2FD4A

Crystal structure of avrptob (436-553)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
105
Chain Sequence
KLAALDPIASQFSQLRTISKALGFKDAADDVTHCLFGGELSLSNPDQQVIGLAGNPTDTSQPYSDLAFMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A bacterial inhibitor of host programmed cell death defenses is an E3 ubiquitin ligase.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Ligase
molecule keywords avirulence protein AvrptoB
total genus 23
structure length 105
sequence length 120
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.110 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2fd4A00
2FD4A
chains in the Genus database with same CATH superfamily
4UP0A 2LAUA 3N9LA 4NN2A 3GL6A 5SVIB 2VPGA 4AYCA 3SOXA 3O34A 2KKYA 3LDYA 2YREA 3QZVA 2VJFB 2VJFA 2PUYA 4GNGA 1WEPA 2LXHC 3IHPA 1U6GB 2VJEA 2KKXA 5AIUA 2VJEB 2DJAA 2M6MA 2EXUA 1X4UA 4I7CA 2JMIA 1WEUA 5EYAF 4TKPB 4L7XA 4B86C 1CHCA 4IC2A 2LDRA 2LRIC 2YU4A 3LVRE 4Q6FA 3T9KA 3ZTGA 5G04B 3SHBA 2MUMA 1DCQA 5TRBA 2L0BA 2ECIA 4V3LC 2M3HA 2YHOA 2MKEA 4R8PK 2YW8A 1RMDA 2MD7B 2VPEA 2EGPA 3C5KA 3RPGB 5TDRA 5FERA 3T7LA 2FSAA 2KWOA 2OWAA 5J3XA 3RPGC 3DDTA 2YURA 2F6JA 3U5NA 3ZPV1 4CA1A 3ZVZB 2LXPC 1F62A 2L5UA 2KE1A 5D1LB 4WZ2A 2P57A 1VD4A 5KH9A 2QIZA 4LJNA 1G25A 3MHSA 3O33A 2LGLA 2XB1A 3KQIA 1DVPA 3SUBA 3L1XA 5FB1A 4O62A 1X4IA 3HTKC 5JG6A 2C2VS 1K2FA 3EB6A 1WILA 4CCGX 3ASLA 4F52B 2FD4A 4YAXA 2JMDA 5K3QA 2Y1NA 4LK9A 3O47A 1WEOA 5TBNA 4MSXA 2MNZA 2VPDA 3DQVR 3O35A 4YADA 2AN6A 2L7PA 4FJCA 4S3OC 3ZPVE 2K17A 3HCSA 2B0OE 4I7BA 2QJ0A 4YBTA 3ZNIA 4LLBA 1MM3A 3N9QA 4I7DA 4BHWA 5H1TA 2ECVA 2K16A 4FIPA 3M99A 2PNXA 3PURA 2H0DB 3DWDA 4N4FA 2ECWA 2VNFA 1MBMA 5B75A 2CKLA 2CRWA 2CSYA 3M62A 2JRJA 2ECJA 2CRRA 1WIMA 2K4DA 1JM7B 4GNDA 1JM7A 4S3OB 4Z0RA 2LV9A 3GV4A 4PTBA 3LVQE 5SVIA 4AYCB 2E6RA 5FB0A 2FFWA 1FP0A 2EODA 3JUEA 4FO9A 1WEWA 4IC3A 3LJUX 2LN0A 4GNEA 5KH3A 4YC9A 4R7EA 3KDEC 2F42A 2FUIA 1T1HA 2YVRA 1VYXA 4OGCA 3U5OA 1WEEA 2YT5A 2DX8A 5G0FA 3ZVYA 1WGMA 4W4UA 1VFYA 5H9MA 2KR4A 3N9OA 2OXQC 4GB0A 1WEVA 4A4BA 2XEUA 2NAAA 3FANA 2H0DA 2EGMA 2L43A 4AUQB 2M1RA 2VP7A 4O64A 2VPBA 2CSVA 2YQLA 2ECGA 3NG2A 2G43A 3HCUA 2LQ6A 2HDPA 2BAYA 2C2LA 3KV6A 2QICA 4LADB 2JUNA 4ZUXU 2RI7A 4UP5A 1FBVA 3L1ZB 2UZGA 4F1PA 5C13A 2ECNA 2XP0A 5FEYA 2MNYA 1WFKA 2I50A 4QF2A 4GNFA 3I2DA 5D1MB 3V43A 2KU3A 2ZETC 2M13A 1Z60A 2CT2A 1WESA 1HYIA 4UI9B 5H1UA 4H9DA 3O7AA 3L11A 3LRQA 2KYUA 2Y1MA 4L58A 3PUQA 4YATA 1HYJA 2EA6A 3FEHA 2M85A 3O70A 3SOWA 2YYRA 4AP4A 4WZ0A 3Q1DA 5B8DA 2KWKA 3FJUB 2D8SA 3SOUA 2G45A 5TDWA 2MA6A 5LKTA 5D1KB 4MVTA 3EB5A 2E6SA 2KWNA 3H7HA 1XWHA 4X3GA 1Z2QA 3O37A 3M63A 1Z6UA 4PPEA 2KREA 4B7YC 4AVXA 2YSJA 2DSMA 5DKAA 2MT5A 2YUCA 2XOCA 2ECTA 3ZYQA 4A4CA 3KV5A 2CONA 4OGEA 4A0CD 2JMJA 2E61A 1E4UA 3N9NA 2KWJA 2K1JA 5B76A 2YQMA 2IQJA 2XOZA 5DINA 3PLWA 3M7KA 1WENA 2Y43A 5SVXA 5LKXA 2YHNA 3PHDA 2MIQA 5LKUA 3U5MA 5AITA 3DPLR 3KNVA 2L75A 5B77A 3LQIA 4V3KC 4LKAA 3C6WA 3FM8C 2LGVA 4XI1A 4BBQA 3LQJA 2XOYA 5B79A 2L80A 4N3WA 2LGGA 2F6NA 3N9MA 1BORA 1WEMA 2RSDA 3E2DA 1LDJB 2LGKA 5I3LA 4P5OB 2G6QA 3RTRB 4ZDTA 3VK6A 3MHHA 2RR4A 1X4JA 5H1VA 2KIZA 1WEQA 5C11A 3T6RA 2IDAA 1N87A 3MDBC 2MD8C 4YBMA 4QF3A 4ZQLA 1IYMA 1V87A 4A49A 1LDKC 1JOCA 1MM2A 4Z0OA 2YSMA 4R2YA 1ZBDB 5TABA 2KGIA 4C9ZA 4YABA 3FAOA 3LQHA 4WA6A 2KFTA 5LKZA 2JM3A 4FK5A 5G05B 2KGGA 3HCTA 4QQ4A 5KH7A 4YBSA 5B78A 2CSZA 3O36A 3N9PA 2CKLB 2D8UA 2FUUA 5SVYA 2MA5A 4WZ3B 3FL2A 5LCWB 3U5PA 2HYED 1WE9A
chains in the Genus database with same CATH topology
2E61A 2MKEA 2P57A 3FM8C 4OGCA 2LAUA 2JM3A 2YVRA 2XOYA 4Z0RA 4QQ4A 2M13A 5K3QA 3FEHA 3H7HA 3MDBC 3O47A 3LVQE 5SVIB 5SVIA 2IQJA 2KKYA 2OWAA 2XOZA 3DWDA 3LDYA 2FFWA 2YREA 3DDTA 3LVRE 3Q1DA 3JUEA 3PLWA 2JUNA 3M7KA 2XOCA 5SVXA 3FJUB 3LJUX 2D8UA 3SUBA 4Z0OA 3E2DA 3T9KA 2CRWA 4F1PA 4O62A 5SVYA 2L7PA 2KKXA 2DJAA 2EGMA 2XP0A 1DCQA 3KDEC 2CONA 2EXUA 4H9DA 4OGEA 2CRRA 2RR4A 2FD4A 2B0OE 2CSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD4 A; 
#chains in the Genus database with same CATH topology
 4UP0 A;  2LAU A;  3N9L A;  4NN2 A;  3GL6 A;  5SVI B;  2VPG A;  4AYC A;  3SOX A;  3O34 A;  2KKY A;  3LDY A;  2YRE A;  3QZV A;  2VJF B;  2VJF A;  2PUY A;  4GNG A;  1WEP A;  2LXH C;  3IHP A;  1U6G B;  2VJE A;  2KKX A;  5AIU A;  2VJE B;  2DJA A;  2M6M A;  2EXU A;  1X4U A;  4I7C A;  2JMI A;  1WEU A;  5EYA F;  4TKP B;  4L7X A;  4B86 C;  1CHC A;  4IC2 A;  2LDR A;  2LRI C;  2YU4 A;  3LVR E;  4Q6F A;  3T9K A;  3ZTG A;  5G04 B;  3SHB A;  2MUM A;  1DCQ A;  5TRB A;  2L0B A;  2ECI A;  4V3L C;  2M3H A;  2YHO A;  2MKE A;  4R8P K;  2YW8 A;  1RMD A;  2MD7 B;  2VPE A;  2EGP A;  3C5K A;  3RPG B;  5TDR A;  5FER A;  3T7L A;  2FSA A;  2KWO A;  2OWA A;  5J3X A;  3RPG C;  3DDT A;  2YUR A;  2F6J A;  3U5N A;  3ZPV 1;  4CA1 A;  3ZVZ B;  2LXP C;  1F62 A;  2L5U A;  2KE1 A;  5D1L B;  4WZ2 A;  2P57 A;  1VD4 A;  5KH9 A;  2QIZ A;  4LJN A;  1G25 A;  3MHS A;  3O33 A;  2LGL A;  2XB1 A;  3KQI A;  1DVP A;  3SUB A;  3L1X A;  5FB1 A;  4O62 A;  1X4I A;  3HTK C;  5JG6 A;  2C2V S;  1K2F A;  3EB6 A;  1WIL A;  4CCG X;  3ASL A;  4F52 B;  2FD4 A;  4YAX A;  2JMD A;  5K3Q A;  2Y1N A;  4LK9 A;  3O47 A;  1WEO A;  5TBN A;  4MSX A;  2MNZ A;  2VPD A;  3DQV R;  3O35 A;  4YAD A;  2AN6 A;  2L7P A;  4FJC A;  4S3O C;  3ZPV E;  2K17 A;  3HCS A;  2B0O E;  4I7B A;  2QJ0 A;  4YBT A;  3ZNI A;  4LLB A;  1MM3 A;  3N9Q A;  4I7D A;  4BHW A;  5H1T A;  2ECV A;  2K16 A;  4FIP A;  3M99 A;  2PNX A;  3PUR A;  2H0D B;  3DWD A;  4N4F A;  2ECW A;  2VNF A;  1MBM A;  5B75 A;  2CKL A;  2CRW A;  2CSY A;  3M62 A;  2JRJ A;  2ECJ A;  2CRR A;  1WIM A;  2K4D A;  1JM7 B;  4GND A;  1JM7 A;  4S3O B;  4Z0R A;  2LV9 A;  3GV4 A;  4PTB A;  3LVQ E;  5SVI A;  4AYC B;  2E6R A;  5FB0 A;  2FFW A;  1FP0 A;  2EOD A;  3JUE A;  4FO9 A;  1WEW A;  4IC3 A;  3LJU X;  2LN0 A;  4GNE A;  5KH3 A;  4YC9 A;  4R7E A;  3KDE C;  2F42 A;  2FUI A;  1T1H A;  2YVR A;  1VYX A;  4OGC A;  3U5O A;  1WEE A;  2YT5 A;  2DX8 A;  5G0F A;  3ZVY A;  1WGM A;  4W4U A;  1VFY A;  5H9M A;  2KR4 A;  3N9O A;  2OXQ C;  4GB0 A;  1WEV A;  4A4B A;  2XEU A;  2NAA A;  3FAN A;  2H0D A;  2EGM A;  2L43 A;  4AUQ B;  2M1R A;  2VP7 A;  4O64 A;  2VPB A;  2CSV A;  2YQL A;  2ECG A;  3NG2 A;  2G43 A;  3HCU A;  2LQ6 A;  2HDP A;  2BAY A;  2C2L A;  3KV6 A;  2QIC A;  4LAD B;  2JUN A;  4ZUX U;  2RI7 A;  4UP5 A;  1FBV A;  3L1Z B;  2UZG A;  4F1P A;  5C13 A;  2ECN A;  2XP0 A;  5FEY A;  2MNY A;  1WFK A;  2I50 A;  4QF2 A;  4GNF A;  3I2D A;  5D1M B;  3V43 A;  2KU3 A;  2ZET C;  2M13 A;  1Z60 A;  2CT2 A;  1WES A;  1HYI A;  4UI9 B;  5H1U A;  4H9D A;  3O7A A;  3L11 A;  3LRQ A;  2KYU A;  2Y1M A;  4L58 A;  3PUQ A;  4YAT A;  1HYJ A;  2EA6 A;  3FEH A;  2M85 A;  3O70 A;  3SOW A;  2YYR A;  4AP4 A;  4WZ0 A;  3Q1D A;  5B8D A;  2KWK A;  3FJU B;  2D8S A;  3SOU A;  2G45 A;  5TDW A;  2MA6 A;  5LKT A;  5D1K B;  4MVT A;  3EB5 A;  2E6S A;  2KWN A;  3H7H A;  1XWH A;  4X3G A;  1Z2Q A;  3O37 A;  3M63 A;  1Z6U A;  4PPE A;  2KRE A;  4B7Y C;  4AVX A;  2YSJ A;  2DSM A;  5DKA A;  2MT5 A;  2YUC A;  2XOC A;  2ECT A;  3ZYQ A;  4A4C A;  3KV5 A;  2CON A;  4OGE A;  4A0C D;  2JMJ A;  2E61 A;  1E4U A;  3N9N A;  2KWJ A;  2K1J A;  5B76 A;  2YQM A;  2IQJ A;  2XOZ A;  5DIN A;  3PLW A;  3M7K A;  1WEN A;  2Y43 A;  5SVX A;  5LKX A;  2YHN A;  3PHD A;  2MIQ A;  5LKU A;  3U5M A;  5AIT A;  3DPL R;  3KNV A;  2L75 A;  5B77 A;  3LQI A;  4V3K C;  4LKA A;  3C6W A;  3FM8 C;  2LGV A;  4XI1 A;  4BBQ A;  3LQJ A;  2XOY A;  5B79 A;  2L80 A;  4N3W A;  2LGG A;  2F6N A;  3N9M A;  1BOR A;  1WEM A;  2RSD A;  3E2D A;  1LDJ B;  2LGK A;  5I3L A;  4P5O B;  2G6Q A;  3RTR B;  4ZDT A;  3VK6 A;  3MHH A;  2RR4 A;  1X4J A;  5H1V A;  2KIZ A;  1WEQ A;  5C11 A;  3T6R A;  2IDA A;  1N87 A;  3MDB C;  2MD8 C;  4YBM A;  4QF3 A;  4ZQL A;  1IYM A;  1V87 A;  4A49 A;  1LDK C;  1JOC A;  1MM2 A;  4Z0O A;  2YSM A;  4R2Y A;  1ZBD B;  5TAB A;  2KGI A;  4C9Z A;  4YAB A;  3FAO A;  3LQH A;  4WA6 A;  2KFT A;  5LKZ A;  2JM3 A;  4FK5 A;  5G05 B;  2KGG A;  3HCT A;  4QQ4 A;  5KH7 A;  4YBS A;  5B78 A;  2CSZ A;  3O36 A;  3N9P A;  2CKL B;  2D8U A;  2FUU A;  5SVY A;  2MA5 A;  4WZ3 B;  3FL2 A;  5LCW B;  3U5P A;  2HYE D;  1WE9 A; 
#chains in the Genus database with same CATH homology
 2E61 A;  2MKE A;  2P57 A;  3FM8 C;  4OGC A;  2LAU A;  2JM3 A;  2YVR A;  2XOY A;  4Z0R A;  4QQ4 A;  2M13 A;  5K3Q A;  3FEH A;  3H7H A;  3MDB C;  3O47 A;  3LVQ E;  5SVI B;  5SVI A;  2IQJ A;  2KKY A;  2OWA A;  2XOZ A;  3DWD A;  3LDY A;  2FFW A;  2YRE A;  3DDT A;  3LVR E;  3Q1D A;  3JUE A;  3PLW A;  2JUN A;  3M7K A;  2XOC A;  5SVX A;  3FJU B;  3LJU X;  2D8U A;  3SUB A;  4Z0O A;  3E2D A;  3T9K A;  2CRW A;  4F1P A;  4O62 A;  5SVY A;  2L7P A;  2KKX A;  2DJA A;  2EGM A;  2XP0 A;  1DCQ A;  3KDE C;  2CON A;  2EXU A;  4H9D A;  4OGE A;  2CRR A;  2RR4 A;  2FD4 A;  2B0O E;  2CSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...