5SVIA

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
46
Chain Sequence
SDQTWVQCDACLKWRKLPDGMLPEKWYCSNNPDPQFRNCEVPEEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 48
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviA00
4O62A 4Z0RA 5SVXA 2RR4A 2L7PA 5SVIA 2E61A 5SVYA 5SVIB 4QQ4A 4Z0OA
chains in the Genus database with same CATH superfamily
4QF3A 2EGMA 5TBNA 3ZVZB 4WA6A 2QJ0A 4FK5A 2VJEB 1G25A 3IHPA 2L7PA 5SVIA 2RI7A 1N87A 1MBMA 2LGVA 2YUCA 2YYRA 2JMIA 3U5MA 3N9PA 2CRWA 2JM3A 5TRBA 3EB6A 2VPBA 2KGGA 3GV4A 1WE9A 2ECGA 3DQVR 4MVTA 1FBVA 4LADB 1WEEA 2VPDA 2MA5A 2L80A 4XI1A 3FAOA 2ECIA 1K2FA 5FB1A 1HYIA 2XOYA 2JMJA 3FEHA 4P5OB 3T9KA 1MM2A 3MHHA 4H9DA 1U6GB 3GL6A 3LQHA 4F52B 2C2VS 4CA1A 5B77A 4YC9A 3LDYA 2MD7B 4N3WA 5TDWA 2Y1MA 2CSVA 2UZGA 3E2DA 2M1RA 4NN2A 3NG2A 4FJCA 4UP0A 3I2DA 4B7YC 2G43A 3H7HA 2KGIA 5JG6A 3SUBA 5B78A 3PHDA 5J3XA 2MKEA 2BAYA 4GNEA 1V87A 2RR4A 4GB0A 1E4UA 4BHWA 2ECJA 2L43A 5LKZA 4ZUXU 2YQLA 3L1XA 4WZ3B 4S3OC 3SOWA 2HDPA 4R7EA 4GNGA 2DJAA 4YAXA 5LCWB 4YBSA 3C5KA 3MHSA 5I3LA 3ZPV1 3JUEA 2CT2A 2LXPC 2YU4A 3ZYQA 5C13A 2E6RA 5DKAA 1VYXA 2F6JA 4Z0RA 3O37A 3C6WA 4A4BA 2E61A 3O33A 2YSJA 5H9MA 2KYUA 2H0DB 2K17A 4I7DA 2M85A 2G6QA 3ZTGA 2KWJA 2Y1NA 1JM7B 4V3KC 3U5OA 2CSZA 2K16A 3SHBA 2EA6A 4PPEA 2KKYA 4TKPB 4QQ4A 3HTKC 5AITA 1LDJB 2KWKA 2MUMA 4OGEA 4N4FA 4OGCA 3HCUA 4AYCA 4ZQLA 2LAUA 3KV5A 5AIUA 5H1VA 2VJFA 5KH9A 4Z0OA 1DVPA 3N9QA 3M99A 2LXHC 5LKXA 1Z2QA 2CKLA 2MT5A 5G04B 1WEOA 4A4CA 3LVQE 3ZVYA 3N9NA 3PUQA 2KKXA 3O34A 3QZVA 4C9ZA 3ZPVE 2MNZA 1WEQA 4W4UA 4YBTA 3RTRB 2MIQA 2B0OE 5KH3A 2DX8A 2QIZA 3KDEC 3LJUX 4YATA 5SVIB 3O47A 2PUYA 1Z6UA 2VPGA 3U5NA 2P57A 2LGKA 1WEPA 2MNYA 4WZ0A 3M7KA 2F42A 3O36A 3FM8C 2JUNA 2LGLA 2LDRA 4QF2A 3L1ZB 2LGGA 4MSXA 2MD8C 2XOZA 4I7BA 3RPGB 2FUIA 2VPEA 2ZETC 1WILA 2HYED 2YURA 2L0BA 4L7XA 3DPLR 4UI9B 5FEYA 1X4UA 2ECVA 5FB0A 3KNVA 2CRRA 1CHCA 4LJNA 1MM3A 3KV6A 2IDAA 1WENA 4BBQA 4O64A 2OXQC 2M3HA 4S3OB 2XOCA 1WEUA 3T6RA 2IQJA 3ZNIA 2LQ6A 3FL2A 1ZBDB 5EYAF 3LRQA 3LQJA 4CCGX 2JMDA 2D8UA 4IC3A 4YADA 5DINA 2L5UA 1WFKA 2KWNA 2OWAA 2M13A 3MDBC 3N9LA 4V3LC 5TABA 3O7AA 4I7CA 5KH7A 1T1HA 3EB5A 2ECNA 2FUUA 3HCTA 4GNDA 5G0FA 4YBMA 4YABA 2YVRA 5D1LB 5B75A 3FJUB 1FP0A 4AP4A 2RSDA 2I50A 2KWOA 2KE1A 4R8PK 2XEUA 2YT5A 4B86C 1XWHA 2PNXA 3L11A 4F1PA 2C2LA 4UP5A 2K4DA 4ZDTA 3ASLA 3KQIA 3U5PA 5C11A 5G05B 1VD4A 3M63A 1JOCA 4O62A 2FD4A 2D8SA 5B79A 1WEMA 1HYJA 2CSYA 4FO9A 5SVXA 2AN6A 4FIPA 4R2YA 4LLBA 1IYMA 3DDTA 2G45A 2M6MA 2Y43A 5B76A 3PURA 2ECWA 2LRIC 3FANA 4A49A 3M62A 4PTBA 1X4IA 2KFTA 4LKAA 3SOUA 1WEVA 4AYCB 2VP7A 2VJFB 5H1TA 5D1MB 2KREA 5TDRA 3LQIA 3V43A 2YSMA 2KU3A 3PLWA 3T7LA 2XB1A 2CONA 3Q1DA 1VFYA 2CKLB 2JRJA 2KIZA 2LN0A 1WIMA 1LDKC 5FERA 3N9OA 2YW8A 2YQMA 3O35A 2K1JA 2H0DA 2KR4A 3RPGC 5H1UA 3LVRE 1JM7A 2VNFA 2YHNA 1RMDA 3SOXA 2XP0A 1WESA 2EODA 2VJEA 1F62A 2NAAA 2YREA 5SVYA 3VK6A 5LKUA 1X4JA 2FSAA 4Q6FA 3DWDA 3O70A 2FFWA 4L58A 4LK9A 1BORA 5D1KB 1DCQA 2DSMA 4AUQB 2EXUA 2ECTA 2E6SA 1WEWA 2L75A 5LKTA 2QICA 1Z60A 4AVXA 4GNFA 2LV9A 5B8DA 5K3QA 3N9MA 4X3GA 1WGMA 2YHOA 3HCSA 4A0CD 2EGPA 4IC2A 4WZ2A 2F6NA 2MA6A
chains in the Genus database with same CATH topology
3M7KA 2FFWA 4OGCA 2KKXA 3FM8C 5SVXA 2EGMA 2JUNA 2OWAA 2LAUA 3H7HA 2CRRA 2DJAA 2M13A 3MDBC 1DCQA 3LVRE 3SUBA 4Z0OA 3DDTA 4F1PA 3LDYA 2EXUA 3JUEA 2XOCA 3PLWA 2MKEA 2IQJA 2XP0A 2CSVA 2B0OE 2CONA 2XOZA 3Q1DA 2RR4A 3E2DA 3KDEC 2YREA 2L7PA 3LJUX 5SVIA 2KKYA 5SVYA 5SVIB 3O47A 4QQ4A 2XOYA 2P57A 5K3QA 2YVRA 4O62A 2FD4A 4Z0RA 3LVQE 3FEHA 3FJUB 2E61A 3T9KA 4OGEA 4H9DA 2JM3A 2D8UA 3DWDA 2CRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O62 A;  4Z0R A;  5SVX A;  2RR4 A;  2L7P A;  5SVI A;  2E61 A;  5SVY A;  5SVI B;  4QQ4 A;  4Z0O A; 
#chains in the Genus database with same CATH topology
 4QF3 A;  2EGM A;  5TBN A;  3ZVZ B;  4WA6 A;  2QJ0 A;  4FK5 A;  2VJE B;  1G25 A;  3IHP A;  2L7P A;  5SVI A;  2RI7 A;  1N87 A;  1MBM A;  2LGV A;  2YUC A;  2YYR A;  2JMI A;  3U5M A;  3N9P A;  2CRW A;  2JM3 A;  5TRB A;  3EB6 A;  2VPB A;  2KGG A;  3GV4 A;  1WE9 A;  2ECG A;  3DQV R;  4MVT A;  1FBV A;  4LAD B;  1WEE A;  2VPD A;  2MA5 A;  2L80 A;  4XI1 A;  3FAO A;  2ECI A;  1K2F A;  5FB1 A;  1HYI A;  2XOY A;  2JMJ A;  3FEH A;  4P5O B;  3T9K A;  1MM2 A;  3MHH A;  4H9D A;  1U6G B;  3GL6 A;  3LQH A;  4F52 B;  2C2V S;  4CA1 A;  5B77 A;  4YC9 A;  3LDY A;  2MD7 B;  4N3W A;  5TDW A;  2Y1M A;  2CSV A;  2UZG A;  3E2D A;  2M1R A;  4NN2 A;  3NG2 A;  4FJC A;  4UP0 A;  3I2D A;  4B7Y C;  2G43 A;  3H7H A;  2KGI A;  5JG6 A;  3SUB A;  5B78 A;  3PHD A;  5J3X A;  2MKE A;  2BAY A;  4GNE A;  1V87 A;  2RR4 A;  4GB0 A;  1E4U A;  4BHW A;  2ECJ A;  2L43 A;  5LKZ A;  4ZUX U;  2YQL A;  3L1X A;  4WZ3 B;  4S3O C;  3SOW A;  2HDP A;  4R7E A;  4GNG A;  2DJA A;  4YAX A;  5LCW B;  4YBS A;  3C5K A;  3MHS A;  5I3L A;  3ZPV 1;  3JUE A;  2CT2 A;  2LXP C;  2YU4 A;  3ZYQ A;  5C13 A;  2E6R A;  5DKA A;  1VYX A;  2F6J A;  4Z0R A;  3O37 A;  3C6W A;  4A4B A;  2E61 A;  3O33 A;  2YSJ A;  5H9M A;  2KYU A;  2H0D B;  2K17 A;  4I7D A;  2M85 A;  2G6Q A;  3ZTG A;  2KWJ A;  2Y1N A;  1JM7 B;  4V3K C;  3U5O A;  2CSZ A;  2K16 A;  3SHB A;  2EA6 A;  4PPE A;  2KKY A;  4TKP B;  4QQ4 A;  3HTK C;  5AIT A;  1LDJ B;  2KWK A;  2MUM A;  4OGE A;  4N4F A;  4OGC A;  3HCU A;  4AYC A;  4ZQL A;  2LAU A;  3KV5 A;  5AIU A;  5H1V A;  2VJF A;  5KH9 A;  4Z0O A;  1DVP A;  3N9Q A;  3M99 A;  2LXH C;  5LKX A;  1Z2Q A;  2CKL A;  2MT5 A;  5G04 B;  1WEO A;  4A4C A;  3LVQ E;  3ZVY A;  3N9N A;  3PUQ A;  2KKX A;  3O34 A;  3QZV A;  4C9Z A;  3ZPV E;  2MNZ A;  1WEQ A;  4W4U A;  4YBT A;  3RTR B;  2MIQ A;  2B0O E;  5KH3 A;  2DX8 A;  2QIZ A;  3KDE C;  3LJU X;  4YAT A;  5SVI B;  3O47 A;  2PUY A;  1Z6U A;  2VPG A;  3U5N A;  2P57 A;  2LGK A;  1WEP A;  2MNY A;  4WZ0 A;  3M7K A;  2F42 A;  3O36 A;  3FM8 C;  2JUN A;  2LGL A;  2LDR A;  4QF2 A;  3L1Z B;  2LGG A;  4MSX A;  2MD8 C;  2XOZ A;  4I7B A;  3RPG B;  2FUI A;  2VPE A;  2ZET C;  1WIL A;  2HYE D;  2YUR A;  2L0B A;  4L7X A;  3DPL R;  4UI9 B;  5FEY A;  1X4U A;  2ECV A;  5FB0 A;  3KNV A;  2CRR A;  1CHC A;  4LJN A;  1MM3 A;  3KV6 A;  2IDA A;  1WEN A;  4BBQ A;  4O64 A;  2OXQ C;  2M3H A;  4S3O B;  2XOC A;  1WEU A;  3T6R A;  2IQJ A;  3ZNI A;  2LQ6 A;  3FL2 A;  1ZBD B;  5EYA F;  3LRQ A;  3LQJ A;  4CCG X;  2JMD A;  2D8U A;  4IC3 A;  4YAD A;  5DIN A;  2L5U A;  1WFK A;  2KWN A;  2OWA A;  2M13 A;  3MDB C;  3N9L A;  4V3L C;  5TAB A;  3O7A A;  4I7C A;  5KH7 A;  1T1H A;  3EB5 A;  2ECN A;  2FUU A;  3HCT A;  4GND A;  5G0F A;  4YBM A;  4YAB A;  2YVR A;  5D1L B;  5B75 A;  3FJU B;  1FP0 A;  4AP4 A;  2RSD A;  2I50 A;  2KWO A;  2KE1 A;  4R8P K;  2XEU A;  2YT5 A;  4B86 C;  1XWH A;  2PNX A;  3L11 A;  4F1P A;  2C2L A;  4UP5 A;  2K4D A;  4ZDT A;  3ASL A;  3KQI A;  3U5P A;  5C11 A;  5G05 B;  1VD4 A;  3M63 A;  1JOC A;  4O62 A;  2FD4 A;  2D8S A;  5B79 A;  1WEM A;  1HYJ A;  2CSY A;  4FO9 A;  5SVX A;  2AN6 A;  4FIP A;  4R2Y A;  4LLB A;  1IYM A;  3DDT A;  2G45 A;  2M6M A;  2Y43 A;  5B76 A;  3PUR A;  2ECW A;  2LRI C;  3FAN A;  4A49 A;  3M62 A;  4PTB A;  1X4I A;  2KFT A;  4LKA A;  3SOU A;  1WEV A;  4AYC B;  2VP7 A;  2VJF B;  5H1T A;  5D1M B;  2KRE A;  5TDR A;  3LQI A;  3V43 A;  2YSM A;  2KU3 A;  3PLW A;  3T7L A;  2XB1 A;  2CON A;  3Q1D A;  1VFY A;  2CKL B;  2JRJ A;  2KIZ A;  2LN0 A;  1WIM A;  1LDK C;  5FER A;  3N9O A;  2YW8 A;  2YQM A;  3O35 A;  2K1J A;  2H0D A;  2KR4 A;  3RPG C;  5H1U A;  3LVR E;  1JM7 A;  2VNF A;  2YHN A;  1RMD A;  3SOX A;  2XP0 A;  1WES A;  2EOD A;  2VJE A;  1F62 A;  2NAA A;  2YRE A;  5SVY A;  3VK6 A;  5LKU A;  1X4J A;  2FSA A;  4Q6F A;  3DWD A;  3O70 A;  2FFW A;  4L58 A;  4LK9 A;  1BOR A;  5D1K B;  1DCQ A;  2DSM A;  4AUQ B;  2EXU A;  2ECT A;  2E6S A;  1WEW A;  2L75 A;  5LKT A;  2QIC A;  1Z60 A;  4AVX A;  4GNF A;  2LV9 A;  5B8D A;  5K3Q A;  3N9M A;  4X3G A;  1WGM A;  2YHO A;  3HCS A;  4A0C D;  2EGP A;  4IC2 A;  4WZ2 A;  2F6N A;  2MA6 A; 
#chains in the Genus database with same CATH homology
 3M7K A;  2FFW A;  4OGC A;  2KKX A;  3FM8 C;  5SVX A;  2EGM A;  2JUN A;  2OWA A;  2LAU A;  3H7H A;  2CRR A;  2DJA A;  2M13 A;  3MDB C;  1DCQ A;  3LVR E;  3SUB A;  4Z0O A;  3DDT A;  4F1P A;  3LDY A;  2EXU A;  3JUE A;  2XOC A;  3PLW A;  2MKE A;  2IQJ A;  2XP0 A;  2CSV A;  2B0O E;  2CON A;  2XOZ A;  3Q1D A;  2RR4 A;  3E2D A;  3KDE C;  2YRE A;  2L7P A;  3LJU X;  5SVI A;  2KKY A;  5SVY A;  5SVI B;  3O47 A;  4QQ4 A;  2XOY A;  2P57 A;  5K3Q A;  2YVR A;  4O62 A;  2FD4 A;  4Z0R A;  3LVQ E;  3FEH A;  3FJU B;  2E61 A;  3T9K A;  4OGE A;  4H9D A;  2JM3 A;  2D8U A;  3DWD A;  2CRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...