5SVIA

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
46
Chain Sequence
SDQTWVQCDACLKWRKLPDGMLPEKWYCSNNPDPQFRNCEVPEEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
total genus 7
structure length 46
sequence length 48
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviA00
2L7PA 4Z0OA 5SVYA 5SVXA 5SVIB 4Z0RA 4QQ4A 4O62A 5SVIA 2E61A 2RR4A
chains in the Genus database with same CATH superfamily
2QJ0A 3LRQA 4QF2A 1HYIA 4IC3A 4R7EA 5FB1A 2RSDA 1X4IA 1WEQA 2VJEB 5LKXA 3LVRE 4L58A 4ZUXU 2M13A 2YREA 3HCSA 4LK9A 2Y1MA 5SVYA 5I3LA 3QZVA 2KU3A 4BBQA 4Z0RA 2ECWA 5KH9A 2AN6A 2JMJA 4FK5A 1K2FA 4OGEA 5LKZA 1Z60A 3O47A 4GNEA 2VP7A 3T6RA 3LVQE 2VJEA 4ZQLA 4MSXA 2PNXA 1VFYA 2FUIA 2KIZA 3JUEA 1WENA 3M63A 2ZETC 5H9MA 3RPGC 3ZVZB 2CSZA 1G25A 2YURA 2K1JA 2JMIA 3M99A 2F6NA 4V3LC 4W4UA 4ZDTA 5D1MB 2Y43A 4LLBA 1Z2QA 4QQ4A 2YSMA 5B75A 4LADB 5AIUA 2JUNA 3HCTA 2LXPC 2KR4A 4MVTA 3FAOA 2L43A 3O36A 1WEWA 4IC2A 2K4DA 4I7BA 5EYAF 2E61A 3PUQA 2K16A 5C11A 2PUYA 3SUBA 2UZGA 1WEEA 4N4FA 3N9OA 2MD8C 3E2DA 5B78A 1LDKC 2C2LA 5D1KB 2QIZA 1CHCA 2VNFA 2JM3A 3ZYQA 2YQMA 4FJCA 4PPEA 2CT2A 4YBMA 5H1UA 3H7HA 3HTKC 3C5KA 3T9KA 4S3OB 4WZ3B 5LCWB 2LN0A 1VYXA 2C2VS 2D8SA 1F62A 2D8UA 2KREA 4CA1A 3KV6A 2YT5A 5TRBA 3RPGB 4F52B 1E4UA 4O62A 4GNFA 4WZ0A 1WFKA 3MHSA 5LKTA 3DQVR 4TKPB 4UP0A 1XWHA 2LQ6A 2K17A 2YSJA 4A0CD 2CRWA 3PHDA 2YW8A 2MKEA 3FL2A 2ECGA 5K3QA 3T7LA 3U5MA 2MA5A 1RMDA 1MBMA 5FEYA 2LDRA 3O34A 2KGIA 5KH3A 2CSYA 1DVPA 3I2DA 1WE9A 2M85A 3ZPV1 2XP0A 2KGGA 1JM7B 5FERA 3ZTGA 2FFWA 2MD7B 2YU4A 5FB0A 5H1TA 3EB6A 2M3HA 4Q6FA 2JMDA 3LDYA 2LGGA 5G04B 2KFTA 4GNDA 3SOXA 2QICA 2MIQA 4CCGX 2OWAA 2XOYA 2ECJA 5C13A 1T1HA 4LKAA 3ZPVE 3L1ZB 3EB5A 2OXQC 2VPDA 2VPBA 2IDAA 3O70A 4PTBA 2E6RA 3N9LA 2L75A 2P57A 1VD4A 2FUUA 2CKLA 2VPGA 3SHBA 3KV5A 4FIPA 3GL6A 5G0FA 3NG2A 5G05B 3FEHA 3U5NA 4R8PK 2RI7A 3N9NA 3ZNIA 1X4JA 2MA6A 2Y1NA 3N9PA 4BHWA 2CKLB 3O7AA 1WEOA 2LGKA 2XB1A 2HDPA 1IYMA 2LGLA 1JM7A 2LV9A 4B7YC 5DINA 4YC9A 1WEVA 1WESA 3GV4A 4AP4A 2ECVA 3ZVYA 3L11A 2YHOA 3SOWA 4FO9A 2E6SA 2H0DA 2EODA 5J3XA 2FD4A 4S3OC 4X3GA 2F6JA 1N87A 4UI9B 2LGVA 3V43A 5SVIA 1X4UA 2KYUA 4QF3A 1Z6UA 4R2YA 3LQJA 4A4CA 4UP5A 2YYRA 3O33A 3Q1DA 4AVXA 3PLWA 1BORA 4YAXA 4LJNA 2VJFB 3DDTA 1FBVA 4F1PA 2G43A 2ECNA 2L0BA 3VK6A 1V87A 4YBSA 5TABA 5B79A 4A4BA 3U5OA 4L7XA 4I7CA 4B86C 3DWDA 3M62A 4P5OB 2ECIA 2MUMA 3LQHA 5B8DA 4Z0OA 4AUQB 4I7DA 2H0DB 2HYED 4NN2A 2LAUA 4N3WA 2KKXA 2MNZA 4YADA 3U5PA 4AYCA 2MT5A 3FJUB 2EGPA 4GNGA 4YBTA 4H9DA 5B77A 3FM8C 3LQIA 2XOZA 2DJAA 2XOCA 3O37A 5DKAA 4O64A 2EGMA 3FANA 2I50A 2DSMA 4V3KC 2KWOA 2YVRA 1WEUA 4AYCB 4WZ2A 2LXHC 3KNVA 2B0OE 4YABA 3SOUA 4XI1A 2G45A 2EXUA 5LKUA 2LRIC 2G6QA 5B76A 3M7KA 1WGMA 1WEPA 2M6MA 2FSAA 2YUCA 5SVIB 3HCUA 2YQLA 1FP0A 1JOCA 2ECTA 2CONA 1WIMA 2RR4A 1WEMA 3IHPA 5H1VA 2JRJA 3PURA 4GB0A 3MDBC 1MM2A 3O35A 2KWNA 2KKYA 2L5UA 3N9QA 3RTRB 3ASLA 1LDJB 1U6GB 1MM3A 3LJUX 2NAAA 3C6WA 2L80A 3MHHA 4OGCA 2EA6A 4C9ZA 5TDRA 3L1XA 2L7PA 5D1LB 2KWKA 4A49A 2KWJA 3KQIA 1ZBDB 4WA6A 2DX8A 5JG6A 2CSVA 5SVXA 2YHNA 3N9MA 1HYJA 5TDWA 2F42A 1DCQA 2M1RA 2XEUA 5KH7A 3KDEC 5AITA 3DPLR 2MNYA 2CRRA 2VPEA 4YATA 2BAYA 5TBNA 2VJFA 2KE1A 1WILA 2IQJA
chains in the Genus database with same CATH topology
3Q1DA 3SUBA 3T9KA 2CRWA 3PLWA 2CSVA 5SVXA 2B0OE 4Z0RA 2CONA 3FJUB 4QQ4A 2MKEA 4OGEA 2FD4A 2EXUA 5K3QA 3MDBC 2D8UA 3LDYA 3E2DA 3DDTA 3DWDA 3O47A 2KKYA 4H9DA 4F1PA 3LVQE 3M7KA 3FM8C 5SVIA 2JM3A 2XOZA 2P57A 2DJAA 3LVRE 2XOCA 2JUNA 3LJUX 2EGMA 5SVIB 1DCQA 3JUEA 2M13A 3KDEC 4O62A 2YREA 4Z0OA 2XP0A 4OGCA 2OWAA 3FEHA 2CRRA 2XOYA 2L7PA 2FFWA 5SVYA 2LAUA 3H7HA 2YVRA 2KKXA 2E61A 2RR4A 2IQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  4Z0O A;  5SVY A;  5SVX A;  5SVI B;  4Z0R A;  4QQ4 A;  4O62 A;  5SVI A;  2E61 A;  2RR4 A; 
#chains in the Genus database with same CATH topology
 2QJ0 A;  3LRQ A;  4QF2 A;  1HYI A;  4IC3 A;  4R7E A;  5FB1 A;  2RSD A;  1X4I A;  1WEQ A;  2VJE B;  5LKX A;  3LVR E;  4L58 A;  4ZUX U;  2M13 A;  2YRE A;  3HCS A;  4LK9 A;  2Y1M A;  5SVY A;  5I3L A;  3QZV A;  2KU3 A;  4BBQ A;  4Z0R A;  2ECW A;  5KH9 A;  2AN6 A;  2JMJ A;  4FK5 A;  1K2F A;  4OGE A;  5LKZ A;  1Z60 A;  3O47 A;  4GNE A;  2VP7 A;  3T6R A;  3LVQ E;  2VJE A;  4ZQL A;  4MSX A;  2PNX A;  1VFY A;  2FUI A;  2KIZ A;  3JUE A;  1WEN A;  3M63 A;  2ZET C;  5H9M A;  3RPG C;  3ZVZ B;  2CSZ A;  1G25 A;  2YUR A;  2K1J A;  2JMI A;  3M99 A;  2F6N A;  4V3L C;  4W4U A;  4ZDT A;  5D1M B;  2Y43 A;  4LLB A;  1Z2Q A;  4QQ4 A;  2YSM A;  5B75 A;  4LAD B;  5AIU A;  2JUN A;  3HCT A;  2LXP C;  2KR4 A;  4MVT A;  3FAO A;  2L43 A;  3O36 A;  1WEW A;  4IC2 A;  2K4D A;  4I7B A;  5EYA F;  2E61 A;  3PUQ A;  2K16 A;  5C11 A;  2PUY A;  3SUB A;  2UZG A;  1WEE A;  4N4F A;  3N9O A;  2MD8 C;  3E2D A;  5B78 A;  1LDK C;  2C2L A;  5D1K B;  2QIZ A;  1CHC A;  2VNF A;  2JM3 A;  3ZYQ A;  2YQM A;  4FJC A;  4PPE A;  2CT2 A;  4YBM A;  5H1U A;  3H7H A;  3HTK C;  3C5K A;  3T9K A;  4S3O B;  4WZ3 B;  5LCW B;  2LN0 A;  1VYX A;  2C2V S;  2D8S A;  1F62 A;  2D8U A;  2KRE A;  4CA1 A;  3KV6 A;  2YT5 A;  5TRB A;  3RPG B;  4F52 B;  1E4U A;  4O62 A;  4GNF A;  4WZ0 A;  1WFK A;  3MHS A;  5LKT A;  3DQV R;  4TKP B;  4UP0 A;  1XWH A;  2LQ6 A;  2K17 A;  2YSJ A;  4A0C D;  2CRW A;  3PHD A;  2YW8 A;  2MKE A;  3FL2 A;  2ECG A;  5K3Q A;  3T7L A;  3U5M A;  2MA5 A;  1RMD A;  1MBM A;  5FEY A;  2LDR A;  3O34 A;  2KGI A;  5KH3 A;  2CSY A;  1DVP A;  3I2D A;  1WE9 A;  2M85 A;  3ZPV 1;  2XP0 A;  2KGG A;  1JM7 B;  5FER A;  3ZTG A;  2FFW A;  2MD7 B;  2YU4 A;  5FB0 A;  5H1T A;  3EB6 A;  2M3H A;  4Q6F A;  2JMD A;  3LDY A;  2LGG A;  5G04 B;  2KFT A;  4GND A;  3SOX A;  2QIC A;  2MIQ A;  4CCG X;  2OWA A;  2XOY A;  2ECJ A;  5C13 A;  1T1H A;  4LKA A;  3ZPV E;  3L1Z B;  3EB5 A;  2OXQ C;  2VPD A;  2VPB A;  2IDA A;  3O70 A;  4PTB A;  2E6R A;  3N9L A;  2L75 A;  2P57 A;  1VD4 A;  2FUU A;  2CKL A;  2VPG A;  3SHB A;  3KV5 A;  4FIP A;  3GL6 A;  5G0F A;  3NG2 A;  5G05 B;  3FEH A;  3U5N A;  4R8P K;  2RI7 A;  3N9N A;  3ZNI A;  1X4J A;  2MA6 A;  2Y1N A;  3N9P A;  4BHW A;  2CKL B;  3O7A A;  1WEO A;  2LGK A;  2XB1 A;  2HDP A;  1IYM A;  2LGL A;  1JM7 A;  2LV9 A;  4B7Y C;  5DIN A;  4YC9 A;  1WEV A;  1WES A;  3GV4 A;  4AP4 A;  2ECV A;  3ZVY A;  3L11 A;  2YHO A;  3SOW A;  4FO9 A;  2E6S A;  2H0D A;  2EOD A;  5J3X A;  2FD4 A;  4S3O C;  4X3G A;  2F6J A;  1N87 A;  4UI9 B;  2LGV A;  3V43 A;  5SVI A;  1X4U A;  2KYU A;  4QF3 A;  1Z6U A;  4R2Y A;  3LQJ A;  4A4C A;  4UP5 A;  2YYR A;  3O33 A;  3Q1D A;  4AVX A;  3PLW A;  1BOR A;  4YAX A;  4LJN A;  2VJF B;  3DDT A;  1FBV A;  4F1P A;  2G43 A;  2ECN A;  2L0B A;  3VK6 A;  1V87 A;  4YBS A;  5TAB A;  5B79 A;  4A4B A;  3U5O A;  4L7X A;  4I7C A;  4B86 C;  3DWD A;  3M62 A;  4P5O B;  2ECI A;  2MUM A;  3LQH A;  5B8D A;  4Z0O A;  4AUQ B;  4I7D A;  2H0D B;  2HYE D;  4NN2 A;  2LAU A;  4N3W A;  2KKX A;  2MNZ A;  4YAD A;  3U5P A;  4AYC A;  2MT5 A;  3FJU B;  2EGP A;  4GNG A;  4YBT A;  4H9D A;  5B77 A;  3FM8 C;  3LQI A;  2XOZ A;  2DJA A;  2XOC A;  3O37 A;  5DKA A;  4O64 A;  2EGM A;  3FAN A;  2I50 A;  2DSM A;  4V3K C;  2KWO A;  2YVR A;  1WEU A;  4AYC B;  4WZ2 A;  2LXH C;  3KNV A;  2B0O E;  4YAB A;  3SOU A;  4XI1 A;  2G45 A;  2EXU A;  5LKU A;  2LRI C;  2G6Q A;  5B76 A;  3M7K A;  1WGM A;  1WEP A;  2M6M A;  2FSA A;  2YUC A;  5SVI B;  3HCU A;  2YQL A;  1FP0 A;  1JOC A;  2ECT A;  2CON A;  1WIM A;  2RR4 A;  1WEM A;  3IHP A;  5H1V A;  2JRJ A;  3PUR A;  4GB0 A;  3MDB C;  1MM2 A;  3O35 A;  2KWN A;  2KKY A;  2L5U A;  3N9Q A;  3RTR B;  3ASL A;  1LDJ B;  1U6G B;  1MM3 A;  3LJU X;  2NAA A;  3C6W A;  2L80 A;  3MHH A;  4OGC A;  2EA6 A;  4C9Z A;  5TDR A;  3L1X A;  2L7P A;  5D1L B;  2KWK A;  4A49 A;  2KWJ A;  3KQI A;  1ZBD B;  4WA6 A;  2DX8 A;  5JG6 A;  2CSV A;  5SVX A;  2YHN A;  3N9M A;  1HYJ A;  5TDW A;  2F42 A;  1DCQ A;  2M1R A;  2XEU A;  5KH7 A;  3KDE C;  5AIT A;  3DPL R;  2MNY A;  2CRR A;  2VPE A;  4YAT A;  2BAY A;  5TBN A;  2VJF A;  2KE1 A;  1WIL A;  2IQJ A; 
#chains in the Genus database with same CATH homology
 3Q1D A;  3SUB A;  3T9K A;  2CRW A;  3PLW A;  2CSV A;  5SVX A;  2B0O E;  4Z0R A;  2CON A;  3FJU B;  4QQ4 A;  2MKE A;  4OGE A;  2FD4 A;  2EXU A;  5K3Q A;  3MDB C;  2D8U A;  3LDY A;  3E2D A;  3DDT A;  3DWD A;  3O47 A;  2KKY A;  4H9D A;  4F1P A;  3LVQ E;  3M7K A;  3FM8 C;  5SVI A;  2JM3 A;  2XOZ A;  2P57 A;  2DJA A;  3LVR E;  2XOC A;  2JUN A;  3LJU X;  2EGM A;  5SVI B;  1DCQ A;  3JUE A;  2M13 A;  3KDE C;  4O62 A;  2YRE A;  4Z0O A;  2XP0 A;  4OGC A;  2OWA A;  3FEH A;  2CRR A;  2XOY A;  2L7P A;  2FFW A;  5SVY A;  2LAU A;  3H7H A;  2YVR A;  2KKX A;  2E61 A;  2RR4 A;  2IQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...