  3U5N A;  2KFT A;  4FK5 A;  2L43 A;  4ALH A;  5HRX A;  5TCM A;  3NG2 A;  5DYU A;  4IC2 A;  5FE8 A;  5DLZ A;  5AME A;  4ZC9 A;  3V43 A;  5CFW A;  2I50 A;  4J1P A;  4KV4 A;  5HQ5 A;  4NS5 A;  3HMH A;  4LJN A;  5CUE A;  5F1L A;  4V3L C;  1V87 A;  2DVS A;  2RNY A;  3DQV R;  4O76 A;  5CTL A;  5FE5 A;  4A9K A;  5AMF A;  5FER A;  4Z93 A;  4KCX A;  4QC3 A;  4UP0 A;  4N4F A;  4W4U A;  3RCW A;  1N87 A;  5DX4 A;  3P1C A;  4LZS A;  1WEO A;  2E6S A;  2LDR A;  4O64 A;  1WIM A;  2YHN A;  5A81 A;  1X0J A;  4NYW A;  4CUS A;  2L5E A;  5EU1 A;  4O77 A;  4Q0O A;  4S3O B;  5D1L B;  5EWW A;  5E9Y A;  4QSV A;  3AAD A;  4O74 A;  3UW9 A;  3IU5 A;  2KWJ A;  4A9F A;  5I89 A;  4QNS A;  5C89 A;  2MA5 A;  5LCW B;  5D26 A;  4WZ0 A;  2F42 A;  2RFJ A;  5KTU A;  5IGM A;  4CFK A;  2BAY A;  5HFQ A;  2VP7 A;  5CUC A;  4TYL A;  1K2F A;  4CLB A;  1MM3 A;  4GNF A;  4ZDT A;  2PUY A;  2ECG A;  2L85 A;  4F3I A;  5EPB A;  5C4Q A;  4A4C A;  2MUM A;  2LQ6 A;  5DBM A;  3UV2 A;  2DVR A;  3UV4 A;  2E6R A;  3KV6 A;  4I7B A;  4IOQ A;  5I40 A;  5A5Q A;  1WUM A;  2MD8 C;  2H0D A;  5ACY A;  1DVP A;  5DLX A;  5DKA A;  5E9M A;  2LGG A;  2DWW A;  4LLB A;  4OGI A;  5B77 A;  2JMJ A;  4C67 A;  4WA6 A;  5EIC A;  1WEQ A;  5D1K B;  3HME A;  3U5L A;  3U5K A;  3UVX A;  3RPG C;  1EQF A;  4WHW A;  5FE2 A;  4PS5 A;  5CU8 A;  4NRB A;  4QST A;  4WZ3 B;  5AD2 A;  5DW1 A;  5ENB A;  5B79 A;  4O75 A;  5EIS A;  2MNY A;  1ZS5 A;  4YYK A;  4CCG X;  4MEQ A;  4QSU A;  5FG4 A;  4TKP B;  2K4D A;  2LN0 A;  2OUO A;  4UYF B;  4QUU A;  4LYS A;  4XUA A;  5CPE A;  3Q2E A;  3SOX A;  2VPG A;  4XY9 A;  2GRC A;  2YEM A;  4HBV A;  3D7C A;  2L75 A;  4LK9 A;  3ONI A;  4Q6F A;  2R0V A;  5HFR A;  1LDK C;  4YBS A;  5CQA A;  3PUQ A;  5EWH A;  3N9M A;  5CQ5 A;  5J0D A;  2E7N A;  4XUB A;  5IGK A;  4L7X A;  4HXO A;  5I88 A;  5D3T A;  4O78 A;  5FFV A;  2G6Q A;  2YQL A;  3GV4 A;  4UIW A;  5FH8 A;  1N72 A;  4QSR A;  5A83 A;  4CUQ A;  3P1D A;  4A9N A;  3HCU A;  2MNZ A;  5FH6 A;  5TDR A;  1MM2 A;  5DKH A;  4NXJ A;  4TU6 A;  2D9E A;  4QR4 A;  2EA6 A;  3FL2 A;  5LKZ A;  4QBM A;  4GNE A;  4PY6 A;  5DFB A;  5DKC A;  1FBV A;  2KYU A;  4QSS A;  4MEO A;  5KTX A;  4E96 A;  4AVX A;  2KWO A;  1XWH A;  4V3K C;  2YQM A;  2FUU A;  4J0S A;  1WEM A;  3O35 A;  4PCE A;  2C2V S;  2RS9 B;  2CKL A;  3EB5 A;  2JMD A;  3QZT A;  4Y03 A;  2IDA A;  2K1J A;  5B75 A;  4NR4 A;  3L1Z B;  5B78 A;  1LDJ B;  4IR4 A;  3UVW A;  5I83 A;  5LKU A;  4PKL A;  4UYF A;  3N9O A;  1WGM A;  4LZR A;  4YC9 A;  5B76 A;  4TT2 A;  1CHC A;  3IU6 A;  2M3H A;  4CUP A;  2Y43 A;  5II1 A;  4UP5 A;  3U5P A;  5EP7 A;  5EYA F;  5G4R A;  5A85 A;  4PPE A;  1E6I A;  4HXN A;  1BOR A;  4NR5 A;  3ZYU A;  1WFK A;  4TQN A;  5E73 A;  5D3S A;  4UYD A;  5LJ0 A;  1E4U A;  5D3P A;  5A5S A;  1VYX A;  4N4H A;  4NYX A;  5C7N A;  1X4I A;  2LGL A;  3N9P A;  4XI1 A;  4AUQ B;  5C11 A;  4YAD A;  3C5K A;  5E0R A;  4UYE A;  4QSQ A;  5HEM A;  4GND A;  5L97 A;  4HXP A;  5E3D A;  5EWV A;  1X4U A;  5IGL A;  5CUD A;  4AYC B;  3U5M A;  5CZG A;  2VPD A;  3O37 A;  4YH4 A;  4NQM A;  3SVH A;  5L96 A;  3DAI A;  4IOR A;  3K2J A;  3L1X A;  2C2L A;  2KWN A;  4R7E A;  1WEU A;  4NR7 A;  5CUB A;  3U5O A;  5FE7 A;  3GL6 A;  2E3K A;  5CP5 A;  4LKA A;  1F62 A;  2KGG A;  5D3N A;  1VFY A;  5EGU A;  4YAB A;  4CUU A;  2F6N A;  5IBN A;  2DX8 A;  3DWY A;  4IR6 A;  5F36 A;  4YY4 A;  2KR4 A;  4YBT A;  4MR4 A;  1JM4 B;  2LGK A;  5ETB A;  4L58 A;  4CUT A;  3UVY A;  2MD7 B;  4AKN A;  2NAA A;  4UIX A;  5CQT A;  3S92 A;  4BW2 A;  5CGP A;  4RVR A;  4Z1Q A;  4YAX A;  5ENH A;  5H85 A;  4CL9 A;  5CS8 A;  5CQ6 A;  1IYM A;  2VPE A;  2KE1 A;  5C87 A;  2YYN A;  2MT5 A;  5DIN A;  3O33 A;  5F1H A;  5F60 A;  4MSX A;  3QZV A;  4HXM A;  5KH7 A;  3LXJ A;  1FP0 A;  4NR8 A;  5ENI A;  2ECJ A;  4UYH A;  3GG3 A;  4WHU A;  4XY8 A;  3S91 A;  3ZVY A;  3HCS A;  2K17 A;  4BW1 A;  3P1F A;  5A7C A;  2CSY A;  5FEY A;  3ZPV 1;  2VPB A;  2YT5 A;  3ASL A;  4F52 B;  5AIU A;  5KH3 A;  5G05 B;  4NYV A;  5E9L A;  5FE1 A;  4YYG A;  2KWK A;  2FSA A;  5F25 A;  4YYH A;  1VD4 A;  4QR3 A;  3LQH A;  4UIT A;  4NQN A;  5D25 A;  2H60 A;  4A9M A;  4NRA A;  3U5J A;  5AD3 A;  3VK6 A;  5HEL A;  2M85 A;  5DFC A;  4UI9 B;  4N4G A;  2NXB A;  5A5P A;  4O7F A;  2KIZ A;  4LZ2 A;  5CUA A;  2VJF A;  4BW3 A;  1HYI A;  5II2 A;  4A9H A;  3LRQ A;  2L0B A;  4YYN A;  3DPL R;  1Z2Q A;  2WP1 A;  4O7A A;  3AQA A;  5D24 A;  1WEW A;  3HCT A;  4QEW A;  4P5O B;  1JM7 B;  4GNG A;  4ALG A;  2M6M A;  1Z6U A;  4I7C A;  5JWM A;  5EQ1 A;  5DYC A;  5ENC A;  2KGI A;  2YYR A;  5EV9 A;  5A5R A;  4DON A;  5I86 A;  2E7O A;  4LR6 A;  4QUT A;  2VJF B;  5A5N A;  4QF3 A;  4YYJ A;  2MJV B;  5FBX A;  4BHW A;  4TU4 A;  3MB4 A;  5K29 A;  4QYL A;  4Z1S A;  4IR3 A;  3MUL A;  3HMF A;  5KO4 A;  3LQI A;  4QEV A;  5CUG A;  5HRW A;  5TRB A;  3RTR B;  2QIC A;  5FG5 A;  5LJ1 A;  4FO9 A;  1WUG A;  2ECV A;  2YSJ A;  4A4B A;  2F6J A;  4AP4 A;  4UIY A;  4C66 A;  3KV5 A;  3T7L A;  1HYJ A;  5E74 A;  5E9K A;  5ENJ A;  2YHO A;  3KQI A;  4R2Y A;  4NR6 A;  3T6R A;  4QY4 A;  3MHH A;  2YUR A;  4QC1 A;  4YH3 A;  5I80 A;  2M1R A;  5EWD A;  1U6G B;  4MEP A;  5FE0 A;  2I8N A;  1WES A;  3I3J A;  2YW8 A;  4O72 A;  1F68 A;  4NUD A;  5ENE A;  2H0D B;  4LAD B;  4YY6 A;  4LYI A;  5I1Q A;  2RI7 A;  3MB3 A;  3EB6 A;  3HTK C;  5EPS A;  5F3A A;  2YEK A;  4QSW A;  5CRM A;  3L11 A;  2RNX A;  5G4S A;  5KTW A;  4WZ2 A;  1JOC A;  5D3R A;  4QB3 A;  4ZQL A;  3SOW A;  4NR9 A;  2EOD A;  2D82 A;  4LDF A;  3PHD A;  2YQD A;  2RSD A;  4X3G A;  4A49 A;  5D3H A;  4B7Y C;  5KHM A;  2LV9 A;  5FFW A;  5EK9 A;  3N9N A;  4HBW A;  3Q2F A;  5F63 A;  2UZG A;  5D1M B;  5L98 A;  5BT4 A;  2I7K A;  3MUK A;  5DFD A;  4TZ8 A;  4Q0N A;  5H9M A;  4YK0 A;  3SVG A;  1WEN A;  4GB0 A;  4N3W A;  3FKM X;  5FE9 A;  4UIZ A;  5EWC A;  2RNW A;  3M99 A;  2Y1N A;  5DW2 A;  5LUU A;  5EM3 A;  5E9I A;  1WEE A;  5FE6 A;  5BT5 A;  4NN2 A;  3MQM A;  4OGJ A;  3IHP A;  5FDZ A;  2G4A A;  4UYG A;  5AIT A;  2LRI C;  4X2I A;  4B86 C;  5C8G A;  1X4J A;  5IGN A;  2OO1 A;  3PUR A;  5H1V A;  5C85 A;  3SHB A;  5KU3 A;  3P5O A;  5H1T A;  5G0F A;  2Y1M A;  5B8D A;  4QZS A;  5CQ4 A;  4TTE A;  2DVQ A;  5F62 A;  2XEU A;  5FB1 A;  5BT3 A;  2WP2 A;  4NUE A;  2ECI A;  2YEL A;  2KU3 A;  4A0C D;  3ZPV E;  2L5U A;  4PCI A;  2YW5 A;  4HXS A;  5JI8 A;  3O7A A;  3G0L A;  5J3X A; 
#chains in the Genus database with same CATH topology
 2YSM A;  5DY7 A;  5EA1 A;  5FB0 A;  5L99 A;  4GPJ A;  3TLP A;  3UVD A;  4O7E A;  4UIU A;  1WEV A;  4C9Z A;  3JVJ A;  5EPR A;  3QZS A;  5FFY A;  3NXB A;  2OXQ C;  4O7B A;  4LYW A;  4O71 A;  5A82 A;  5LVR A;  4O70 A;  5C13 A;  4A9E A;  5L8T A;  5HQ6 A;  3C6W A;  4QF2 A;  3I2D A;  4AYC A;  3M63 A;  5I3L A;  5SVY A;  1MBM A;  4HXK A;  2LSP B;  5ETD A;  3RPG B;  4S3O C;  3N9Q A;  5ENF A;  4ZUX U;  5D0C A;  2VNF A;  4A9L A;  4YYI A;  3LJW A;  1WIL A;  2G45 A;  2R10 A;  4TT4 A;  5CQ7 A;  1ZBD B;  2CT2 A;  2XP0 A;  4F1P A;  3MXF A;  4YBM A;  3D1D A;  3P1E A;  5CQ8 A;  2DAT A;  2YUC A;  5FE4 A;  5TB6 A;  5IG6 A;  4IC3 A;  4N4I A;  4HBX A;  4A9O A;  2ZET C;  3KNV A;  5COI A;  4J3I A;  5JG6 A;  4WIV A;  4MR6 A;  5IID A;  5DKD A;  2DVV A;  5LVQ A;  2RR4 A;  5H1U A;  2G43 A;  5CQ3 A;  4HXR A;  3MHS A;  2D8S A;  3ZTG A;  4YYD A;  5F5Z A;  4QYD A;  2ECN A;  2EGP A;  4LRG A;  3VKH A;  5FE3 A;  4LC2 A;  4QR5 A;  5F2P A;  4YYM A;  4IOO A;  3G0J A;  4MR3 A;  5HJC A;  4QEU A;  3DWD A;  4BW4 A;  2CKL B;  2L80 A;  5HQ7 A;  3PLW A;  4FIP A;  5EI4 A;  3ZVZ B;  5I29 A;  3N9L A;  4MVT A;  1G25 A;  4BBQ A;  5TAB A;  4XYA A;  4KV1 A;  3O34 A;  4A9J A;  5A5O A;  4CUR A;  5HM0 A;  4AI6 A;  2B0O E;  5CRZ A;  4R8P K;  5LJ2 A;  4HXL A;  4CFL A;  4CA1 A;  2L84 A;  2YRE A;  4IR5 A;  5LKT A;  4AKI A;  5KH9 A;  4Z6I A;  4UIV A;  5G04 B;  4O7C A;  5DYX A;  5TDW A;  4QSX A;  1WE9 A;  5LKX A;  5DYA A;  2MKE A;  2FUI A;  2KKX A;  1WEP A;  4MEN A;  4BJX A;  2LGV A;  5HRV A;  5I7X A;  2LXP C;  3JVL A;  2R0S A;  2EJN A;  2QJ0 A;  2KTB B;  5D3J A;  2QIZ A;  5E3G A;  2YDW A;  5HEN A;  2HDP A;  2YU4 A;  2DKW A;  3M62 A;  4MR5 A;  5CY9 A;  2AN6 A;  5D7X A;  4NRC A;  2KRE A;  2E61 A;  2VJE B;  3ZYQ A;  3O47 A;  4FLP A;  5ENG A;  5EVA A;  5FG6 A;  3JVK A;  2N9G A;  4QSP A;  4A9I A;  5TBN A;  3UV5 A;  3O70 A;  4TZ2 A;  2JMI A;  2ECW A;  4Z6H A;  5FH7 A;  2MIQ A;  2PNX A;  3JVM A;  4NUC A;  4YAT A;  5E7D A;  1RMD A;  5F61 A;  2MA6 A;  2JRJ A;  2XB1 A;  4J0R A;  5SVX A;  4TS8 A;  4HBY A;  2R0Y A;  5HCL A;  5L8U A;  1T1H A;  1Z60 A;  2K16 A;  3SVF A;  4FJC A;  4I7D A;  1JM7 A;  5D3L A;  3ZNI A;  4OUF A;  4ZW1 A;  5I7Y A;  1JSP B;  5HLS A;  2LXH C;  3SOU A;  2VJE A;  2HYE D;  2ECT A;  2RO1 A;  3LQJ A;  2CSZ A;  4TT6 A;  3O36 A;  2OSS A;  3LDY A;  4PTB A;  5E9V A;  3U5N A;  2KFT A;  3FM8 C;  4FK5 A;  2L43 A;  4ALH A;  5HRX A;  5TCM A;  3NG2 A;  5DYU A;  4IC2 A;  5FE8 A;  5DLZ A;  5AME A;  4ZC9 A;  2XOZ A;  3V43 A;  5CFW A;  2I50 A;  4J1P A;  4KV4 A;  5HQ5 A;  4NS5 A;  3HMH A;  4LJN A;  5CUE A;  5F1L A;  4V3L C;  1V87 A;  2DVS A;  2RNY A;  3DQV R;  4O76 A;  5CTL A;  5FE5 A;  4A9K A;  5AMF A;  5FER A;  4Z93 A;  4KCX A;  4QC3 A;  4UP0 A;  4N4F A;  4W4U A;  3RCW A;  1N87 A;  5DX4 A;  3P1C A;  4LZS A;  1WEO A;  2E6S A;  2LDR A;  4O64 A;  1WIM A;  2YHN A;  5A81 A;  3JUE A;  1X0J A;  4NYW A;  4CUS A;  4Z0R A;  2L5E A;  5EU1 A;  4O77 A;  4Q0O A;  4S3O B;  5D1L B;  5EWW A;  5E9Y A;  4QSV A;  3AAD A;  4O74 A;  3UW9 A;  3IU5 A;  2KWJ A;  4A9F A;  5I89 A;  4QNS A;  5C89 A;  2MA5 A;  5LCW B;  5D26 A;  4WZ0 A;  2F42 A;  2RFJ A;  5KTU A;  5IGM A;  2EXU A;  4CFK A;  2BAY A;  5HFQ A;  2VP7 A;  5CUC A;  4TYL A;  2M13 A;  1K2F A;  4CLB A;  1MM3 A;  3FAN A;  4GNF A;  4ZDT A;  2PUY A;  2ECG A;  2L85 A;  4F3I A;  5EPB A;  5C4Q A;  4A4C A;  2MUM A;  2LQ6 A;  5DBM A;  3UV2 A;  2DVR A;  3UV4 A;  5SVI B;  2E6R A;  3KV6 A;  4I7B A;  4IOQ A;  5I40 A;  5A5Q A;  1WUM A;  2JUN A;  2MD8 C;  2H0D A;  5ACY A;  1DVP A;  5DLX A;  5DKA A;  5E9M A;  2LGG A;  2DWW A;  3FJU B;  4OGI A;  4LLB A;  5B77 A;  2JMJ A;  4C67 A;  4WA6 A;  5EIC A;  4H9D A;  1WEQ A;  5D1K B;  3HME A;  3U5L A;  3U5K A;  3UVX A;  3RPG C;  1EQF A;  4WHW A;  5FE2 A;  4PS5 A;  5CU8 A;  4NRB A;  4QST A;  4WZ3 B;  5AD2 A;  5DW1 A;  5ENB A;  5B79 A;  4O75 A;  3LJU X;  5EIS A;  2MNY A;  1ZS5 A;  4YYK A;  4CCG X;  4MEQ A;  4QSU A;  5FG4 A;  4TKP B;  2K4D A;  2LN0 A;  2OUO A;  4UYF B;  4QUU A;  4LYS A;  4XUA A;  5CPE A;  2CSV A;  3Q2E A;  3SOX A;  2VPG A;  4XY9 A;  2DJA A;  2GRC A;  2YEM A;  4HBV A;  3D7C A;  2L75 A;  4LK9 A;  3ONI A;  4Q6F A;  2R0V A;  5HFR A;  1LDK C;  4YBS A;  2CRR A;  5CQA A;  3PUQ A;  5EWH A;  3N9M A;  5CQ5 A;  5J0D A;  2E7N A;  2XOC A;  4XUB A;  5IGK A;  4L7X A;  4HXO A;  5I88 A;  5D3T A;  4O78 A;  5FFV A;  2G6Q A;  2YQL A;  3GV4 A;  4UIW A;  5FH8 A;  1N72 A;  4QSR A;  5A83 A;  4CUQ A;  3P1D A;  3D1B A;  4A9N A;  3HCU A;  3LVQ E;  4Z0O A;  2MNZ A;  2FFW A;  5FH6 A;  5TDR A;  1MM2 A;  5DKH A;  4NXJ A;  4TU6 A;  2D9E A;  4QR4 A;  2EA6 A;  3FL2 A;  5LKZ A;  4QBM A;  4GNE A;  4OGE A;  4PY6 A;  5DFB A;  5DKC A;  1FBV A;  2KYU A;  4QSS A;  4MEO A;  5KTX A;  4E96 A;  4AVX A;  2KWO A;  1XWH A;  4V3K C;  2YQM A;  2FUU A;  4J0S A;  1WEM A;  3O35 A;  4PCE A;  2C2V S;  2RS9 B;  2CKL A;  3EB5 A;  2JMD A;  3QZT A;  4Y03 A;  2IDA A;  2K1J A;  5B75 A;  4NR4 A;  3L1Z B;  5B78 A;  1LDJ B;  4IR4 A;  3UVW A;  5I83 A;  5LKU A;  4PKL A;  4UYF A;  3N9O A;  1WGM A;  4LZR A;  4YC9 A;  5B76 A;  3SUB A;  4TT2 A;  1CHC A;  3IU6 A;  2M3H A;  4CUP A;  2Y43 A;  5II1 A;  4UP5 A;  3U5P A;  5EP7 A;  3VKG A;  5EYA F;  5G4R A;  5A85 A;  3E2D A;  4PPE A;  1E6I A;  4HXN A;  1BOR A;  4NR5 A;  3ZYU A;  1WFK A;  3DDT A;  3T9K A;  4TQN A;  5E73 A;  5D3S A;  4UYD A;  5LJ0 A;  1E4U A;  5D3P A;  5A5S A;  1VYX A;  4N4H A;  4NYX A;  5C7N A;  1X4I A;  2LGL A;  3N9P A;  4XI1 A;  4AUQ B;  5C11 A;  4YAD A;  3C5K A;  5E0R A;  3ERR A;  4UYE A;  4QSQ A;  5HEM A;  3LVR E;  4GND A;  5L97 A;  4HXP A;  2IQJ A;  5E3D A;  5EWV A;  1X4U A;  5IGL A;  5CUD A;  4AYC B;  3U5M A;  2CRW A;  5CZG A;  2VPD A;  3O37 A;  4YH4 A;  4NQM A;  3SVH A;  4QQ4 A;  5L96 A;  3DAI A;  1ZKR A;  4IOR A;  3K2J A;  3L1X A;  2C2L A;  2KWN A;  4R7E A;  1WEU A;  4NR7 A;  5CUB A;  3U5O A;  5FE7 A;  3GL6 A;  2E3K A;  5CP5 A;  4LKA A;  1F62 A;  2KGG A;  5D3N A;  1VFY A;  5EGU A;  4YAB A;  4CUU A;  4AKG A;  2F6N A;  5IBN A;  2DX8 A;  3DWY A;  4IR6 A;  5F36 A;  4YY4 A;  2KR4 A;  3Q1D A;  4YBT A;  4MR4 A;  1JM4 B;  2LGK A;  5ETB A;  4L58 A;  4CUT A;  3UVY A;  2MD7 B;  4AKN A;  2NAA A;  4UIX A;  5CQT A;  3S92 A;  4BW2 A;  5CGP A;  1DCQ A;  4RVR A;  4Z1Q A;  4YAX A;  5ENH A;  5H85 A;  4CL9 A;  5CS8 A;  5CQ6 A;  4AKH A;  1IYM A;  2VPE A;  2KE1 A;  5C87 A;  2YYN A;  2MT5 A;  5DIN A;  2EGM A;  3O33 A;  5F1H A;  5F60 A;  4MSX A;  3FEH A;  3QZV A;  4HXM A;  5KH7 A;  3LXJ A;  1FP0 A;  5SVI A;  3H7H A;  4NR8 A;  5ENI A;  2ECJ A;  4UYH A;  3GG3 A;  3FAO A;  4WHU A;  3M7K A;  4XY8 A;  3S91 A;  2XOY A;  3ZVY A;  3HCS A;  2K17 A;  4BW1 A;  3P1F A;  5A7C A;  2CSY A;  5FEY A;  3ZPV 1;  2VPB A;  2YT5 A;  3ASL A;  4F52 B;  5AIU A;  5KH3 A;  5G05 B;  4NYV A;  5E9L A;  2JM3 A;  5FE1 A;  4YYG A;  2KWK A;  2FSA A;  5F25 A;  4YYH A;  1VD4 A;  3MDB C;  4QR3 A;  3LQH A;  4UIT A;  4NQN A;  5D25 A;  2H60 A;  4A9M A;  2CON A;  4NRA A;  1PUO A;  3U5J A;  5AD3 A;  3VK6 A;  5HEL A;  2M85 A;  5DFC A;  4UI9 B;  4N4G A;  2NXB A;  5A5P A;  4O7F A;  2KIZ A;  4LZ2 A;  5CUA A;  2VJF A;  4O62 A;  4BW3 A;  1HYI A;  5II2 A;  4A9H A;  2LAU A;  2L0B A;  3LRQ A;  4YYN A;  2FD4 A;  3DPL R;  1Z2Q A;  2WP1 A;  4O7A A;  3AQA A;  5D24 A;  1WEW A;  3HCT A;  4QEW A;  4P5O B;  1JM7 B;  4GNG A;  4ALG A;  2M6M A;  1Z6U A;  2OWA A;  4I7C A;  5JWM A;  5EQ1 A;  2YVR A;  5DYC A;  5ENC A;  2KGI A;  2YYR A;  5EV9 A;  3KDE C;  5A5R A;  4DON A;  5I86 A;  2E7O A;  4LR6 A;  4QUT A;  2VJF B;  5A5N A;  4QF3 A;  4YYJ A;  2MJV B;  5FBX A;  4BHW A;  4TU4 A;  3MB4 A;  5K29 A;  4QYL A;  4Z1S A;  2D8U A;  4IR3 A;  3MUL A;  3HMF A;  5KO4 A;  3LQI A;  4QEV A;  5CUG A;  5HRW A;  5TRB A;  2P57 A;  2QIC A;  3RTR B;  5FG5 A;  5LJ1 A;  4FO9 A;  1WUG A;  2ECV A;  2YSJ A;  4A4B A;  2F6J A;  4AP4 A;  4UIY A;  4C66 A;  3KV5 A;  2DSM A;  3T7L A;  1HYJ A;  5E74 A;  5E9K A;  5ENJ A;  2YHO A;  3KQI A;  4R2Y A;  2L7P A;  4NR6 A;  3T6R A;  4QY4 A;  3MHH A;  2YUR A;  4QC1 A;  4YH3 A;  5K3Q A;  5I80 A;  2M1R A;  5EWD A;  1U6G B;  4MEP A;  5FE0 A;  2I8N A;  1WES A;  3I3J A;  2YW8 A;  4O72 A;  1F68 A;  4NUD A;  5ENE A;  2H0D B;  4LAD B;  4YY6 A;  4LYI A;  5I1Q A;  2RI7 A;  3MB3 A;  3EB6 A;  3HTK C;  5EPS A;  5F3A A;  4OGC A;  2YEK A;  4QSW A;  5CRM A;  3L11 A;  2RNX A;  5G4S A;  5KTW A;  4WZ2 A;  1JOC A;  5D3R A;  4QB3 A;  4ZQL A;  3SOW A;  4NR9 A;  2EOD A;  2D82 A;  4LDF A;  3PHD A;  2YQD A;  2RSD A;  4X3G A;  4A49 A;  5D3H A;  4B7Y C;  5KHM A;  2LV9 A;  5FFW A;  5EK9 A;  3N9N A;  4HBW A;  3Q2F A;  5F63 A;  2UZG A;  5D1M B;  5L98 A;  5BT4 A;  2I7K A;  3MUK A;  2KKY A;  5DFD A;  4TZ8 A;  4Q0N A;  5H9M A;  4YK0 A;  3SVG A;  1WEN A;  4GB0 A;  4N3W A;  3FKM X;  5FE9 A;  4UIZ A;  5EWC A;  2RNW A;  3M99 A;  2Y1N A;  5DW2 A;  5LUU A;  5EM3 A;  5E9I A;  1WEE A;  5FE6 A;  5BT5 A;  4NN2 A;  3MQM A;  4OGJ A;  3IHP A;  5FDZ A;  2G4A A;  4UYG A;  5AIT A;  2LRI C;  4X2I A;  4B86 C;  5C8G A;  1X4J A;  5IGN A;  2OO1 A;  3PUR A;  5H1V A;  5C85 A;  3SHB A;  5KU3 A;  3P5O A;  5H1T A;  5G0F A;  2Y1M A;  5B8D A;  4QZS A;  5CQ4 A;  4TTE A;  2DVQ A;  5F62 A;  2XEU A;  5FB1 A;  5BT3 A;  2WP2 A;  4NUE A;  2ECI A;  2YEL A;  2KU3 A;  4A0C D;  3ZPV E;  2L5U A;  4PCI A;  2YW5 A;  4HXS A;  5JI8 A;  3O7A A;  3G0L A;  5J3X A; 
#chains in the Genus database with same CATH homology
 2YSM A;  5DY7 A;  5EA1 A;  5FB0 A;  5L99 A;  4GPJ A;  3TLP A;  3UVD A;  4O7E A;  4UIU A;  1WEV A;  4C9Z A;  3JVJ A;  5EPR A;  3QZS A;  5FFY A;  3NXB A;  2OXQ C;  4O7B A;  4LYW A;  4O71 A;  5A82 A;  5LVR A;  4O70 A;  5C13 A;  4A9E A;  5L8T A;  5HQ6 A;  3C6W A;  4QF2 A;  3I2D A;  4AYC A;  3M63 A;  5I3L A;  4HXK A;  2LSP B;  5ETD A;  3RPG B;  4S3O C;  3N9Q A;  5ENF A;  4ZUX U;  5D0C A;  2VNF A;  4A9L A;  4YYI A;  3LJW A;  1WIL A;  2G45 A;  2R10 A;  4TT4 A;  5CQ7 A;  1ZBD B;  2CT2 A;  3MXF A;  4YBM A;  5CQ8 A;  3P1E A;  2DAT A;  2YUC A;  5FE4 A;  5TB6 A;  5IG6 A;  4IC3 A;  4N4I A;  4HBX A;  4A9O A;  2ZET C;  3KNV A;  5COI A;  4J3I A;  5JG6 A;  4WIV A;  4MR6 A;  5IID A;  5DKD A;  2DVV A;  5LVQ A;  5H1U A;  2G43 A;  5CQ3 A;  4HXR A;  3MHS A;  2D8S A;  3ZTG A;  4YYD A;  5F5Z A;  4QYD A;  2ECN A;  2EGP A;  4LRG A;  5FE3 A;  4LC2 A;  4QR5 A;  5F2P A;  4YYM A;  4IOO A;  3G0J A;  4MR3 A;  5HJC A;  4QEU A;  4BW4 A;  2CKL B;  2L80 A;  5HQ7 A;  4FIP A;  5EI4 A;  3ZVZ B;  5I29 A;  3N9L A;  4MVT A;  1G25 A;  4BBQ A;  5TAB A;  4XYA A;  4KV1 A;  3O34 A;  4A9J A;  5A5O A;  4CUR A;  5HM0 A;  5CRZ A;  4R8P K;  5LJ2 A;  4HXL A;  4CFL A;  4CA1 A;  2L84 A;  2YRE A;  4IR5 A;  5LKT A;  5KH9 A;  4Z6I A;  4UIV A;  5G04 B;  4O7C A;  5DYX A;  5TDW A;  4QSX A;  1WE9 A;  5LKX A;  5DYA A;  2FUI A;  1WEP A;  4MEN A;  4BJX A;  2LGV A;  5HRV A;  5I7X A;  2LXP C;  3JVL A;  2R0S A;  2QJ0 A;  2KTB B;  5D3J A;  2QIZ A;  5E3G A;  2YDW A;  5HEN A;  2HDP A;  2YU4 A;  2DKW A;  3M62 A;  4MR5 A;  5CY9 A;  2AN6 A;  5D7X A;  4NRC A;  2KRE A;  2VJE B;  3ZYQ A;  4FLP A;  5ENG A;  5EVA A;  5FG6 A;  3JVK A;  2N9G A;  4QSP A;  4A9I A;  5TBN A;  3UV5 A;  3O70 A;  4TZ2 A;  2JMI A;  2ECW A;  4Z6H A;  5FH7 A;  2MIQ A;  2PNX A;  3JVM A;  4NUC A;  4YAT A;  5E7D A;  1RMD A;  5F61 A;  2MA6 A;  2JRJ A;  2XB1 A;  4J0R A;  4TS8 A;  4HBY A;  2R0Y A;  5HCL A;  5L8U A;  1T1H A;  1Z60 A;  2K16 A;  3SVF A;  4FJC A;  4I7D A;  1JM7 A;  5D3L A;  3ZNI A;  4OUF A;  4ZW1 A;  5I7Y A;  1JSP B;  5HLS A;  2LXH C;  3SOU A;  2VJE A;  2HYE D;  2ECT A;  2RO1 A;  3LQJ A;  2CSZ A;  4TT6 A;  3O36 A;  2OSS A;  4PTB A;  5E9V A;  3U5N A;  2KFT A;  4FK5 A;  2L43 A;  4ALH A;  5HRX A;  5TCM A;  3NG2 A;  5DYU A;  4IC2 A;  5FE8 A;  5DLZ A;  5AME A;  4ZC9 A;  3V43 A;  5CFW A;  2I50 A;  4J1P A;  4KV4 A;  5HQ5 A;  4NS5 A;  3HMH A;  4LJN A;  5CUE A;  5F1L A;  4V3L C;  1V87 A;  2DVS A;  2RNY A;  3DQV R;  4O76 A;  5CTL A;  5FE5 A;  4A9K A;  5AMF A;  5FER A;  4Z93 A;  4KCX A;  4QC3 A;  4UP0 A;  4N4F A;  4W4U A;  3RCW A;  1N87 A;  5DX4 A;  3P1C A;  4LZS A;  1WEO A;  2E6S A;  2LDR A;  4O64 A;  1WIM A;  2YHN A;  5A81 A;  1X0J A;  4NYW A;  4CUS A;  2L5E A;  5EU1 A;  4O77 A;  4Q0O A;  4S3O B;  5D1L B;  5EWW A;  5E9Y A;  4QSV A;  3AAD A;  4O74 A;  3UW9 A;  3IU5 A;  2KWJ A;  4A9F A;  5I89 A;  4QNS A;  5C89 A;  2MA5 A;  5LCW B;  5D26 A;  4WZ0 A;  2F42 A;  2RFJ A;  5KTU A;  5IGM A;  4CFK A;  2BAY A;  5HFQ A;  2VP7 A;  5CUC A;  4TYL A;  1K2F A;  4CLB A;  1MM3 A;  4GNF A;  4ZDT A;  2PUY A;  2ECG A;  2L85 A;  4F3I A;  5EPB A;  5C4Q A;  4A4C A;  2MUM A;  2LQ6 A;  5DBM A;  3UV2 A;  2DVR A;  3UV4 A;  2E6R A;  3KV6 A;  4I7B A;  4IOQ A;  5I40 A;  5A5Q A;  1WUM A;  2MD8 C;  2H0D A;  5ACY A;  1DVP A;  5DLX A;  5DKA A;  5E9M A;  2LGG A;  2DWW A;  4LLB A;  4OGI A;  5B77 A;  2JMJ A;  4C67 A;  4WA6 A;  5EIC A;  1WEQ A;  5D1K B;  3HME A;  3U5L A;  3U5K A;  3UVX A;  3RPG C;  1EQF A;  4WHW A;  5FE2 A;  4PS5 A;  5CU8 A;  4NRB A;  4QST A;  4WZ3 B;  5AD2 A;  5DW1 A;  5ENB A;  5B79 A;  4O75 A;  5EIS A;  2MNY A;  1ZS5 A;  4YYK A;  4CCG X;  4MEQ A;  4QSU A;  5FG4 A;  4TKP B;  2K4D A;  2LN0 A;  2OUO A;  4UYF B;  4QUU A;  4LYS A;  4XUA A;  5CPE A;  3Q2E A;  3SOX A;  2VPG A;  4XY9 A;  2GRC A;  2YEM A;  4HBV A;  3D7C A;  2L75 A;  4LK9 A;  3ONI A;  4Q6F A;  2R0V A;  5HFR A;  1LDK C;  4YBS A;  5CQA A;  3PUQ A;  5EWH A;  3N9M A;  5CQ5 A;  5J0D A;  2E7N A;  4XUB A;  5IGK A;  4L7X A;  4HXO A;  5I88 A;  5D3T A;  4O78 A;  5FFV A;  2G6Q A;  2YQL A;  3GV4 A;  4UIW A;  5FH8 A;  1N72 A;  4QSR A;  5A83 A;  4CUQ A;  3P1D A;  4A9N A;  3HCU A;  2MNZ A;  5FH6 A;  5TDR A;  1MM2 A;  5DKH A;  4NXJ A;  4TU6 A;  2D9E A;  4QR4 A;  2EA6 A;  3FL2 A;  5LKZ A;  4QBM A;  4GNE A;  4PY6 A;  5DFB A;  5DKC A;  1FBV A;  2KYU A;  4QSS A;  4MEO A;  5KTX A;  4E96 A;  4AVX A;  2KWO A;  1XWH A;  4V3K C;  2YQM A;  2FUU A;  4J0S A;  1WEM A;  3O35 A;  4PCE A;  2C2V S;  2RS9 B;  2CKL A;  3EB5 A;  2JMD A;  3QZT A;  4Y03 A;  2IDA A;  2K1J A;  5B75 A;  4NR4 A;  3L1Z B;  5B78 A;  1LDJ B;  4IR4 A;  3UVW A;  5I83 A;  5LKU A;  4PKL A;  4UYF A;  3N9O A;  1WGM A;  4LZR A;  4YC9 A;  5B76 A;  4TT2 A;  1CHC A;  3IU6 A;  2M3H A;  4CUP A;  2Y43 A;  5II1 A;  4UP5 A;  3U5P A;  5EP7 A;  5EYA F;  5G4R A;  5A85 A;  4PPE A;  1E6I A;  4HXN A;  1BOR A;  4NR5 A;  3ZYU A;  1WFK A;  4TQN A;  5E73 A;  5D3S A;  4UYD A;  5LJ0 A;  1E4U A;  5D3P A;  5A5S A;  1VYX A;  4N4H A;  4NYX A;  5C7N A;  1X4I A;  2LGL A;  3N9P A;  4XI1 A;  4AUQ B;  5C11 A;  4YAD A;  3C5K A;  5E0R A;  4UYE A;  4QSQ A;  5HEM A;  4GND A;  5L97 A;  4HXP A;  5E3D A;  5EWV A;  1X4U A;  5IGL A;  5CUD A;  4AYC B;  3U5M A;  5CZG A;  2VPD A;  3O37 A;  4YH4 A;  4NQM A;  3SVH A;  5L96 A;  3DAI A;  4IOR A;  3K2J A;  3L1X A;  2C2L A;  2KWN A;  4R7E A;  1WEU A;  4NR7 A;  5CUB A;  3U5O A;  5FE7 A;  3GL6 A;  2E3K A;  5CP5 A;  4LKA A;  1F62 A;  2KGG A;  5D3N A;  1VFY A;  5EGU A;  4YAB A;  4CUU A;  2F6N A;  5IBN A;  2DX8 A;  3DWY A;  4IR6 A;  5F36 A;  4YY4 A;  2KR4 A;  4YBT A;  4MR4 A;  1JM4 B;  2LGK A;  5ETB A;  4L58 A;  4CUT A;  3UVY A;  2MD7 B;  4AKN A;  2NAA A;  4UIX A;  5CQT A;  3S92 A;  4BW2 A;  5CGP A;  4RVR A;  4Z1Q A;  4YAX A;  5ENH A;  5H85 A;  4CL9 A;  5CS8 A;  5CQ6 A;  1IYM A;  2VPE A;  2KE1 A;  5C87 A;  2YYN A;  2MT5 A;  5DIN A;  3O33 A;  5F1H A;  5F60 A;  4MSX A;  3QZV A;  4HXM A;  5KH7 A;  3LXJ A;  1FP0 A;  4NR8 A;  5ENI A;  2ECJ A;  4UYH A;  3GG3 A;  4WHU A;  4XY8 A;  3S91 A;  3ZVY A;  3HCS A;  2K17 A;  4BW1 A;  3P1F A;  5A7C A;  2CSY A;  5FEY A;  3ZPV 1;  2VPB A;  2YT5 A;  3ASL A;  4F52 B;  5AIU A;  5KH3 A;  5G05 B;  4NYV A;  5E9L A;  5FE1 A;  4YYG A;  2KWK A;  2FSA A;  5F25 A;  4YYH A;  1VD4 A;  4QR3 A;  3LQH A;  4UIT A;  4NQN A;  5D25 A;  2H60 A;  4A9M A;  4NRA A;  3U5J A;  5AD3 A;  3VK6 A;  5HEL A;  2M85 A;  5DFC A;  4UI9 B;  4N4G A;  2NXB A;  5A5P A;  4O7F A;  2KIZ A;  4LZ2 A;  5CUA A;  2VJF A;  4BW3 A;  1HYI A;  5II2 A;  4A9H A;  3LRQ A;  2L0B A;  4YYN A;  3DPL R;  1Z2Q A;  2WP1 A;  4O7A A;  3AQA A;  5D24 A;  1WEW A;  3HCT A;  4QEW A;  4P5O B;  1JM7 B;  4GNG A;  4ALG A;  2M6M A;  1Z6U A;  4I7C A;  5JWM A;  5EQ1 A;  5DYC A;  5ENC A;  2KGI A;  2YYR A;  5EV9 A;  5A5R A;  4DON A;  5I86 A;  2E7O A;  4LR6 A;  4QUT A;  2VJF B;  5A5N A;  4QF3 A;  4YYJ A;  2MJV B;  5FBX A;  4BHW A;  4TU4 A;  3MB4 A;  5K29 A;  4QYL A;  4Z1S A;  4IR3 A;  3MUL A;  3HMF A;  5KO4 A;  3LQI A;  4QEV A;  5CUG A;  5HRW A;  5TRB A;  3RTR B;  2QIC A;  5FG5 A;  5LJ1 A;  4FO9 A;  1WUG A;  2ECV A;  2YSJ A;  4A4B A;  2F6J A;  4AP4 A;  4UIY A;  4C66 A;  3KV5 A;  3T7L A;  1HYJ A;  5E74 A;  5E9K A;  5ENJ A;  2YHO A;  3KQI A;  4R2Y A;  4NR6 A;  3T6R A;  4QY4 A;  3MHH A;  2YUR A;  4QC1 A;  4YH3 A;  5I80 A;  2M1R A;  5EWD A;  1U6G B;  4MEP A;  5FE0 A;  2I8N A;  1WES A;  3I3J A;  2YW8 A;  4O72 A;  1F68 A;  4NUD A;  5ENE A;  2H0D B;  4LAD B;  4YY6 A;  4LYI A;  5I1Q A;  2RI7 A;  3MB3 A;  3EB6 A;  3HTK C;  5EPS A;  5F3A A;  2YEK A;  4QSW A;  5CRM A;  3L11 A;  2RNX A;  5G4S A;  5KTW A;  4WZ2 A;  1JOC A;  5D3R A;  4QB3 A;  4ZQL A;  3SOW A;  4NR9 A;  2EOD A;  2D82 A;  4LDF A;  3PHD A;  2YQD A;  2RSD A;  4X3G A;  4A49 A;  5D3H A;  4B7Y C;  5KHM A;  2LV9 A;  5FFW A;  5EK9 A;  3N9N A;  4HBW A;  3Q2F A;  5F63 A;  2UZG A;  5D1M B;  5L98 A;  5BT4 A;  2I7K A;  3MUK A;  5DFD A;  4TZ8 A;  4Q0N A;  5H9M A;  4YK0 A;  3SVG A;  1WEN A;  4GB0 A;  4N3W A;  3FKM X;  5FE9 A;  4UIZ A;  5EWC A;  2RNW A;  3M99 A;  2Y1N A;  5DW2 A;  5LUU A;  5EM3 A;  5E9I A;  1WEE A;  5FE6 A;  5BT5 A;  4NN2 A;  3MQM A;  4OGJ A;  3IHP A;  5FDZ A;  2G4A A;  4UYG A;  5AIT A;  2LRI C;  4X2I A;  4B86 C;  5C8G A;  1X4J A;  5IGN A;  2OO1 A;  3PUR A;  5H1V A;  5C85 A;  3SHB A;  5KU3 A;  3P5O A;  5H1T A;  5G0F A;  2Y1M A;  5B8D A;  4QZS A;  5CQ4 A;  4TTE A;  2DVQ A;  5F62 A;  2XEU A;  5FB1 A;  5BT3 A;  2WP2 A;  4NUE A;  2ECI A;  2YEL A;  2KU3 A;  4A0C D;  3ZPV E;  2L5U A;  4PCI A;  2YW5 A;  4HXS A;  5JI8 A;  3O7A A;  3G0L A;  5J3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...