2CSZA

Solution structure of the ring domain of the synaptotagmin-like protein 4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
76
structure length
76
Chain Sequence
GSSGSSGLLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Synaptotagmin-like protein 4
publication title Solution Structure of the RING domain of the Synaptotagmin-like protein 4
rcsb
source organism Homo sapiens
total genus 2
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cszA00
4GNDA 4I7CA 2G6QA 2HYED 2KWJA 2YT5A 5FEYA 2YSMA 3ZNIA 4AVXA 4F52B 5EYAF 1WILA 1X4UA 2KU3A 2YREA 2MUMA 2BAYA 2LXPC 3O36A 2F6JA 4FK5A 5TABA 2AN6A 2VPGA 2YUCA 3KV6A 4X3GA 4YBSA 3KNVA 3L1XA 2JRJA 1F62A 5FB1A 5B77A 3ZYQA 4YATA 4AP4A 3U5PA 2L43A 3N9NA 5KH7A 5I3LA 2JMIA 3PUQA 4PPEA 2CKLA 2YYRA 3KQIA 3ZPV1 1N87A 5TBNA 3U5NA 3KV5A 2LQ6A 3U5OA 4YBMA 2QJ0A 4WA6A 2ECWA 3QZVA 2VPEA 4CA1A 3T7LA 2M3HA 4YC9A 2G43A 4P5OB 2KGGA 1WEMA 2M85A 2YURA 2F6NA 1WGMA 4ZDTA 3DPLR 3ASLA 5G0FA 4IC3A 5B76A 3HCUA 1G25A 2LN0A 4YADA 1IYMA 2KYUA 2YU4A 4GNGA 3RTRB 4LADB 4YAXA 3PURA 1HYJA 2MD7B 5FERA 1E4UA 1X4JA 3O34A 1XWHA 3RPGC 4GNFA 3LQJA 2EGPA 1X4IA 2PNXA 3HCTA 4ZUXU 2LXHC 5D1LB 4Q6FA 2ECIA 2L0BA 2YHOA 3HTKC 2MA5A 2H0DB 1WEUA 5TDRA 3T6RA 1CHCA 2CSZA 3SOXA 5TDWA 3GL6A 4AUQB 4FIPA 2Y1NA 2YHNA 2Y1MA 1WEWA 2VPBA 2KWKA 3V43A 1WEEA 1MM3A 3N9OA 3RPGB 5LKZA 2ECTA 1WIMA 2LGLA 3ZTGA 5H9MA 1WEQA 3MHHA 4C9ZA 3L1ZB 4B86C 2JMDA 3ZVZB 2MT5A 2K4DA 4S3OC 4QF2A 5B8DA 2VNFA 2YSJA 2KR4A 2M6MA 2FUIA 3MHSA 2K16A 1HYIA 5H1UA 1WENA 2ZETC 2K1JA 4N4FA 1WESA 2L80A 4N3WA 2YQMA 4V3LC 1T1HA 2OXQC 2MIQA 4FO9A 5DINA 5JG6A 3SOUA 3N9QA 2L5UA 1LDJB 5AIUA 2QIZA 4S3OB 2VJFB 2CT2A 2LV9A 1V87A 5H1TA 4UP0A 2I50A 4LKAA 4I7DA 1Z2QA 3O37A 4MVTA 2YQLA 5D1KB 1RMDA 2UZGA 2LGVA 3O70A 4R7EA 4LLBA 4WZ3B 4A0CD 3LRQA 4WZ2A 2F42A 2JMJA 2RI7A 2M1RA 4I7BA 4XI1A 4R2YA 5B78A 2RSDA 1Z60A 5AITA 2KWOA 2HDPA 4L58A 3EB6A 3DQVR 3L11A 4CCGX 4NN2A 2H0DA 2KREA 2VP7A 4W4UA 4AYCB 3M62A 2YW8A 4L7XA 4UI9B 5B75A 5TRBA 3U5MA 2ECJA 1WE9A 5B79A 5G05B 4BBQA 3IHPA 2KFTA 4R8PK 1JOCA 1FBVA 2PUYA 2LRIC 4V3KC 2VJEB 2L75A 2E6RA 4A49A 1U6GB 4BHWA 2VJEA 3M99A 4QF3A 1WEPA 3C5KA 4UP5A 2KIZA 2KGIA 2MNYA 4A4BA 2XB1A 2CSYA 2C2VS 5G04B 2QICA 3N9MA 3N9LA 4YABA 3EB5A 3N9PA 4TKPB 4GB0A 3NG2A 2LDRA 3VK6A 4GNEA 1VD4A 2CKLB 1MM2A 3LQIA 2EA6A 4MSXA 3M63A 5C11A 1JM7B 4ZQLA 4WZ0A 5D1MB 2MNZA 2VJFA 1JM7A 3I2DA 3O33A 1LDKC 2ECNA 3C6WA 3O35A 5C13A 3O7AA 2ECVA 1K2FA 5FB0A 2LGKA 1Z6UA 2ECGA 2EODA 4PTBA 1DVPA 3SHBA 5LCWB 4A4CA 2IDAA 1WEVA 1VFYA 2FUUA 2C2LA 3FL2A 4LJNA 2VPDA 3ZVYA 4IC2A 2D8SA 3LQHA 2FSAA 3HCSA 2G45A 5KH3A 2MD8C 5LKTA 4O64A 1WFKA 2NAAA 1ZBDB 5H1VA 4LK9A 2K17A 2KWNA 2DX8A 2E6SA 5DKAA 3GV4A 3PHDA 3SOWA 3ZPVE 4YBTA 5J3XA 4B7YC 1WEOA 2XEUA 5LKXA 2Y43A 2LGGA 2MA6A 1VYXA 5LKUA 4AYCA 5KH9A 2KE1A 1BORA 4FJCA 1FP0A
chains in the Genus database with same CATH superfamily
2L7PA 4GNDA 4I7CA 2G6QA 2CONA 1MBMA 2HYED 2KWJA 2YT5A 5FEYA 2IQJA 2YSMA 5SVYA 3ZNIA 4AVXA 4F52B 5EYAF 1WILA 1X4UA 2KU3A 2YREA 2OWAA 2MUMA 2BAYA 2LXPC 3O36A 3LDYA 2F6JA 4FK5A 4OGEA 3FAOA 5TABA 2AN6A 2VPGA 2YUCA 3KV6A 4X3GA 2EXUA 4YBSA 3KNVA 2MKEA 3L1XA 2JRJA 1F62A 5FB1A 5B77A 3ZYQA 4YATA 4AP4A 3U5PA 2CRRA 2L43A 3N9NA 5KH7A 5I3LA 2JMIA 3PUQA 4PPEA 2CKLA 2YYRA 3M7KA 3KQIA 3ZPV1 1N87A 5TBNA 3U5NA 3KV5A 2LQ6A 3U5OA 4YBMA 2QJ0A 4WA6A 2ECWA 3QZVA 2VPEA 4CA1A 3T7LA 2M3HA 4YC9A 2G43A 4P5OB 2KGGA 1WEMA 2M85A 2YURA 2F6NA 1WGMA 4ZDTA 3DPLR 3ASLA 5G0FA 4IC3A 5B76A 3HCUA 4QQ4A 3E2DA 2CRWA 5SVXA 3FJUB 1G25A 2RR4A 2LN0A 4YADA 1IYMA 2KYUA 2D8UA 2YU4A 4GNGA 3RTRB 4LADB 4YAXA 3PURA 1HYJA 5SVIB 5K3QA 2MD7B 5FERA 1E4UA 1X4JA 3O34A 1XWHA 3RPGC 4GNFA 3LQJA 4O62A 2EGPA 1X4IA 2PNXA 3HCTA 3PLWA 4ZUXU 2LXHC 5D1LB 4Q6FA 2ECIA 2L0BA 2YHOA 3HTKC 2MA5A 2H0DB 3Q1DA 1WEUA 5TDRA 3T6RA 1CHCA 2CSZA 3SOXA 5TDWA 2DSMA 3GL6A 4AUQB 4FIPA 2Y1NA 2YHNA 2Y1MA 1WEWA 2VPBA 4H9DA 2LAUA 2KWKA 3V43A 1WEEA 1MM3A 3N9OA 3RPGB 5LKZA 2ECTA 1WIMA 2LGLA 3ZTGA 5H9MA 1WEQA 3MHHA 2XOCA 4C9ZA 3L1ZB 2FFWA 4B86C 2JMDA 3ZVZB 2MT5A 2K4DA 4S3OC 4QF2A 5B8DA 2VNFA 2YSJA 2KR4A 2M6MA 2FUIA 3MHSA 2K16A 1HYIA 2KKYA 5H1UA 1WENA 2ZETC 2K1JA 4N4FA 4Z0OA 1WESA 2L80A 4N3WA 2YQMA 3LVRE 4V3LC 1T1HA 2YVRA 2OXQC 2MIQA 4FO9A 5DINA 5JG6A 3SOUA 3N9QA 2L5UA 1LDJB 5AIUA 3SUBA 2QIZA 4S3OB 2VJFB 2CT2A 2LV9A 1V87A 5H1TA 4UP0A 2I50A 4LKAA 3KDEC 4I7DA 1Z2QA 3O37A 2JM3A 4MVTA 2YQLA 5D1KB 1RMDA 2UZGA 3JUEA 2LGVA 3O70A 3DWDA 5SVIA 3MDBC 4R7EA 4LLBA 4WZ3B 4A0CD 3LRQA 4WZ2A 2F42A 2JMJA 3FM8C 2RI7A 2M1RA 4I7BA 3DDTA 4R2YA 4XI1A 5B78A 2RSDA 1Z60A 5AITA 2KWOA 2HDPA 4L58A 1DCQA 2EGMA 3EB6A 3DQVR 3L11A 4CCGX 4NN2A 2H0DA 2KREA 2VP7A 4W4UA 4AYCB 3M62A 2YW8A 4L7XA 4UI9B 5B75A 5TRBA 3U5MA 2ECJA 1WE9A 5B79A 5G05B 3H7HA 4BBQA 3IHPA 3LJUX 2CSVA 2KFTA 1JOCA 4R8PK 1FBVA 2PUYA 2LRIC 4V3KC 2VJEB 2L75A 2E6RA 2XP0A 4A49A 4OGCA 1U6GB 4BHWA 2VJEA 3M99A 4QF3A 3FEHA 1WEPA 2DJAA 2B0OE 3C5KA 4UP5A 2KIZA 2KGIA 2MNYA 4A4BA 2XB1A 3FANA 3LVQE 3O47A 2CSYA 2C2VS 5G04B 2QICA 2FD4A 2KKXA 3N9MA 3N9LA 4YABA 3EB5A 3N9PA 4TKPB 4GB0A 3NG2A 2LDRA 3VK6A 4GNEA 2M13A 4Z0RA 1VD4A 2XOYA 2CKLB 1MM2A 2E61A 3LQIA 2EA6A 4MSXA 3M63A 5C11A 1JM7B 4ZQLA 4WZ0A 5D1MB 2MNZA 2VJFA 1JM7A 3I2DA 3O33A 1LDKC 2ECNA 3C6WA 2P57A 3O35A 5C13A 3O7AA 2ECVA 1K2FA 3T9KA 5FB0A 2LGKA 1Z6UA 2ECGA 2EODA 4PTBA 1DVPA 3SHBA 5LCWB 4A4CA 2IDAA 1WEVA 1VFYA 2FUUA 2C2LA 3FL2A 4LJNA 2VPDA 3ZVYA 4IC2A 2D8SA 3LQHA 2JUNA 2FSAA 3HCSA 2G45A 5KH3A 2MD8C 5LKTA 4O64A 1WFKA 2NAAA 1ZBDB 5H1VA 4LK9A 2K17A 2KWNA 2DX8A 2E6SA 5DKAA 3GV4A 3PHDA 4F1PA 3SOWA 3ZPVE 4YBTA 5J3XA 4B7YC 1WEOA 2XEUA 5LKXA 2Y43A 2LGGA 2MA6A 1VYXA 5LKUA 4AYCA 5KH9A 2KE1A 2XOZA 1BORA 4FJCA 1FP0A
chains in the Genus database with same CATH topology
4GNDA 4I7CA 2G6QA 2HYED 2KWJA 2YT5A 5FEYA 2YSMA 3ZNIA 4AVXA 4F52B 5EYAF 1WILA 1X4UA 2KU3A 2YREA 2MUMA 2BAYA 2LXPC 3O36A 2F6JA 4FK5A 5TABA 2AN6A 2VPGA 2YUCA 3KV6A 4X3GA 4YBSA 3KNVA 3L1XA 2JRJA 1F62A 5FB1A 5B77A 3ZYQA 4YATA 4AP4A 3U5PA 2L43A 3N9NA 5KH7A 5I3LA 2JMIA 3PUQA 4PPEA 2CKLA 2YYRA 3KQIA 3ZPV1 1N87A 5TBNA 3U5NA 3KV5A 2LQ6A 3U5OA 4YBMA 2QJ0A 4WA6A 2ECWA 3QZVA 2VPEA 4CA1A 3T7LA 2M3HA 4YC9A 2G43A 4P5OB 2KGGA 1WEMA 2M85A 2YURA 2F6NA 1WGMA 4ZDTA 3DPLR 3ASLA 5G0FA 4IC3A 5B76A 3HCUA 1G25A 2LN0A 4YADA 1IYMA 2KYUA 2YU4A 4GNGA 3RTRB 4LADB 4YAXA 3PURA 1HYJA 2MD7B 5FERA 1E4UA 1X4JA 3O34A 1XWHA 3RPGC 4GNFA 3LQJA 2EGPA 1X4IA 2PNXA 3HCTA 4ZUXU 2LXHC 5D1LB 4Q6FA 2ECIA 2L0BA 2YHOA 3HTKC 2MA5A 2H0DB 1WEUA 5TDRA 3T6RA 1CHCA 2CSZA 3SOXA 5TDWA 3GL6A 4AUQB 4FIPA 2Y1NA 2YHNA 2Y1MA 1WEWA 2VPBA 2KWKA 3V43A 1WEEA 1MM3A 3N9OA 3RPGB 5LKZA 2ECTA 1WIMA 2LGLA 3ZTGA 5H9MA 1WEQA 3MHHA 4C9ZA 3L1ZB 4B86C 2JMDA 3ZVZB 2MT5A 2K4DA 4S3OC 4QF2A 5B8DA 2VNFA 2YSJA 2KR4A 2M6MA 2FUIA 3MHSA 2K16A 1HYIA 5H1UA 1WENA 2ZETC 2K1JA 4N4FA 1WESA 2L80A 4N3WA 2YQMA 4V3LC 1T1HA 2OXQC 2MIQA 4FO9A 5DINA 5JG6A 3SOUA 3N9QA 2L5UA 1LDJB 5AIUA 2QIZA 4S3OB 2VJFB 2CT2A 2LV9A 1V87A 5H1TA 4UP0A 2I50A 4LKAA 4I7DA 1Z2QA 3O37A 4MVTA 2YQLA 5D1KB 1RMDA 2UZGA 2LGVA 3O70A 4R7EA 4LLBA 4WZ3B 4A0CD 3LRQA 4WZ2A 2F42A 2JMJA 2RI7A 2M1RA 4I7BA 4XI1A 4R2YA 5B78A 2RSDA 1Z60A 5AITA 2KWOA 2HDPA 4L58A 3EB6A 3DQVR 3L11A 4CCGX 4NN2A 2H0DA 2KREA 2VP7A 4W4UA 4AYCB 3M62A 2YW8A 4L7XA 4UI9B 5B75A 5TRBA 3U5MA 2ECJA 1WE9A 5B79A 5G05B 4BBQA 3IHPA 2KFTA 4R8PK 1JOCA 1FBVA 2PUYA 2LRIC 4V3KC 2VJEB 2L75A 2E6RA 4A49A 1U6GB 4BHWA 2VJEA 3M99A 4QF3A 1WEPA 3C5KA 4UP5A 2KIZA 2KGIA 2MNYA 4A4BA 2XB1A 2CSYA 2C2VS 5G04B 2QICA 3N9MA 3N9LA 4YABA 3EB5A 3N9PA 4TKPB 4GB0A 3NG2A 2LDRA 3VK6A 4GNEA 1VD4A 2CKLB 1MM2A 3LQIA 2EA6A 4MSXA 3M63A 5C11A 1JM7B 4ZQLA 4WZ0A 5D1MB 2MNZA 2VJFA 1JM7A 3I2DA 3O33A 1LDKC 2ECNA 3C6WA 3O35A 5C13A 3O7AA 2ECVA 1K2FA 5FB0A 2LGKA 1Z6UA 2ECGA 2EODA 4PTBA 1DVPA 3SHBA 5LCWB 4A4CA 2IDAA 1WEVA 1VFYA 2FUUA 2C2LA 3FL2A 4LJNA 2VPDA 3ZVYA 4IC2A 2D8SA 3LQHA 2FSAA 3HCSA 2G45A 5KH3A 2MD8C 5LKTA 4O64A 1WFKA 2NAAA 1ZBDB 5H1VA 4LK9A 2K17A 2KWNA 2DX8A 2E6SA 5DKAA 3GV4A 3PHDA 3SOWA 3ZPVE 4YBTA 5J3XA 4B7YC 1WEOA 2XEUA 5LKXA 2Y43A 2LGGA 2MA6A 1VYXA 5LKUA 4AYCA 5KH9A 2KE1A 1BORA 4FJCA 1FP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GND A;  4I7C A;  2G6Q A;  2HYE D;  2KWJ A;  2YT5 A;  5FEY A;  2YSM A;  3ZNI A;  4AVX A;  4F52 B;  5EYA F;  1WIL A;  1X4U A;  2KU3 A;  2YRE A;  2MUM A;  2BAY A;  2LXP C;  3O36 A;  2F6J A;  4FK5 A;  5TAB A;  2AN6 A;  2VPG A;  2YUC A;  3KV6 A;  4X3G A;  4YBS A;  3KNV A;  3L1X A;  2JRJ A;  1F62 A;  5FB1 A;  5B77 A;  3ZYQ A;  4YAT A;  4AP4 A;  3U5P A;  2L43 A;  3N9N A;  5KH7 A;  5I3L A;  2JMI A;  3PUQ A;  4PPE A;  2CKL A;  2YYR A;  3KQI A;  3ZPV 1;  1N87 A;  5TBN A;  3U5N A;  3KV5 A;  2LQ6 A;  3U5O A;  4YBM A;  2QJ0 A;  4WA6 A;  2ECW A;  3QZV A;  2VPE A;  4CA1 A;  3T7L A;  2M3H A;  4YC9 A;  2G43 A;  4P5O B;  2KGG A;  1WEM A;  2M85 A;  2YUR A;  2F6N A;  1WGM A;  4ZDT A;  3DPL R;  3ASL A;  5G0F A;  4IC3 A;  5B76 A;  3HCU A;  1G25 A;  2LN0 A;  4YAD A;  1IYM A;  2KYU A;  2YU4 A;  4GNG A;  3RTR B;  4LAD B;  4YAX A;  3PUR A;  1HYJ A;  2MD7 B;  5FER A;  1E4U A;  1X4J A;  3O34 A;  1XWH A;  3RPG C;  4GNF A;  3LQJ A;  2EGP A;  1X4I A;  2PNX A;  3HCT A;  4ZUX U;  2LXH C;  5D1L B;  4Q6F A;  2ECI A;  2L0B A;  2YHO A;  3HTK C;  2MA5 A;  2H0D B;  1WEU A;  5TDR A;  3T6R A;  1CHC A;  2CSZ A;  3SOX A;  5TDW A;  3GL6 A;  4AUQ B;  4FIP A;  2Y1N A;  2YHN A;  2Y1M A;  1WEW A;  2VPB A;  2KWK A;  3V43 A;  1WEE A;  1MM3 A;  3N9O A;  3RPG B;  5LKZ A;  2ECT A;  1WIM A;  2LGL A;  3ZTG A;  5H9M A;  1WEQ A;  3MHH A;  4C9Z A;  3L1Z B;  4B86 C;  2JMD A;  3ZVZ B;  2MT5 A;  2K4D A;  4S3O C;  4QF2 A;  5B8D A;  2VNF A;  2YSJ A;  2KR4 A;  2M6M A;  2FUI A;  3MHS A;  2K16 A;  1HYI A;  5H1U A;  1WEN A;  2ZET C;  2K1J A;  4N4F A;  1WES A;  2L80 A;  4N3W A;  2YQM A;  4V3L C;  1T1H A;  2OXQ C;  2MIQ A;  4FO9 A;  5DIN A;  5JG6 A;  3SOU A;  3N9Q A;  2L5U A;  1LDJ B;  5AIU A;  2QIZ A;  4S3O B;  2VJF B;  2CT2 A;  2LV9 A;  1V87 A;  5H1T A;  4UP0 A;  2I50 A;  4LKA A;  4I7D A;  1Z2Q A;  3O37 A;  4MVT A;  2YQL A;  5D1K B;  1RMD A;  2UZG A;  2LGV A;  3O70 A;  4R7E A;  4LLB A;  4WZ3 B;  4A0C D;  3LRQ A;  4WZ2 A;  2F42 A;  2JMJ A;  2RI7 A;  2M1R A;  4I7B A;  4XI1 A;  4R2Y A;  5B78 A;  2RSD A;  1Z60 A;  5AIT A;  2KWO A;  2HDP A;  4L58 A;  3EB6 A;  3DQV R;  3L11 A;  4CCG X;  4NN2 A;  2H0D A;  2KRE A;  2VP7 A;  4W4U A;  4AYC B;  3M62 A;  2YW8 A;  4L7X A;  4UI9 B;  5B75 A;  5TRB A;  3U5M A;  2ECJ A;  1WE9 A;  5B79 A;  5G05 B;  4BBQ A;  3IHP A;  2KFT A;  4R8P K;  1JOC A;  1FBV A;  2PUY A;  2LRI C;  4V3K C;  2VJE B;  2L75 A;  2E6R A;  4A49 A;  1U6G B;  4BHW A;  2VJE A;  3M99 A;  4QF3 A;  1WEP A;  3C5K A;  4UP5 A;  2KIZ A;  2KGI A;  2MNY A;  4A4B A;  2XB1 A;  2CSY A;  2C2V S;  5G04 B;  2QIC A;  3N9M A;  3N9L A;  4YAB A;  3EB5 A;  3N9P A;  4TKP B;  4GB0 A;  3NG2 A;  2LDR A;  3VK6 A;  4GNE A;  1VD4 A;  2CKL B;  1MM2 A;  3LQI A;  2EA6 A;  4MSX A;  3M63 A;  5C11 A;  1JM7 B;  4ZQL A;  4WZ0 A;  5D1M B;  2MNZ A;  2VJF A;  1JM7 A;  3I2D A;  3O33 A;  1LDK C;  2ECN A;  3C6W A;  3O35 A;  5C13 A;  3O7A A;  2ECV A;  1K2F A;  5FB0 A;  2LGK A;  1Z6U A;  2ECG A;  2EOD A;  4PTB A;  1DVP A;  3SHB A;  5LCW B;  4A4C A;  2IDA A;  1WEV A;  1VFY A;  2FUU A;  2C2L A;  3FL2 A;  4LJN A;  2VPD A;  3ZVY A;  4IC2 A;  2D8S A;  3LQH A;  2FSA A;  3HCS A;  2G45 A;  5KH3 A;  2MD8 C;  5LKT A;  4O64 A;  1WFK A;  2NAA A;  1ZBD B;  5H1V A;  4LK9 A;  2K17 A;  2KWN A;  2DX8 A;  2E6S A;  5DKA A;  3GV4 A;  3PHD A;  3SOW A;  3ZPV E;  4YBT A;  5J3X A;  4B7Y C;  1WEO A;  2XEU A;  5LKX A;  2Y43 A;  2LGG A;  2MA6 A;  1VYX A;  5LKU A;  4AYC A;  5KH9 A;  2KE1 A;  1BOR A;  4FJC A;  1FP0 A; 
#chains in the Genus database with same CATH topology
 2L7P A;  4GND A;  4I7C A;  2G6Q A;  2CON A;  1MBM A;  2HYE D;  2KWJ A;  2YT5 A;  5FEY A;  2IQJ A;  2YSM A;  5SVY A;  3ZNI A;  4AVX A;  4F52 B;  5EYA F;  1WIL A;  1X4U A;  2KU3 A;  2YRE A;  2OWA A;  2MUM A;  2BAY A;  2LXP C;  3O36 A;  3LDY A;  2F6J A;  4FK5 A;  4OGE A;  3FAO A;  5TAB A;  2AN6 A;  2VPG A;  2YUC A;  3KV6 A;  4X3G A;  2EXU A;  4YBS A;  3KNV A;  2MKE A;  3L1X A;  2JRJ A;  1F62 A;  5FB1 A;  5B77 A;  3ZYQ A;  4YAT A;  4AP4 A;  3U5P A;  2CRR A;  2L43 A;  3N9N A;  5KH7 A;  5I3L A;  2JMI A;  3PUQ A;  4PPE A;  2CKL A;  2YYR A;  3M7K A;  3KQI A;  3ZPV 1;  1N87 A;  5TBN A;  3U5N A;  3KV5 A;  2LQ6 A;  3U5O A;  4YBM A;  2QJ0 A;  4WA6 A;  2ECW A;  3QZV A;  2VPE A;  4CA1 A;  3T7L A;  2M3H A;  4YC9 A;  2G43 A;  4P5O B;  2KGG A;  1WEM A;  2M85 A;  2YUR A;  2F6N A;  1WGM A;  4ZDT A;  3DPL R;  3ASL A;  5G0F A;  4IC3 A;  5B76 A;  3HCU A;  4QQ4 A;  3E2D A;  2CRW A;  5SVX A;  3FJU B;  1G25 A;  2RR4 A;  2LN0 A;  4YAD A;  1IYM A;  2KYU A;  2D8U A;  2YU4 A;  4GNG A;  3RTR B;  4LAD B;  4YAX A;  3PUR A;  1HYJ A;  5SVI B;  5K3Q A;  2MD7 B;  5FER A;  1E4U A;  1X4J A;  3O34 A;  1XWH A;  3RPG C;  4GNF A;  3LQJ A;  4O62 A;  2EGP A;  1X4I A;  2PNX A;  3HCT A;  3PLW A;  4ZUX U;  2LXH C;  5D1L B;  4Q6F A;  2ECI A;  2L0B A;  2YHO A;  3HTK C;  2MA5 A;  2H0D B;  3Q1D A;  1WEU A;  5TDR A;  3T6R A;  1CHC A;  2CSZ A;  3SOX A;  5TDW A;  2DSM A;  3GL6 A;  4AUQ B;  4FIP A;  2Y1N A;  2YHN A;  2Y1M A;  1WEW A;  2VPB A;  4H9D A;  2LAU A;  2KWK A;  3V43 A;  1WEE A;  1MM3 A;  3N9O A;  3RPG B;  5LKZ A;  2ECT A;  1WIM A;  2LGL A;  3ZTG A;  5H9M A;  1WEQ A;  3MHH A;  2XOC A;  4C9Z A;  3L1Z B;  2FFW A;  4B86 C;  2JMD A;  3ZVZ B;  2MT5 A;  2K4D A;  4S3O C;  4QF2 A;  5B8D A;  2VNF A;  2YSJ A;  2KR4 A;  2M6M A;  2FUI A;  3MHS A;  2K16 A;  1HYI A;  2KKY A;  5H1U A;  1WEN A;  2ZET C;  2K1J A;  4N4F A;  4Z0O A;  1WES A;  2L80 A;  4N3W A;  2YQM A;  3LVR E;  4V3L C;  1T1H A;  2YVR A;  2OXQ C;  2MIQ A;  4FO9 A;  5DIN A;  5JG6 A;  3SOU A;  3N9Q A;  2L5U A;  1LDJ B;  5AIU A;  3SUB A;  2QIZ A;  4S3O B;  2VJF B;  2CT2 A;  2LV9 A;  1V87 A;  5H1T A;  4UP0 A;  2I50 A;  4LKA A;  3KDE C;  4I7D A;  1Z2Q A;  3O37 A;  2JM3 A;  4MVT A;  2YQL A;  5D1K B;  1RMD A;  2UZG A;  3JUE A;  2LGV A;  3O70 A;  3DWD A;  5SVI A;  3MDB C;  4R7E A;  4LLB A;  4WZ3 B;  4A0C D;  3LRQ A;  4WZ2 A;  2F42 A;  2JMJ A;  3FM8 C;  2RI7 A;  2M1R A;  4I7B A;  3DDT A;  4R2Y A;  4XI1 A;  5B78 A;  2RSD A;  1Z60 A;  5AIT A;  2KWO A;  2HDP A;  4L58 A;  1DCQ A;  2EGM A;  3EB6 A;  3DQV R;  3L11 A;  4CCG X;  4NN2 A;  2H0D A;  2KRE A;  2VP7 A;  4W4U A;  4AYC B;  3M62 A;  2YW8 A;  4L7X A;  4UI9 B;  5B75 A;  5TRB A;  3U5M A;  2ECJ A;  1WE9 A;  5B79 A;  5G05 B;  3H7H A;  4BBQ A;  3IHP A;  3LJU X;  2CSV A;  2KFT A;  1JOC A;  4R8P K;  1FBV A;  2PUY A;  2LRI C;  4V3K C;  2VJE B;  2L75 A;  2E6R A;  2XP0 A;  4A49 A;  4OGC A;  1U6G B;  4BHW A;  2VJE A;  3M99 A;  4QF3 A;  3FEH A;  1WEP A;  2DJA A;  2B0O E;  3C5K A;  4UP5 A;  2KIZ A;  2KGI A;  2MNY A;  4A4B A;  2XB1 A;  3FAN A;  3LVQ E;  3O47 A;  2CSY A;  2C2V S;  5G04 B;  2QIC A;  2FD4 A;  2KKX A;  3N9M A;  3N9L A;  4YAB A;  3EB5 A;  3N9P A;  4TKP B;  4GB0 A;  3NG2 A;  2LDR A;  3VK6 A;  4GNE A;  2M13 A;  4Z0R A;  1VD4 A;  2XOY A;  2CKL B;  1MM2 A;  2E61 A;  3LQI A;  2EA6 A;  4MSX A;  3M63 A;  5C11 A;  1JM7 B;  4ZQL A;  4WZ0 A;  5D1M B;  2MNZ A;  2VJF A;  1JM7 A;  3I2D A;  3O33 A;  1LDK C;  2ECN A;  3C6W A;  2P57 A;  3O35 A;  5C13 A;  3O7A A;  2ECV A;  1K2F A;  3T9K A;  5FB0 A;  2LGK A;  1Z6U A;  2ECG A;  2EOD A;  4PTB A;  1DVP A;  3SHB A;  5LCW B;  4A4C A;  2IDA A;  1WEV A;  1VFY A;  2FUU A;  2C2L A;  3FL2 A;  4LJN A;  2VPD A;  3ZVY A;  4IC2 A;  2D8S A;  3LQH A;  2JUN A;  2FSA A;  3HCS A;  2G45 A;  5KH3 A;  2MD8 C;  5LKT A;  4O64 A;  1WFK A;  2NAA A;  1ZBD B;  5H1V A;  4LK9 A;  2K17 A;  2KWN A;  2DX8 A;  2E6S A;  5DKA A;  3GV4 A;  3PHD A;  4F1P A;  3SOW A;  3ZPV E;  4YBT A;  5J3X A;  4B7Y C;  1WEO A;  2XEU A;  5LKX A;  2Y43 A;  2LGG A;  2MA6 A;  1VYX A;  5LKU A;  4AYC A;  5KH9 A;  2KE1 A;  2XOZ A;  1BOR A;  4FJC A;  1FP0 A; 
#chains in the Genus database with same CATH homology
 4GND A;  4I7C A;  2G6Q A;  2HYE D;  2KWJ A;  2YT5 A;  5FEY A;  2YSM A;  3ZNI A;  4AVX A;  4F52 B;  5EYA F;  1WIL A;  1X4U A;  2KU3 A;  2YRE A;  2MUM A;  2BAY A;  2LXP C;  3O36 A;  2F6J A;  4FK5 A;  5TAB A;  2AN6 A;  2VPG A;  2YUC A;  3KV6 A;  4X3G A;  4YBS A;  3KNV A;  3L1X A;  2JRJ A;  1F62 A;  5FB1 A;  5B77 A;  3ZYQ A;  4YAT A;  4AP4 A;  3U5P A;  2L43 A;  3N9N A;  5KH7 A;  5I3L A;  2JMI A;  3PUQ A;  4PPE A;  2CKL A;  2YYR A;  3KQI A;  3ZPV 1;  1N87 A;  5TBN A;  3U5N A;  3KV5 A;  2LQ6 A;  3U5O A;  4YBM A;  2QJ0 A;  4WA6 A;  2ECW A;  3QZV A;  2VPE A;  4CA1 A;  3T7L A;  2M3H A;  4YC9 A;  2G43 A;  4P5O B;  2KGG A;  1WEM A;  2M85 A;  2YUR A;  2F6N A;  1WGM A;  4ZDT A;  3DPL R;  3ASL A;  5G0F A;  4IC3 A;  5B76 A;  3HCU A;  1G25 A;  2LN0 A;  4YAD A;  1IYM A;  2KYU A;  2YU4 A;  4GNG A;  3RTR B;  4LAD B;  4YAX A;  3PUR A;  1HYJ A;  2MD7 B;  5FER A;  1E4U A;  1X4J A;  3O34 A;  1XWH A;  3RPG C;  4GNF A;  3LQJ A;  2EGP A;  1X4I A;  2PNX A;  3HCT A;  4ZUX U;  2LXH C;  5D1L B;  4Q6F A;  2ECI A;  2L0B A;  2YHO A;  3HTK C;  2MA5 A;  2H0D B;  1WEU A;  5TDR A;  3T6R A;  1CHC A;  2CSZ A;  3SOX A;  5TDW A;  3GL6 A;  4AUQ B;  4FIP A;  2Y1N A;  2YHN A;  2Y1M A;  1WEW A;  2VPB A;  2KWK A;  3V43 A;  1WEE A;  1MM3 A;  3N9O A;  3RPG B;  5LKZ A;  2ECT A;  1WIM A;  2LGL A;  3ZTG A;  5H9M A;  1WEQ A;  3MHH A;  4C9Z A;  3L1Z B;  4B86 C;  2JMD A;  3ZVZ B;  2MT5 A;  2K4D A;  4S3O C;  4QF2 A;  5B8D A;  2VNF A;  2YSJ A;  2KR4 A;  2M6M A;  2FUI A;  3MHS A;  2K16 A;  1HYI A;  5H1U A;  1WEN A;  2ZET C;  2K1J A;  4N4F A;  1WES A;  2L80 A;  4N3W A;  2YQM A;  4V3L C;  1T1H A;  2OXQ C;  2MIQ A;  4FO9 A;  5DIN A;  5JG6 A;  3SOU A;  3N9Q A;  2L5U A;  1LDJ B;  5AIU A;  2QIZ A;  4S3O B;  2VJF B;  2CT2 A;  2LV9 A;  1V87 A;  5H1T A;  4UP0 A;  2I50 A;  4LKA A;  4I7D A;  1Z2Q A;  3O37 A;  4MVT A;  2YQL A;  5D1K B;  1RMD A;  2UZG A;  2LGV A;  3O70 A;  4R7E A;  4LLB A;  4WZ3 B;  4A0C D;  3LRQ A;  4WZ2 A;  2F42 A;  2JMJ A;  2RI7 A;  2M1R A;  4I7B A;  4XI1 A;  4R2Y A;  5B78 A;  2RSD A;  1Z60 A;  5AIT A;  2KWO A;  2HDP A;  4L58 A;  3EB6 A;  3DQV R;  3L11 A;  4CCG X;  4NN2 A;  2H0D A;  2KRE A;  2VP7 A;  4W4U A;  4AYC B;  3M62 A;  2YW8 A;  4L7X A;  4UI9 B;  5B75 A;  5TRB A;  3U5M A;  2ECJ A;  1WE9 A;  5B79 A;  5G05 B;  4BBQ A;  3IHP A;  2KFT A;  4R8P K;  1JOC A;  1FBV A;  2PUY A;  2LRI C;  4V3K C;  2VJE B;  2L75 A;  2E6R A;  4A49 A;  1U6G B;  4BHW A;  2VJE A;  3M99 A;  4QF3 A;  1WEP A;  3C5K A;  4UP5 A;  2KIZ A;  2KGI A;  2MNY A;  4A4B A;  2XB1 A;  2CSY A;  2C2V S;  5G04 B;  2QIC A;  3N9M A;  3N9L A;  4YAB A;  3EB5 A;  3N9P A;  4TKP B;  4GB0 A;  3NG2 A;  2LDR A;  3VK6 A;  4GNE A;  1VD4 A;  2CKL B;  1MM2 A;  3LQI A;  2EA6 A;  4MSX A;  3M63 A;  5C11 A;  1JM7 B;  4ZQL A;  4WZ0 A;  5D1M B;  2MNZ A;  2VJF A;  1JM7 A;  3I2D A;  3O33 A;  1LDK C;  2ECN A;  3C6W A;  3O35 A;  5C13 A;  3O7A A;  2ECV A;  1K2F A;  5FB0 A;  2LGK A;  1Z6U A;  2ECG A;  2EOD A;  4PTB A;  1DVP A;  3SHB A;  5LCW B;  4A4C A;  2IDA A;  1WEV A;  1VFY A;  2FUU A;  2C2L A;  3FL2 A;  4LJN A;  2VPD A;  3ZVY A;  4IC2 A;  2D8S A;  3LQH A;  2FSA A;  3HCS A;  2G45 A;  5KH3 A;  2MD8 C;  5LKT A;  4O64 A;  1WFK A;  2NAA A;  1ZBD B;  5H1V A;  4LK9 A;  2K17 A;  2KWN A;  2DX8 A;  2E6S A;  5DKA A;  3GV4 A;  3PHD A;  3SOW A;  3ZPV E;  4YBT A;  5J3X A;  4B7Y C;  1WEO A;  2XEU A;  5LKX A;  2Y43 A;  2LGG A;  2MA6 A;  1VYX A;  5LKU A;  4AYC A;  5KH9 A;  2KE1 A;  1BOR A;  4FJC A;  1FP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...