5SVIA

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
46
Chain Sequence
SDQTWVQCDACLKWRKLPDGMLPEKWYCSNNPDPQFRNCEVPEEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 48
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviA00
5SVXA 5SVIA 4QQ4A 5SVIB 5SVYA 4Z0RA 4Z0OA 4O62A 2L7PA 2RR4A 2E61A
chains in the Genus database with same CATH superfamily
5D1LB 2IQJA 2JMJA 2YUCA 4FK5A 4YBSA 2MKEA 4YABA 3FANA 4AVXA 1G25A 3U5NA 3FL2A 4AUQB 4B86C 2L7PA 3ZVYA 3T9KA 3U5OA 5B79A 3FJUB 2Y1MA 3FM8C 4AYCA 4A4BA 2MNZA 3ASLA 2ECWA 3DPLR 2LV9A 4Q6FA 2D8UA 1BORA 2L80A 4X3GA 1N87A 3PUQA 1DCQA 2KKYA 3LVRE 2KU3A 4UI9B 3U5PA 2YT5A 3M62A 3ZYQA 2VPEA 2Y43A 3MDBC 3FAOA 4A4CA 2D8SA 2XP0A 2KYUA 3LQIA 3NG2A 3O70A 2YU4A 3HCTA 1LDJB 3MHHA 3O7AA 2EA6A 5TBNA 5B8DA 4AYCB 3SUBA 5SVYA 2MD7B 4PTBA 5LKZA 2I50A 2F42A 1WGMA 5K3QA 4H9DA 2LGKA 3C5KA 2CKLA 3SOWA 4ZQLA 5LKUA 2CSVA 5H1VA 4IC2A 2LXHC 4N3WA 2B0OE 1WESA 4YC9A 1Z6UA 3HCSA 3O37A 4XI1A 3PURA 4N4FA 1ZBDB 1HYIA 4QQ4A 5TABA 1DVPA 2EODA 3N9LA 2ECVA 2L75A 3L1XA 1WENA 4GNEA 2E61A 1WEUA 4OGEA 4YBTA 5B76A 2L0BA 1U6GB 4YATA 2M85A 2CONA 4ZDTA 2M1RA 2F6NA 2YYRA 2MA6A 4S3OB 2XB1A 5G05B 5SVIB 2XOZA 3H7HA 3VK6A 3ZTGA 1VYXA 2M6MA 4OGCA 4I7DA 4F1PA 3ZPVE 4GNGA 3RPGC 1LDKC 2K17A 1X4IA 4WA6A 2LRIC 2K1JA 2RR4A 3LQHA 2FSAA 1FBVA 3O35A 2KR4A 2YVRA 2VJFA 4YBMA 2YQLA 5LKXA 5I3LA 2KWNA 3PLWA 4FO9A 4I7BA 4IC3A 2VPDA 2JMIA 2G6QA 3T7LA 2EGMA 2MIQA 3M7KA 4MVTA 2VJEA 3LDYA 1RMDA 5TDRA 4A0CD 4BBQA 2E6SA 3SHBA 2ECTA 1MM2A 1V87A 3Q1DA 4PPEA 4QF2A 2PUYA 2QIZA 2IDAA 1MM3A 5SVXA 5KH9A 1HYJA 2LGVA 1X4JA 2YW8A 5KH3A 3HCUA 2MD8C 2RSDA 2LGLA 4QF3A 1IYMA 4FIPA 5G0FA 3O36A 2CSZA 4LADB 2C2VS 4UP0A 2EXUA 5FERA 1WILA 2ECJA 5AITA 2G43A 2VJFB 3KQIA 3V43A 2F6JA 1VFYA 3IHPA 4AP4A 2BAYA 2L43A 2G45A 2XOYA 1K2FA 5DKAA 3L11A 2VNFA 2YHOA 4O64A 1WEEA 4GNFA 4B7YC 2E6RA 2DJAA 5DINA 2OWAA 1MBMA 4WZ0A 3N9NA 1WEVA 3GV4A 3SOXA 2LN0A 1Z60A 2MNYA 5KH7A 2NAAA 5C13A 3M99A 4CA1A 3C6WA 5FB1A 2KWOA 3O34A 4MSXA 5TDWA 1CHCA 2P57A 5B78A 2JUNA 3T6RA 4Z0RA 2PNXA 3RPGB 3HTKC 2FD4A 2DX8A 4F52B 2CKLB 3ZNIA 2KE1A 2KGIA 2KWKA 2H0DA 2CT2A 5H9MA 2KFTA 5LKTA 2OXQC 1WIMA 3E2DA 2LDRA 3N9OA 3SOUA 2QICA 2XEUA 4WZ2A 1FP0A 5FEYA 3N9MA 4GNDA 4L58A 2YREA 2LQ6A 4LKAA 4O62A 3KV6A 4TKPB 4UP5A 2MUMA 2Y1NA 4P5OB 4S3OC 1F62A 1WEOA 3MHSA 2K4DA 2KKXA 2VPGA 3DDTA 4R7EA 2VPBA 1E4UA 2CRRA 2YSMA 2CRWA 3U5MA 5B75A 3DQVR 2H0DB 2KGGA 2M3HA 3L1ZB 2RI7A 3LQJA 4L7XA 1JM7A 5D1KB 2YHNA 1WEPA 1WFKA 4YAXA 4I7CA 4LJNA 1Z2QA 3N9QA 4LLBA 3LRQA 1XWHA 3ZPV1 3LVQE 1WEMA 2YQMA 3LJUX 5LCWB 2ECIA 4V3LC 4C9ZA 3GL6A 2AN6A 3I2DA 3DWDA 2VJEB 2YSJA 5H1UA 4LK9A 2KIZA 3FEHA 2JMDA 4R2YA 2FFWA 1WEWA 3O33A 1X4UA 2MA5A 3KNVA 2HYED 2ECGA 3ZVZB 3EB5A 3N9PA 2UZGA 5SVIA 3O47A 3EB6A 5FB0A 2FUIA 1JM7B 3KDEC 1T1HA 4NN2A 2M13A 2DSMA 4W4UA 4CCGX 3RTRB 4ZUXU 2VP7A 3QZVA 3M63A 2FUUA 2QJ0A 5AIUA 5TRBA 4WZ3B 4A49A 2LXPC 2KREA 2C2LA 2L5UA 5H1TA 4BHWA 5C11A 2ECNA 2YURA 4V3KC 5EYAF 2ZETC 2LGGA 1WEQA 2EGPA 3PHDA 1VD4A 2CSYA 4GB0A 5JG6A 4R8PK 4Z0OA 2JRJA 2MT5A 1JOCA 2K16A 2XOCA 5G04B 3KV5A 1WE9A 2KWJA 5B77A 4YADA 5J3XA 2LAUA 3JUEA 2HDPA 5D1MB 2JM3A 4FJCA
chains in the Genus database with same CATH topology
2IQJA 3H7HA 5SVXA 3DWDA 4QQ4A 5SVIA 3O47A 2MKEA 2XP0A 2EGMA 4O62A 4OGCA 3M7KA 3KDEC 2D8UA 2CSVA 2M13A 4F1PA 1DCQA 3LDYA 2KKYA 2XOYA 4Z0OA 2L7PA 2XOZA 3FEHA 3T9KA 2E61A 3E2DA 2B0OE 3FJUB 2KKXA 3LVRE 3Q1DA 3DDTA 4OGEA 3SUBA 2FFWA 2XOCA 2EXUA 5SVYA 3FM8C 2DJAA 2RR4A 2CRRA 2CONA 2P57A 3MDBC 2OWAA 3LVQE 5SVIB 2CRWA 2JUNA 2YVRA 3LJUX 2LAUA 4Z0RA 4H9DA 3JUEA 5K3QA 2FD4A 2JM3A 2YREA 3PLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVX A;  5SVI A;  4QQ4 A;  5SVI B;  5SVY A;  4Z0R A;  4Z0O A;  4O62 A;  2L7P A;  2RR4 A;  2E61 A; 
#chains in the Genus database with same CATH topology
 5D1L B;  2IQJ A;  2JMJ A;  2YUC A;  4FK5 A;  4YBS A;  2MKE A;  4YAB A;  3FAN A;  4AVX A;  1G25 A;  3U5N A;  3FL2 A;  4AUQ B;  4B86 C;  2L7P A;  3ZVY A;  3T9K A;  3U5O A;  5B79 A;  3FJU B;  2Y1M A;  3FM8 C;  4AYC A;  4A4B A;  2MNZ A;  3ASL A;  2ECW A;  3DPL R;  2LV9 A;  4Q6F A;  2D8U A;  1BOR A;  2L80 A;  4X3G A;  1N87 A;  3PUQ A;  1DCQ A;  2KKY A;  3LVR E;  2KU3 A;  4UI9 B;  3U5P A;  2YT5 A;  3M62 A;  3ZYQ A;  2VPE A;  2Y43 A;  3MDB C;  3FAO A;  4A4C A;  2D8S A;  2XP0 A;  2KYU A;  3LQI A;  3NG2 A;  3O70 A;  2YU4 A;  3HCT A;  1LDJ B;  3MHH A;  3O7A A;  2EA6 A;  5TBN A;  5B8D A;  4AYC B;  3SUB A;  5SVY A;  2MD7 B;  4PTB A;  5LKZ A;  2I50 A;  2F42 A;  1WGM A;  5K3Q A;  4H9D A;  2LGK A;  3C5K A;  2CKL A;  3SOW A;  4ZQL A;  5LKU A;  2CSV A;  5H1V A;  4IC2 A;  2LXH C;  4N3W A;  2B0O E;  1WES A;  4YC9 A;  1Z6U A;  3HCS A;  3O37 A;  4XI1 A;  3PUR A;  4N4F A;  1ZBD B;  1HYI A;  4QQ4 A;  5TAB A;  1DVP A;  2EOD A;  3N9L A;  2ECV A;  2L75 A;  3L1X A;  1WEN A;  4GNE A;  2E61 A;  1WEU A;  4OGE A;  4YBT A;  5B76 A;  2L0B A;  1U6G B;  4YAT A;  2M85 A;  2CON A;  4ZDT A;  2M1R A;  2F6N A;  2YYR A;  2MA6 A;  4S3O B;  2XB1 A;  5G05 B;  5SVI B;  2XOZ A;  3H7H A;  3VK6 A;  3ZTG A;  1VYX A;  2M6M A;  4OGC A;  4I7D A;  4F1P A;  3ZPV E;  4GNG A;  3RPG C;  1LDK C;  2K17 A;  1X4I A;  4WA6 A;  2LRI C;  2K1J A;  2RR4 A;  3LQH A;  2FSA A;  1FBV A;  3O35 A;  2KR4 A;  2YVR A;  2VJF A;  4YBM A;  2YQL A;  5LKX A;  5I3L A;  2KWN A;  3PLW A;  4FO9 A;  4I7B A;  4IC3 A;  2VPD A;  2JMI A;  2G6Q A;  3T7L A;  2EGM A;  2MIQ A;  3M7K A;  4MVT A;  2VJE A;  3LDY A;  1RMD A;  5TDR A;  4A0C D;  4BBQ A;  2E6S A;  3SHB A;  2ECT A;  1MM2 A;  1V87 A;  3Q1D A;  4PPE A;  4QF2 A;  2PUY A;  2QIZ A;  2IDA A;  1MM3 A;  5SVX A;  5KH9 A;  1HYJ A;  2LGV A;  1X4J A;  2YW8 A;  5KH3 A;  3HCU A;  2MD8 C;  2RSD A;  2LGL A;  4QF3 A;  1IYM A;  4FIP A;  5G0F A;  3O36 A;  2CSZ A;  4LAD B;  2C2V S;  4UP0 A;  2EXU A;  5FER A;  1WIL A;  2ECJ A;  5AIT A;  2G43 A;  2VJF B;  3KQI A;  3V43 A;  2F6J A;  1VFY A;  3IHP A;  4AP4 A;  2BAY A;  2L43 A;  2G45 A;  2XOY A;  1K2F A;  5DKA A;  3L11 A;  2VNF A;  2YHO A;  4O64 A;  1WEE A;  4GNF A;  4B7Y C;  2E6R A;  2DJA A;  5DIN A;  2OWA A;  1MBM A;  4WZ0 A;  3N9N A;  1WEV A;  3GV4 A;  3SOX A;  2LN0 A;  1Z60 A;  2MNY A;  5KH7 A;  2NAA A;  5C13 A;  3M99 A;  4CA1 A;  3C6W A;  5FB1 A;  2KWO A;  3O34 A;  4MSX A;  5TDW A;  1CHC A;  2P57 A;  5B78 A;  2JUN A;  3T6R A;  4Z0R A;  2PNX A;  3RPG B;  3HTK C;  2FD4 A;  2DX8 A;  4F52 B;  2CKL B;  3ZNI A;  2KE1 A;  2KGI A;  2KWK A;  2H0D A;  2CT2 A;  5H9M A;  2KFT A;  5LKT A;  2OXQ C;  1WIM A;  3E2D A;  2LDR A;  3N9O A;  3SOU A;  2QIC A;  2XEU A;  4WZ2 A;  1FP0 A;  5FEY A;  3N9M A;  4GND A;  4L58 A;  2YRE A;  2LQ6 A;  4LKA A;  4O62 A;  3KV6 A;  4TKP B;  4UP5 A;  2MUM A;  2Y1N A;  4P5O B;  4S3O C;  1F62 A;  1WEO A;  3MHS A;  2K4D A;  2KKX A;  2VPG A;  3DDT A;  4R7E A;  2VPB A;  1E4U A;  2CRR A;  2YSM A;  2CRW A;  3U5M A;  5B75 A;  3DQV R;  2H0D B;  2KGG A;  2M3H A;  3L1Z B;  2RI7 A;  3LQJ A;  4L7X A;  1JM7 A;  5D1K B;  2YHN A;  1WEP A;  1WFK A;  4YAX A;  4I7C A;  4LJN A;  1Z2Q A;  3N9Q A;  4LLB A;  3LRQ A;  1XWH A;  3ZPV 1;  3LVQ E;  1WEM A;  2YQM A;  3LJU X;  5LCW B;  2ECI A;  4V3L C;  4C9Z A;  3GL6 A;  2AN6 A;  3I2D A;  3DWD A;  2VJE B;  2YSJ A;  5H1U A;  4LK9 A;  2KIZ A;  3FEH A;  2JMD A;  4R2Y A;  2FFW A;  1WEW A;  3O33 A;  1X4U A;  2MA5 A;  3KNV A;  2HYE D;  2ECG A;  3ZVZ B;  3EB5 A;  3N9P A;  2UZG A;  5SVI A;  3O47 A;  3EB6 A;  5FB0 A;  2FUI A;  1JM7 B;  3KDE C;  1T1H A;  4NN2 A;  2M13 A;  2DSM A;  4W4U A;  4CCG X;  3RTR B;  4ZUX U;  2VP7 A;  3QZV A;  3M63 A;  2FUU A;  2QJ0 A;  5AIU A;  5TRB A;  4WZ3 B;  4A49 A;  2LXP C;  2KRE A;  2C2L A;  2L5U A;  5H1T A;  4BHW A;  5C11 A;  2ECN A;  2YUR A;  4V3K C;  5EYA F;  2ZET C;  2LGG A;  1WEQ A;  2EGP A;  3PHD A;  1VD4 A;  2CSY A;  4GB0 A;  5JG6 A;  4R8P K;  4Z0O A;  2JRJ A;  2MT5 A;  1JOC A;  2K16 A;  2XOC A;  5G04 B;  3KV5 A;  1WE9 A;  2KWJ A;  5B77 A;  4YAD A;  5J3X A;  2LAU A;  3JUE A;  2HDP A;  5D1M B;  2JM3 A;  4FJC A; 
#chains in the Genus database with same CATH homology
 2IQJ A;  3H7H A;  5SVX A;  3DWD A;  4QQ4 A;  5SVI A;  3O47 A;  2MKE A;  2XP0 A;  2EGM A;  4O62 A;  4OGC A;  3M7K A;  3KDE C;  2D8U A;  2CSV A;  2M13 A;  4F1P A;  1DCQ A;  3LDY A;  2KKY A;  2XOY A;  4Z0O A;  2L7P A;  2XOZ A;  3FEH A;  3T9K A;  2E61 A;  3E2D A;  2B0O E;  3FJU B;  2KKX A;  3LVR E;  3Q1D A;  3DDT A;  4OGE A;  3SUB A;  2FFW A;  2XOC A;  2EXU A;  5SVY A;  3FM8 C;  2DJA A;  2RR4 A;  2CRR A;  2CON A;  2P57 A;  3MDB C;  2OWA A;  3LVQ E;  5SVI B;  2CRW A;  2JUN A;  2YVR A;  3LJU X;  2LAU A;  4Z0R A;  4H9D A;  3JUE A;  5K3Q A;  2FD4 A;  2JM3 A;  2YRE A;  3PLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...