2CSZA

Solution structure of the ring domain of the synaptotagmin-like protein 4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
76
structure length
76
Chain Sequence
GSSGSSGLLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-like protein 4
publication title Solution Structure of the RING domain of the Synaptotagmin-like protein 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 2
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cszA00
1WEPA 1ZBDB 3O33A 2BAYA 4YC9A 1WEOA 4R2YA 5FERA 1U6GB 4L58A 3ZVYA 4B7YC 4ZUXU 5LKUA 2L0BA 3GV4A 4L7XA 4WZ3B 2LN0A 3O37A 1Z2QA 4BHWA 2VNFA 3FL2A 3GL6A 5H1VA 4YBMA 2VPBA 1LDJB 2JRJA 4YATA 5JG6A 3U5MA 2VPGA 2EA6A 2KIZA 2K4DA 3LQIA 1F62A 3L1XA 4WA6A 2YQLA 2MD8C 2CKLA 2M85A 2PNXA 5FB1A 5D1MB 2G43A 2EGPA 2LV9A 2L5UA 3I2DA 2HYED 3ZPV1 4YBTA 5AITA 1WILA 5TABA 2HDPA 4MVTA 1WEWA 2YHNA 3NG2A 2ECJA 5TRBA 1WEQA 2G6QA 2ZETC 5LCWB 3N9PA 4FJCA 4WZ2A 4AUQB 2K16A 4IC3A 2QIZA 2E6SA 2ECVA 2KREA 5KH9A 2QJ0A 3RPGC 2KU3A 2ECIA 2L43A 2PUYA 4R7EA 5AIUA 5H1TA 1JM7A 2LQ6A 2VPEA 5C13A 3L11A 2JMDA 4N4FA 2I50A 2YSJA 1WIMA 1WEUA 2JMJA 4GNDA 5B78A 1FP0A 4I7BA 5FEYA 3O7AA 3HCSA 5TDRA 2KWJA 5H1UA 5G0FA 2FUUA 2JMIA 4YABA 3L1ZB 4V3KC 1LDKC 2VJEB 2XEUA 1V87A 4LADB 3T6RA 3MHSA 4TKPB 2Y1MA 2E6RA 4PPEA 4S3OB 2KWOA 5G05B 4F52B 3M99A 2VPDA 4R8PK 1VFYA 4GB0A 2YURA 2NAAA 2FSAA 3C6WA 3O36A 2MNYA 3MHHA 4C9ZA 4N3WA 1K2FA 1FBVA 2YHOA 4YAXA 2VJFB 2K17A 2YUCA 3N9LA 2KGGA 2F42A 5G04B 1WE9A 2LRIC 5B76A 5B77A 2M3HA 2H0DB 5B79A 5KH3A 1HYJA 3N9MA 3C5KA 2CSZA 1JOCA 5C11A 2MNZA 2ECTA 4XI1A 4AVXA 3EB5A 4CA1A 3KV5A 4UP0A 3LRQA 2C2VS 4CCGX 5LKZA 4V3LC 2YQMA 4UP5A 3M63A 3V43A 3HTKC 2YT5A 2K1JA 2LXHC 4AYCB 2YU4A 1Z60A 3ASLA 1RMDA 1VYXA 2AN6A 3IHPA 2LGGA 1WESA 3N9NA 2LGKA 5H9MA 2RSDA 3U5OA 3KQIA 4LK9A 2D8SA 3N9OA 4A4BA 1N87A 2Y1NA 3O70A 3HCTA 3KV6A 3QZVA 4UI9B 3PUQA 4I7DA 4LLBA 4Q6FA 4O64A 3PHDA 2MT5A 4ZQLA 4P5OB 1BORA 3ZVZB 2KR4A 5LKTA 3VK6A 5KH7A 4ZDTA 2KWNA 2M1RA 4GNFA 3SOWA 4W4UA 3O35A 1X4JA 3RPGB 4QF3A 5B8DA 3O34A 4YBSA 2VJEA 2KWKA 3EB6A 3T7LA 2ECNA 3ZPVE 1T1HA 1HYIA 5I3LA 1Z6UA 2CKLB 2VP7A 3HCUA 3LQJA 1E4UA 5J3XA 2MA6A 2L75A 4GNEA 1MM2A 3U5NA 3U5PA 5D1LB 5LKXA 2LGLA 2C2LA 3ZNIA 5FB0A 3DQVR 2MA5A 2UZGA 1MM3A 2F6NA 1VD4A 4MSXA 4BBQA 2VJFA 2Y43A 2LXPC 4A49A 4NN2A 2ECWA 2MUMA 4IC2A 1WEEA 1X4IA 4X3GA 2YSMA 2DX8A 2M6MA 2H0DA 5DINA 5DKAA 2KYUA 2MD7B 4GNGA 3SOUA 2CSYA 4FO9A 2FUIA 4S3OC 1JM7B 2XB1A 2CT2A 3PURA 4LKAA 4A4CA 4YADA 5TDWA 2KGIA 5TBNA 1WFKA 3SHBA 2F6JA 2KFTA 4FIPA 1WGMA 4QF2A 1WENA 5D1KB 4A0CD 1IYMA 3KNVA 1XWHA 4B86C 2LDRA 3DPLR 2YYRA 3LQHA 4AP4A 2OXQC 1WEVA 4PTBA 4AYCA 2EODA 2YW8A 2RI7A 4LJNA 3RTRB 3N9QA 3ZTGA 3M62A 4FK5A 1WEMA 3ZYQA 2L80A 2KE1A 5B75A 3SOXA 1X4UA 4I7CA 2YREA 2G45A 1CHCA 2LGVA 1G25A 2MIQA 2QICA 2IDAA 1DVPA 5EYAF 4WZ0A 2ECGA
chains in the Genus database with same CATH superfamily
1WEPA 1ZBDB 3O33A 2YVRA 2BAYA 4YC9A 1WEOA 4R2YA 5FERA 1U6GB 4L58A 3ZVYA 4B7YC 4ZUXU 3PLWA 5LKUA 2L0BA 3GV4A 4L7XA 4WZ3B 2KKYA 2LN0A 3O37A 5SVYA 1Z2QA 4BHWA 2VNFA 3FL2A 3SUBA 3GL6A 5H1VA 4YBMA 2VPBA 1LDJB 2JRJA 4YATA 5JG6A 3U5MA 3O47A 2VPGA 2EA6A 2KIZA 2K4DA 3LQIA 1F62A 3L1XA 4WA6A 2YQLA 2MD8C 2CKLA 2M85A 2PNXA 5FB1A 5D1MB 2G43A 2XOYA 2EGPA 2LV9A 2L5UA 3I2DA 2HYED 3ZPV1 4YBTA 5AITA 1WILA 5TABA 2E61A 2HDPA 4MVTA 1WEWA 2EGMA 2B0OE 2YHNA 3NG2A 2ECJA 5TRBA 1WEQA 2G6QA 2ZETC 2RR4A 3N9PA 4FJCA 5LCWB 4WZ2A 4AUQB 2K16A 4IC3A 2QIZA 2E6SA 2ECVA 2KREA 5KH9A 2QJ0A 3RPGC 2L7PA 2KU3A 2ECIA 2L43A 2CSVA 2PUYA 4R7EA 2XP0A 4OGCA 5AIUA 5H1TA 1JM7A 2LQ6A 2VPEA 5C13A 3L11A 2JMDA 4N4FA 2I50A 2YSJA 1WIMA 1WEUA 3H7HA 2JMJA 4GNDA 4OGEA 5B78A 1FP0A 4I7BA 5FEYA 3O7AA 3HCSA 5SVIB 5TDRA 2KWJA 5H1UA 5G0FA 2FUUA 1MBMA 2JMIA 2OWAA 4YABA 3LJUX 3L1ZB 4V3KC 3JUEA 1LDKC 2VJEB 2XEUA 1V87A 4LADB 3T6RA 3Q1DA 3MHSA 4TKPB 2JM3A 2Y1MA 2E6RA 4PPEA 4S3OB 2KWOA 5G05B 4F52B 3M99A 2VPDA 4R8PK 3DDTA 1VFYA 2JUNA 4GB0A 2YURA 2M13A 2NAAA 2FSAA 3C6WA 3O36A 2MNYA 3MHHA 4C9ZA 4N3WA 1K2FA 1FBVA 2YHOA 4YAXA 2VJFB 2K17A 2YUCA 3N9LA 2KGGA 2F42A 3FAOA 3LVRE 2LAUA 5G04B 2DSMA 1WE9A 2LRIC 5B76A 5B77A 2M3HA 2H0DB 5B79A 2CRRA 5KH3A 1HYJA 3N9MA 3C5KA 3E2DA 2CSZA 1JOCA 5C11A 2XOZA 2MNZA 2ECTA 4XI1A 4AVXA 4Z0RA 3FJUB 3EB5A 4CA1A 3KV5A 2FD4A 4UP0A 2EXUA 3M7KA 3LRQA 2C2VS 4CCGX 5LKZA 5K3QA 4V3LC 2YQMA 4UP5A 3M63A 3V43A 3HTKC 2YT5A 2K1JA 4O62A 2LXHC 4AYCB 3MDBC 2YU4A 1Z60A 3ASLA 1RMDA 1VYXA 2AN6A 3IHPA 3FEHA 2LGGA 1WESA 3N9NA 2LGKA 5H9MA 2RSDA 3U5OA 3KQIA 4LK9A 2FFWA 2D8SA 3N9OA 4A4BA 1N87A 2Y1NA 3O70A 3HCTA 3KV6A 3QZVA 4UI9B 5SVXA 3PUQA 4I7DA 4LLBA 4Q6FA 2CONA 4O64A 3PHDA 2MT5A 4ZQLA 4P5OB 1BORA 3ZVZB 2KR4A 5LKTA 3VK6A 5KH7A 4ZDTA 2KWNA 2M1RA 4GNFA 5SVIA 3SOWA 4W4UA 3O35A 1X4JA 3RPGB 4QF3A 5B8DA 3O34A 4YBSA 2VJEA 2KWKA 3EB6A 3LVQE 3T7LA 2ECNA 3ZPVE 1T1HA 3LDYA 1HYIA 5I3LA 1Z6UA 2CKLB 2VP7A 3HCUA 3LQJA 1E4UA 5J3XA 2MA6A 2L75A 4GNEA 3FM8C 1MM2A 2IQJA 3U5NA 2XOCA 3U5PA 5D1LB 5LKXA 2LGLA 2C2LA 3ZNIA 5FB0A 3DQVR 2MA5A 2UZGA 1MM3A 4Z0OA 2F6NA 1VD4A 4MSXA 4BBQA 2VJFA 2Y43A 2LXPC 4A49A 4NN2A 3KDEC 2ECWA 2MUMA 4IC2A 1WEEA 1X4IA 4X3GA 2YSMA 2DX8A 2P57A 3DWDA 2M6MA 2H0DA 5DINA 5DKAA 2KYUA 2MD7B 4GNGA 4H9DA 3SOUA 2CRWA 2CSYA 4FO9A 2FUIA 4S3OC 1JM7B 2XB1A 2CT2A 3PURA 4LKAA 2KKXA 4A4CA 2D8UA 4YADA 5TDWA 2KGIA 5TBNA 1WFKA 3SHBA 2F6JA 2MKEA 2KFTA 4FIPA 1DCQA 1WGMA 4QF2A 1WENA 5D1KB 4A0CD 1IYMA 4F1PA 3KNVA 1XWHA 3T9KA 2LDRA 3DPLR 4B86C 2YYRA 3LQHA 4AP4A 2OXQC 1WEVA 4PTBA 4AYCA 2EODA 2YW8A 2RI7A 4LJNA 3RTRB 3N9QA 3ZTGA 3M62A 4FK5A 1WEMA 3ZYQA 2L80A 2KE1A 5B75A 2DJAA 3SOXA 1X4UA 4I7CA 2YREA 2G45A 3FANA 1CHCA 2LGVA 1G25A 4QQ4A 2MIQA 2QICA 2IDAA 1DVPA 5EYAF 4WZ0A 2ECGA
chains in the Genus database with same CATH topology
1WEPA 1ZBDB 3O33A 2BAYA 4YC9A 1WEOA 4R2YA 5FERA 1U6GB 4L58A 3ZVYA 4B7YC 4ZUXU 5LKUA 2L0BA 3GV4A 4L7XA 4WZ3B 2LN0A 3O37A 1Z2QA 4BHWA 2VNFA 3FL2A 3GL6A 5H1VA 4YBMA 2VPBA 1LDJB 2JRJA 4YATA 5JG6A 3U5MA 2VPGA 2EA6A 2KIZA 2K4DA 3LQIA 1F62A 3L1XA 4WA6A 2YQLA 2MD8C 2CKLA 2M85A 2PNXA 5FB1A 5D1MB 2G43A 2EGPA 2LV9A 2L5UA 3I2DA 2HYED 3ZPV1 4YBTA 5AITA 1WILA 5TABA 2HDPA 4MVTA 1WEWA 2YHNA 3NG2A 2ECJA 5TRBA 1WEQA 2G6QA 2ZETC 5LCWB 3N9PA 4FJCA 4WZ2A 4AUQB 2K16A 4IC3A 2QIZA 2E6SA 2ECVA 2KREA 5KH9A 2QJ0A 3RPGC 2KU3A 2ECIA 2L43A 2PUYA 4R7EA 5AIUA 5H1TA 1JM7A 2LQ6A 2VPEA 5C13A 3L11A 2JMDA 4N4FA 2I50A 2YSJA 1WIMA 1WEUA 2JMJA 4GNDA 5B78A 1FP0A 4I7BA 5FEYA 3O7AA 3HCSA 5TDRA 2KWJA 5H1UA 5G0FA 2FUUA 2JMIA 4YABA 3L1ZB 4V3KC 1LDKC 2VJEB 2XEUA 1V87A 4LADB 3T6RA 3MHSA 4TKPB 2Y1MA 2E6RA 4PPEA 4S3OB 2KWOA 5G05B 4F52B 3M99A 2VPDA 4R8PK 1VFYA 4GB0A 2YURA 2NAAA 2FSAA 3C6WA 3O36A 2MNYA 3MHHA 4C9ZA 4N3WA 1K2FA 1FBVA 2YHOA 4YAXA 2VJFB 2K17A 2YUCA 3N9LA 2KGGA 2F42A 5G04B 1WE9A 2LRIC 5B76A 5B77A 2M3HA 2H0DB 5B79A 5KH3A 1HYJA 3N9MA 3C5KA 2CSZA 1JOCA 5C11A 2MNZA 2ECTA 4XI1A 4AVXA 3EB5A 4CA1A 3KV5A 4UP0A 3LRQA 2C2VS 4CCGX 5LKZA 4V3LC 2YQMA 4UP5A 3M63A 3V43A 3HTKC 2YT5A 2K1JA 2LXHC 4AYCB 2YU4A 1Z60A 3ASLA 1RMDA 1VYXA 2AN6A 3IHPA 2LGGA 1WESA 3N9NA 2LGKA 5H9MA 2RSDA 3U5OA 3KQIA 4LK9A 2D8SA 3N9OA 4A4BA 1N87A 2Y1NA 3O70A 3HCTA 3KV6A 3QZVA 4UI9B 3PUQA 4I7DA 4LLBA 4Q6FA 4O64A 3PHDA 2MT5A 4ZQLA 4P5OB 1BORA 3ZVZB 2KR4A 5LKTA 3VK6A 5KH7A 4ZDTA 2KWNA 2M1RA 4GNFA 3SOWA 4W4UA 3O35A 1X4JA 3RPGB 4QF3A 5B8DA 3O34A 4YBSA 2VJEA 2KWKA 3EB6A 3T7LA 2ECNA 3ZPVE 1T1HA 1HYIA 5I3LA 1Z6UA 2CKLB 2VP7A 3HCUA 3LQJA 1E4UA 5J3XA 2MA6A 2L75A 4GNEA 1MM2A 3U5NA 3U5PA 5D1LB 5LKXA 2LGLA 2C2LA 3ZNIA 5FB0A 3DQVR 2MA5A 2UZGA 1MM3A 2F6NA 1VD4A 4MSXA 4BBQA 2VJFA 2Y43A 2LXPC 4A49A 4NN2A 2ECWA 2MUMA 4IC2A 1WEEA 1X4IA 4X3GA 2YSMA 2DX8A 2M6MA 2H0DA 5DINA 5DKAA 2KYUA 2MD7B 4GNGA 3SOUA 2CSYA 4FO9A 2FUIA 4S3OC 1JM7B 2XB1A 2CT2A 3PURA 4LKAA 4A4CA 4YADA 5TDWA 2KGIA 5TBNA 1WFKA 3SHBA 2F6JA 2KFTA 4FIPA 1WGMA 4QF2A 1WENA 5D1KB 4A0CD 1IYMA 3KNVA 1XWHA 4B86C 2LDRA 3DPLR 2YYRA 3LQHA 4AP4A 2OXQC 1WEVA 4PTBA 4AYCA 2EODA 2YW8A 2RI7A 4LJNA 3RTRB 3N9QA 3ZTGA 3M62A 4FK5A 1WEMA 3ZYQA 2L80A 2KE1A 5B75A 3SOXA 1X4UA 4I7CA 2YREA 2G45A 1CHCA 2LGVA 1G25A 2MIQA 2QICA 2IDAA 1DVPA 5EYAF 4WZ0A 2ECGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEP A;  1ZBD B;  3O33 A;  2BAY A;  4YC9 A;  1WEO A;  4R2Y A;  5FER A;  1U6G B;  4L58 A;  3ZVY A;  4B7Y C;  4ZUX U;  5LKU A;  2L0B A;  3GV4 A;  4L7X A;  4WZ3 B;  2LN0 A;  3O37 A;  1Z2Q A;  4BHW A;  2VNF A;  3FL2 A;  3GL6 A;  5H1V A;  4YBM A;  2VPB A;  1LDJ B;  2JRJ A;  4YAT A;  5JG6 A;  3U5M A;  2VPG A;  2EA6 A;  2KIZ A;  2K4D A;  3LQI A;  1F62 A;  3L1X A;  4WA6 A;  2YQL A;  2MD8 C;  2CKL A;  2M85 A;  2PNX A;  5FB1 A;  5D1M B;  2G43 A;  2EGP A;  2LV9 A;  2L5U A;  3I2D A;  2HYE D;  3ZPV 1;  4YBT A;  5AIT A;  1WIL A;  5TAB A;  2HDP A;  4MVT A;  1WEW A;  2YHN A;  3NG2 A;  2ECJ A;  5TRB A;  1WEQ A;  2G6Q A;  2ZET C;  5LCW B;  3N9P A;  4FJC A;  4WZ2 A;  4AUQ B;  2K16 A;  4IC3 A;  2QIZ A;  2E6S A;  2ECV A;  2KRE A;  5KH9 A;  2QJ0 A;  3RPG C;  2KU3 A;  2ECI A;  2L43 A;  2PUY A;  4R7E A;  5AIU A;  5H1T A;  1JM7 A;  2LQ6 A;  2VPE A;  5C13 A;  3L11 A;  2JMD A;  4N4F A;  2I50 A;  2YSJ A;  1WIM A;  1WEU A;  2JMJ A;  4GND A;  5B78 A;  1FP0 A;  4I7B A;  5FEY A;  3O7A A;  3HCS A;  5TDR A;  2KWJ A;  5H1U A;  5G0F A;  2FUU A;  2JMI A;  4YAB A;  3L1Z B;  4V3K C;  1LDK C;  2VJE B;  2XEU A;  1V87 A;  4LAD B;  3T6R A;  3MHS A;  4TKP B;  2Y1M A;  2E6R A;  4PPE A;  4S3O B;  2KWO A;  5G05 B;  4F52 B;  3M99 A;  2VPD A;  4R8P K;  1VFY A;  4GB0 A;  2YUR A;  2NAA A;  2FSA A;  3C6W A;  3O36 A;  2MNY A;  3MHH A;  4C9Z A;  4N3W A;  1K2F A;  1FBV A;  2YHO A;  4YAX A;  2VJF B;  2K17 A;  2YUC A;  3N9L A;  2KGG A;  2F42 A;  5G04 B;  1WE9 A;  2LRI C;  5B76 A;  5B77 A;  2M3H A;  2H0D B;  5B79 A;  5KH3 A;  1HYJ A;  3N9M A;  3C5K A;  2CSZ A;  1JOC A;  5C11 A;  2MNZ A;  2ECT A;  4XI1 A;  4AVX A;  3EB5 A;  4CA1 A;  3KV5 A;  4UP0 A;  3LRQ A;  2C2V S;  4CCG X;  5LKZ A;  4V3L C;  2YQM A;  4UP5 A;  3M63 A;  3V43 A;  3HTK C;  2YT5 A;  2K1J A;  2LXH C;  4AYC B;  2YU4 A;  1Z60 A;  3ASL A;  1RMD A;  1VYX A;  2AN6 A;  3IHP A;  2LGG A;  1WES A;  3N9N A;  2LGK A;  5H9M A;  2RSD A;  3U5O A;  3KQI A;  4LK9 A;  2D8S A;  3N9O A;  4A4B A;  1N87 A;  2Y1N A;  3O70 A;  3HCT A;  3KV6 A;  3QZV A;  4UI9 B;  3PUQ A;  4I7D A;  4LLB A;  4Q6F A;  4O64 A;  3PHD A;  2MT5 A;  4ZQL A;  4P5O B;  1BOR A;  3ZVZ B;  2KR4 A;  5LKT A;  3VK6 A;  5KH7 A;  4ZDT A;  2KWN A;  2M1R A;  4GNF A;  3SOW A;  4W4U A;  3O35 A;  1X4J A;  3RPG B;  4QF3 A;  5B8D A;  3O34 A;  4YBS A;  2VJE A;  2KWK A;  3EB6 A;  3T7L A;  2ECN A;  3ZPV E;  1T1H A;  1HYI A;  5I3L A;  1Z6U A;  2CKL B;  2VP7 A;  3HCU A;  3LQJ A;  1E4U A;  5J3X A;  2MA6 A;  2L75 A;  4GNE A;  1MM2 A;  3U5N A;  3U5P A;  5D1L B;  5LKX A;  2LGL A;  2C2L A;  3ZNI A;  5FB0 A;  3DQV R;  2MA5 A;  2UZG A;  1MM3 A;  2F6N A;  1VD4 A;  4MSX A;  4BBQ A;  2VJF A;  2Y43 A;  2LXP C;  4A49 A;  4NN2 A;  2ECW A;  2MUM A;  4IC2 A;  1WEE A;  1X4I A;  4X3G A;  2YSM A;  2DX8 A;  2M6M A;  2H0D A;  5DIN A;  5DKA A;  2KYU A;  2MD7 B;  4GNG A;  3SOU A;  2CSY A;  4FO9 A;  2FUI A;  4S3O C;  1JM7 B;  2XB1 A;  2CT2 A;  3PUR A;  4LKA A;  4A4C A;  4YAD A;  5TDW A;  2KGI A;  5TBN A;  1WFK A;  3SHB A;  2F6J A;  2KFT A;  4FIP A;  1WGM A;  4QF2 A;  1WEN A;  5D1K B;  4A0C D;  1IYM A;  3KNV A;  1XWH A;  4B86 C;  2LDR A;  3DPL R;  2YYR A;  3LQH A;  4AP4 A;  2OXQ C;  1WEV A;  4PTB A;  4AYC A;  2EOD A;  2YW8 A;  2RI7 A;  4LJN A;  3RTR B;  3N9Q A;  3ZTG A;  3M62 A;  4FK5 A;  1WEM A;  3ZYQ A;  2L80 A;  2KE1 A;  5B75 A;  3SOX A;  1X4U A;  4I7C A;  2YRE A;  2G45 A;  1CHC A;  2LGV A;  1G25 A;  2MIQ A;  2QIC A;  2IDA A;  1DVP A;  5EYA F;  4WZ0 A;  2ECG A; 
#chains in the Genus database with same CATH topology
 1WEP A;  1ZBD B;  3O33 A;  2YVR A;  2BAY A;  4YC9 A;  1WEO A;  4R2Y A;  5FER A;  1U6G B;  4L58 A;  3ZVY A;  4B7Y C;  4ZUX U;  3PLW A;  5LKU A;  2L0B A;  3GV4 A;  4L7X A;  4WZ3 B;  2KKY A;  2LN0 A;  3O37 A;  5SVY A;  1Z2Q A;  4BHW A;  2VNF A;  3FL2 A;  3SUB A;  3GL6 A;  5H1V A;  4YBM A;  2VPB A;  1LDJ B;  2JRJ A;  4YAT A;  5JG6 A;  3U5M A;  3O47 A;  2VPG A;  2EA6 A;  2KIZ A;  2K4D A;  3LQI A;  1F62 A;  3L1X A;  4WA6 A;  2YQL A;  2MD8 C;  2CKL A;  2M85 A;  2PNX A;  5FB1 A;  5D1M B;  2G43 A;  2XOY A;  2EGP A;  2LV9 A;  2L5U A;  3I2D A;  2HYE D;  3ZPV 1;  4YBT A;  5AIT A;  1WIL A;  5TAB A;  2E61 A;  2HDP A;  4MVT A;  1WEW A;  2EGM A;  2B0O E;  2YHN A;  3NG2 A;  2ECJ A;  5TRB A;  1WEQ A;  2G6Q A;  2ZET C;  2RR4 A;  3N9P A;  4FJC A;  5LCW B;  4WZ2 A;  4AUQ B;  2K16 A;  4IC3 A;  2QIZ A;  2E6S A;  2ECV A;  2KRE A;  5KH9 A;  2QJ0 A;  3RPG C;  2L7P A;  2KU3 A;  2ECI A;  2L43 A;  2CSV A;  2PUY A;  4R7E A;  2XP0 A;  4OGC A;  5AIU A;  5H1T A;  1JM7 A;  2LQ6 A;  2VPE A;  5C13 A;  3L11 A;  2JMD A;  4N4F A;  2I50 A;  2YSJ A;  1WIM A;  1WEU A;  3H7H A;  2JMJ A;  4GND A;  4OGE A;  5B78 A;  1FP0 A;  4I7B A;  5FEY A;  3O7A A;  3HCS A;  5SVI B;  5TDR A;  2KWJ A;  5H1U A;  5G0F A;  2FUU A;  1MBM A;  2JMI A;  2OWA A;  4YAB A;  3LJU X;  3L1Z B;  4V3K C;  3JUE A;  1LDK C;  2VJE B;  2XEU A;  1V87 A;  4LAD B;  3T6R A;  3Q1D A;  3MHS A;  4TKP B;  2JM3 A;  2Y1M A;  2E6R A;  4PPE A;  4S3O B;  2KWO A;  5G05 B;  4F52 B;  3M99 A;  2VPD A;  4R8P K;  3DDT A;  1VFY A;  2JUN A;  4GB0 A;  2YUR A;  2M13 A;  2NAA A;  2FSA A;  3C6W A;  3O36 A;  2MNY A;  3MHH A;  4C9Z A;  4N3W A;  1K2F A;  1FBV A;  2YHO A;  4YAX A;  2VJF B;  2K17 A;  2YUC A;  3N9L A;  2KGG A;  2F42 A;  3FAO A;  3LVR E;  2LAU A;  5G04 B;  2DSM A;  1WE9 A;  2LRI C;  5B76 A;  5B77 A;  2M3H A;  2H0D B;  5B79 A;  2CRR A;  5KH3 A;  1HYJ A;  3N9M A;  3C5K A;  3E2D A;  2CSZ A;  1JOC A;  5C11 A;  2XOZ A;  2MNZ A;  2ECT A;  4XI1 A;  4AVX A;  4Z0R A;  3FJU B;  3EB5 A;  4CA1 A;  3KV5 A;  2FD4 A;  4UP0 A;  2EXU A;  3M7K A;  3LRQ A;  2C2V S;  4CCG X;  5LKZ A;  5K3Q A;  4V3L C;  2YQM A;  4UP5 A;  3M63 A;  3V43 A;  3HTK C;  2YT5 A;  2K1J A;  4O62 A;  2LXH C;  4AYC B;  3MDB C;  2YU4 A;  1Z60 A;  3ASL A;  1RMD A;  1VYX A;  2AN6 A;  3IHP A;  3FEH A;  2LGG A;  1WES A;  3N9N A;  2LGK A;  5H9M A;  2RSD A;  3U5O A;  3KQI A;  4LK9 A;  2FFW A;  2D8S A;  3N9O A;  4A4B A;  1N87 A;  2Y1N A;  3O70 A;  3HCT A;  3KV6 A;  3QZV A;  4UI9 B;  5SVX A;  3PUQ A;  4I7D A;  4LLB A;  4Q6F A;  2CON A;  4O64 A;  3PHD A;  2MT5 A;  4ZQL A;  4P5O B;  1BOR A;  3ZVZ B;  2KR4 A;  5LKT A;  3VK6 A;  5KH7 A;  4ZDT A;  2KWN A;  2M1R A;  4GNF A;  5SVI A;  3SOW A;  4W4U A;  3O35 A;  1X4J A;  3RPG B;  4QF3 A;  5B8D A;  3O34 A;  4YBS A;  2VJE A;  2KWK A;  3EB6 A;  3LVQ E;  3T7L A;  2ECN A;  3ZPV E;  1T1H A;  3LDY A;  1HYI A;  5I3L A;  1Z6U A;  2CKL B;  2VP7 A;  3HCU A;  3LQJ A;  1E4U A;  5J3X A;  2MA6 A;  2L75 A;  4GNE A;  3FM8 C;  1MM2 A;  2IQJ A;  3U5N A;  2XOC A;  3U5P A;  5D1L B;  5LKX A;  2LGL A;  2C2L A;  3ZNI A;  5FB0 A;  3DQV R;  2MA5 A;  2UZG A;  1MM3 A;  4Z0O A;  2F6N A;  1VD4 A;  4MSX A;  4BBQ A;  2VJF A;  2Y43 A;  2LXP C;  4A49 A;  4NN2 A;  3KDE C;  2ECW A;  2MUM A;  4IC2 A;  1WEE A;  1X4I A;  4X3G A;  2YSM A;  2DX8 A;  2P57 A;  3DWD A;  2M6M A;  2H0D A;  5DIN A;  5DKA A;  2KYU A;  2MD7 B;  4GNG A;  4H9D A;  3SOU A;  2CRW A;  2CSY A;  4FO9 A;  2FUI A;  4S3O C;  1JM7 B;  2XB1 A;  2CT2 A;  3PUR A;  4LKA A;  2KKX A;  4A4C A;  2D8U A;  4YAD A;  5TDW A;  2KGI A;  5TBN A;  1WFK A;  3SHB A;  2F6J A;  2MKE A;  2KFT A;  4FIP A;  1DCQ A;  1WGM A;  4QF2 A;  1WEN A;  5D1K B;  4A0C D;  1IYM A;  4F1P A;  3KNV A;  1XWH A;  3T9K A;  2LDR A;  3DPL R;  4B86 C;  2YYR A;  3LQH A;  4AP4 A;  2OXQ C;  1WEV A;  4PTB A;  4AYC A;  2EOD A;  2YW8 A;  2RI7 A;  4LJN A;  3RTR B;  3N9Q A;  3ZTG A;  3M62 A;  4FK5 A;  1WEM A;  3ZYQ A;  2L80 A;  2KE1 A;  5B75 A;  2DJA A;  3SOX A;  1X4U A;  4I7C A;  2YRE A;  2G45 A;  3FAN A;  1CHC A;  2LGV A;  1G25 A;  4QQ4 A;  2MIQ A;  2QIC A;  2IDA A;  1DVP A;  5EYA F;  4WZ0 A;  2ECG A; 
#chains in the Genus database with same CATH homology
 1WEP A;  1ZBD B;  3O33 A;  2BAY A;  4YC9 A;  1WEO A;  4R2Y A;  5FER A;  1U6G B;  4L58 A;  3ZVY A;  4B7Y C;  4ZUX U;  5LKU A;  2L0B A;  3GV4 A;  4L7X A;  4WZ3 B;  2LN0 A;  3O37 A;  1Z2Q A;  4BHW A;  2VNF A;  3FL2 A;  3GL6 A;  5H1V A;  4YBM A;  2VPB A;  1LDJ B;  2JRJ A;  4YAT A;  5JG6 A;  3U5M A;  2VPG A;  2EA6 A;  2KIZ A;  2K4D A;  3LQI A;  1F62 A;  3L1X A;  4WA6 A;  2YQL A;  2MD8 C;  2CKL A;  2M85 A;  2PNX A;  5FB1 A;  5D1M B;  2G43 A;  2EGP A;  2LV9 A;  2L5U A;  3I2D A;  2HYE D;  3ZPV 1;  4YBT A;  5AIT A;  1WIL A;  5TAB A;  2HDP A;  4MVT A;  1WEW A;  2YHN A;  3NG2 A;  2ECJ A;  5TRB A;  1WEQ A;  2G6Q A;  2ZET C;  5LCW B;  3N9P A;  4FJC A;  4WZ2 A;  4AUQ B;  2K16 A;  4IC3 A;  2QIZ A;  2E6S A;  2ECV A;  2KRE A;  5KH9 A;  2QJ0 A;  3RPG C;  2KU3 A;  2ECI A;  2L43 A;  2PUY A;  4R7E A;  5AIU A;  5H1T A;  1JM7 A;  2LQ6 A;  2VPE A;  5C13 A;  3L11 A;  2JMD A;  4N4F A;  2I50 A;  2YSJ A;  1WIM A;  1WEU A;  2JMJ A;  4GND A;  5B78 A;  1FP0 A;  4I7B A;  5FEY A;  3O7A A;  3HCS A;  5TDR A;  2KWJ A;  5H1U A;  5G0F A;  2FUU A;  2JMI A;  4YAB A;  3L1Z B;  4V3K C;  1LDK C;  2VJE B;  2XEU A;  1V87 A;  4LAD B;  3T6R A;  3MHS A;  4TKP B;  2Y1M A;  2E6R A;  4PPE A;  4S3O B;  2KWO A;  5G05 B;  4F52 B;  3M99 A;  2VPD A;  4R8P K;  1VFY A;  4GB0 A;  2YUR A;  2NAA A;  2FSA A;  3C6W A;  3O36 A;  2MNY A;  3MHH A;  4C9Z A;  4N3W A;  1K2F A;  1FBV A;  2YHO A;  4YAX A;  2VJF B;  2K17 A;  2YUC A;  3N9L A;  2KGG A;  2F42 A;  5G04 B;  1WE9 A;  2LRI C;  5B76 A;  5B77 A;  2M3H A;  2H0D B;  5B79 A;  5KH3 A;  1HYJ A;  3N9M A;  3C5K A;  2CSZ A;  1JOC A;  5C11 A;  2MNZ A;  2ECT A;  4XI1 A;  4AVX A;  3EB5 A;  4CA1 A;  3KV5 A;  4UP0 A;  3LRQ A;  2C2V S;  4CCG X;  5LKZ A;  4V3L C;  2YQM A;  4UP5 A;  3M63 A;  3V43 A;  3HTK C;  2YT5 A;  2K1J A;  2LXH C;  4AYC B;  2YU4 A;  1Z60 A;  3ASL A;  1RMD A;  1VYX A;  2AN6 A;  3IHP A;  2LGG A;  1WES A;  3N9N A;  2LGK A;  5H9M A;  2RSD A;  3U5O A;  3KQI A;  4LK9 A;  2D8S A;  3N9O A;  4A4B A;  1N87 A;  2Y1N A;  3O70 A;  3HCT A;  3KV6 A;  3QZV A;  4UI9 B;  3PUQ A;  4I7D A;  4LLB A;  4Q6F A;  4O64 A;  3PHD A;  2MT5 A;  4ZQL A;  4P5O B;  1BOR A;  3ZVZ B;  2KR4 A;  5LKT A;  3VK6 A;  5KH7 A;  4ZDT A;  2KWN A;  2M1R A;  4GNF A;  3SOW A;  4W4U A;  3O35 A;  1X4J A;  3RPG B;  4QF3 A;  5B8D A;  3O34 A;  4YBS A;  2VJE A;  2KWK A;  3EB6 A;  3T7L A;  2ECN A;  3ZPV E;  1T1H A;  1HYI A;  5I3L A;  1Z6U A;  2CKL B;  2VP7 A;  3HCU A;  3LQJ A;  1E4U A;  5J3X A;  2MA6 A;  2L75 A;  4GNE A;  1MM2 A;  3U5N A;  3U5P A;  5D1L B;  5LKX A;  2LGL A;  2C2L A;  3ZNI A;  5FB0 A;  3DQV R;  2MA5 A;  2UZG A;  1MM3 A;  2F6N A;  1VD4 A;  4MSX A;  4BBQ A;  2VJF A;  2Y43 A;  2LXP C;  4A49 A;  4NN2 A;  2ECW A;  2MUM A;  4IC2 A;  1WEE A;  1X4I A;  4X3G A;  2YSM A;  2DX8 A;  2M6M A;  2H0D A;  5DIN A;  5DKA A;  2KYU A;  2MD7 B;  4GNG A;  3SOU A;  2CSY A;  4FO9 A;  2FUI A;  4S3O C;  1JM7 B;  2XB1 A;  2CT2 A;  3PUR A;  4LKA A;  4A4C A;  4YAD A;  5TDW A;  2KGI A;  5TBN A;  1WFK A;  3SHB A;  2F6J A;  2KFT A;  4FIP A;  1WGM A;  4QF2 A;  1WEN A;  5D1K B;  4A0C D;  1IYM A;  3KNV A;  1XWH A;  4B86 C;  2LDR A;  3DPL R;  2YYR A;  3LQH A;  4AP4 A;  2OXQ C;  1WEV A;  4PTB A;  4AYC A;  2EOD A;  2YW8 A;  2RI7 A;  4LJN A;  3RTR B;  3N9Q A;  3ZTG A;  3M62 A;  4FK5 A;  1WEM A;  3ZYQ A;  2L80 A;  2KE1 A;  5B75 A;  3SOX A;  1X4U A;  4I7C A;  2YRE A;  2G45 A;  1CHC A;  2LGV A;  1G25 A;  2MIQ A;  2QIC A;  2IDA A;  1DVP A;  5EYA F;  4WZ0 A;  2ECG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...