2CONA

Solution structure of rsgi ruh-035, a zn-ribbon module in mouse cdna
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
79
structure length
79
Chain Sequence
GSSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nin one binding protein
publication title Solution Structure of RSGI RUH-035, a Zn-ribbon module in Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Ribosome
total genus 1
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.120 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2conA00
2CONA
chains in the Genus database with same CATH superfamily
2EODA 3ZTGA 3KV5A 2D8SA 4Z0OA 1MM3A 3N9OA 1F62A 2JM3A 3U5OA 1HYJA 2DJAA 2YVRA 1Z2QA 5DKAA 3T6RA 3KV6A 2Y1NA 2JRJA 2VJEA 4B86C 2LGKA 4UI9B 4XI1A 1X4JA 3C6WA 2OXQC 4YBSA 2M85A 4W4UA 1WEMA 2CT2A 3FL2A 2EXUA 2FD4A 4GNFA 5D1LB 4V3KC 2YT5A 2XOCA 5G05B 4GNGA 3T7LA 1ZBDB 2G43A 5H9MA 4FJCA 2CSYA 4WZ0A 2ECGA 3O37A 4FIPA 4H9DA 2DSMA 4MSXA 4YAXA 5SVIB 3KDEC 4AYCB 5LKUA 4O62A 1VFYA 3MHSA 5C11A 4QF2A 2LDRA 5H1UA 4FO9A 4IC3A 2VPDA 2KIZA 1WESA 4I7DA 4F1PA 1E4UA 4S3OB 5EYAF 5B78A 1WEVA 3O33A 3NG2A 2DX8A 4LLBA 2VJFA 3RTRB 2KWNA 4A4CA 2OWAA 2L80A 3N9PA 4ZQLA 2LRIC 3SOUA 4S3OC 3VK6A 2XOZA 3EB5A 1CHCA 4YC9A 3LQIA 4F52B 4IC2A 5D1KB 5JG6A 2BAYA 3N9LA 2E6RA 2CKLB 1DCQA 2LXPC 3ZPV1 2MKEA 5TDRA 3FJUB 3GL6A 4YBTA 2ECVA 3O35A 3PLWA 4I7CA 2QIZA 2KR4A 5TDWA 5TRBA 2CRWA 2FUUA 3H7HA 2RSDA 3FEHA 3HCSA 3O34A 2ECWA 5LCWB 2H0DA 4P5OB 5B75A 1WEUA 2KU3A 2XB1A 3FAOA 1DVPA 4N4FA 3LQJA 1MBMA 3N9NA 2VJFB 4R2YA 2ECTA 3Q1DA 5LKTA 2MT5A 4B7YC 3L1ZB 4ZUXU 2KGGA 2M1RA 2MUMA 4YATA 4GNDA 2KWOA 2MA5A 2VP7A 3V43A 2CSZA 1XWHA 2P57A 3PURA 2YU4A 1JOCA 3HCUA 5C13A 4PPEA 2LV9A 3N9QA 4GNEA 2JMIA 5H1VA 2KREA 3U5MA 3L1XA 4WZ2A 2L0BA 4L7XA 1LDKC 2H0DB 2MA6A 4R7EA 4WA6A 2F42A 2YSJA 3ZNIA 3ZYQA 2D8UA 3RPGC 5H1TA 4GB0A 2MD8C 4YADA 2XEUA 2XP0A 1X4UA 4O64A 2UZGA 2Y43A 2E6SA 5I3LA 2KKYA 4ZDTA 1JM7A 5FB0A 2KWJA 4I7BA 4BHWA 2JMDA 2ZETC 4YABA 2C2VS 5SVXA 3LRQA 2QJ0A 2KKXA 2VJEB 2KYUA 2KGIA 1FP0A 3IHPA 4YBMA 1IYMA 5TBNA 4NN2A 2MNZA 2LGLA 2PNXA 1WENA 2XOYA 3ASLA 3GV4A 3QZVA 3PUQA 1BORA 4CCGX 3MDBC 2ECJA 3M7KA 2C2LA 3O7AA 3M62A 3M99A 2ECIA 5DINA 3ZVYA 4LK9A 2KE1A 5B76A 2YQLA 2K4DA 2L7PA 5LKZA 2EGMA 4BBQA 3LVQE 4X3GA 3MHHA 3O70A 3KQIA 2L43A 2EA6A 2CRRA 3O36A 3JUEA 3ZVZB 2Y1MA 4PTBA 2IQJA 2VPGA 4Z0RA 4LKAA 1WEEA 4WZ3B 2FUIA 2VNFA 4R8PK 2YHOA 4A49A 3LJUX 5FERA 1G25A 3T9KA 1T1HA 3DPLR 5SVYA 1U6GB 3HTKC 2ECNA 2MIQA 3FANA 5B8DA 2YURA 2CONA 1VYXA 2EGPA 3O47A 4A4BA 2QICA 1MM2A 2LGVA 2LAUA 5D1MB 1WEQA 2YSMA 5FB1A 3SOWA 5TABA 4LADB 2VPBA 2LGGA 2IDAA 1N87A 2RI7A 1Z60A 2MNYA 2PUYA 3HCTA 2JMJA 2FFWA 5KH7A 5G0FA 3RPGB 2FSAA 2M13A 3N9MA 4A0CD 1FBVA 4V3LC 2LN0A 3DDTA 3M63A 5B79A 2L75A 5AIUA 2M3HA 2CKLA 2L5UA 2G6QA 2YQMA 4OGCA 2KWKA 2CSVA 3LQHA 5G04B 2B0OE 4N3WA 1WILA 1WEPA 2LQ6A 1WFKA 2HYED 3PHDA 2K16A 3FM8C 1Z6UA 2F6JA 4FK5A 3LVRE 4OGEA 1X4IA 2LXHC 3EB6A 4L58A 5AITA 2F6NA 2RR4A 3SHBA 3U5NA 1WEOA 4UP5A 4MVTA 1WGMA 2NAAA 2HDPA 4AVXA 2YHNA 2K1JA 1HYIA 4QF3A 2G45A 5KH3A 5LKXA 3ZPVE 2KFTA 2M6MA 5KH9A 3E2DA 3U5PA 3SUBA 3DQVR 4CA1A 5B77A 3KNVA 4LJNA 2VPEA 2AN6A 2YW8A 2YYRA 1WEWA 3DWDA 4QQ4A 4AP4A 1JM7B 1WE9A 2JUNA 1VD4A 4Q6FA 4C9ZA 1WIMA 3L11A 3SOXA 1RMDA 2K17A 2YREA 3LDYA 5FEYA 5SVIA 2MD7B 3I2DA 4AYCA 3C5KA 4TKPB 2YUCA 2I50A 2E61A 1LDJB 4UP0A 1V87A 4AUQB 1K2FA 5J3XA 5K3QA
chains in the Genus database with same CATH topology
2EXUA 2FD4A 3KDEC 3LJUX 2CRWA 2XOZA 2XP0A 3DDTA 3T9KA 4Z0OA 3LVRE 2XOCA 3Q1DA 4OGEA 2JM3A 5SVYA 2L7PA 2EGMA 2DJAA 2YVRA 3H7HA 5K3QA 2XOYA 3FEHA 3E2DA 3LVQE 4F1PA 2YREA 3SUBA 3LDYA 5SVIA 2KKYA 2FFWA 2RR4A 1DCQA 2CONA 4OGCA 2CRRA 4H9DA 2CSVA 3O47A 2M13A 3JUEA 2MKEA 3DWDA 3MDBC 5SVIB 2P57A 2E61A 2IQJA 4Z0RA 3FJUB 4QQ4A 5SVXA 2B0OE 3M7KA 2LAUA 2OWAA 3PLWA 4O62A 2JUNA 2KKXA 2D8UA 3FM8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CON A; 
#chains in the Genus database with same CATH topology
 2EOD A;  3ZTG A;  3KV5 A;  2D8S A;  4Z0O A;  1MM3 A;  3N9O A;  1F62 A;  2JM3 A;  3U5O A;  1HYJ A;  2DJA A;  2YVR A;  1Z2Q A;  5DKA A;  3T6R A;  3KV6 A;  2Y1N A;  2JRJ A;  2VJE A;  4B86 C;  2LGK A;  4UI9 B;  4XI1 A;  1X4J A;  3C6W A;  2OXQ C;  4YBS A;  2M85 A;  4W4U A;  1WEM A;  2CT2 A;  3FL2 A;  2EXU A;  2FD4 A;  4GNF A;  5D1L B;  4V3K C;  2YT5 A;  2XOC A;  5G05 B;  4GNG A;  3T7L A;  1ZBD B;  2G43 A;  5H9M A;  4FJC A;  2CSY A;  4WZ0 A;  2ECG A;  3O37 A;  4FIP A;  4H9D A;  2DSM A;  4MSX A;  4YAX A;  5SVI B;  3KDE C;  4AYC B;  5LKU A;  4O62 A;  1VFY A;  3MHS A;  5C11 A;  4QF2 A;  2LDR A;  5H1U A;  4FO9 A;  4IC3 A;  2VPD A;  2KIZ A;  1WES A;  4I7D A;  4F1P A;  1E4U A;  4S3O B;  5EYA F;  5B78 A;  1WEV A;  3O33 A;  3NG2 A;  2DX8 A;  4LLB A;  2VJF A;  3RTR B;  2KWN A;  4A4C A;  2OWA A;  2L80 A;  3N9P A;  4ZQL A;  2LRI C;  3SOU A;  4S3O C;  3VK6 A;  2XOZ A;  3EB5 A;  1CHC A;  4YC9 A;  3LQI A;  4F52 B;  4IC2 A;  5D1K B;  5JG6 A;  2BAY A;  3N9L A;  2E6R A;  2CKL B;  1DCQ A;  2LXP C;  3ZPV 1;  2MKE A;  5TDR A;  3FJU B;  3GL6 A;  4YBT A;  2ECV A;  3O35 A;  3PLW A;  4I7C A;  2QIZ A;  2KR4 A;  5TDW A;  5TRB A;  2CRW A;  2FUU A;  3H7H A;  2RSD A;  3FEH A;  3HCS A;  3O34 A;  2ECW A;  5LCW B;  2H0D A;  4P5O B;  5B75 A;  1WEU A;  2KU3 A;  2XB1 A;  3FAO A;  1DVP A;  4N4F A;  3LQJ A;  1MBM A;  3N9N A;  2VJF B;  4R2Y A;  2ECT A;  3Q1D A;  5LKT A;  2MT5 A;  4B7Y C;  3L1Z B;  4ZUX U;  2KGG A;  2M1R A;  2MUM A;  4YAT A;  4GND A;  2KWO A;  2MA5 A;  2VP7 A;  3V43 A;  2CSZ A;  1XWH A;  2P57 A;  3PUR A;  2YU4 A;  1JOC A;  3HCU A;  5C13 A;  4PPE A;  2LV9 A;  3N9Q A;  4GNE A;  2JMI A;  5H1V A;  2KRE A;  3U5M A;  3L1X A;  4WZ2 A;  2L0B A;  4L7X A;  1LDK C;  2H0D B;  2MA6 A;  4R7E A;  4WA6 A;  2F42 A;  2YSJ A;  3ZNI A;  3ZYQ A;  2D8U A;  3RPG C;  5H1T A;  4GB0 A;  2MD8 C;  4YAD A;  2XEU A;  2XP0 A;  1X4U A;  4O64 A;  2UZG A;  2Y43 A;  2E6S A;  5I3L A;  2KKY A;  4ZDT A;  1JM7 A;  5FB0 A;  2KWJ A;  4I7B A;  4BHW A;  2JMD A;  2ZET C;  4YAB A;  2C2V S;  5SVX A;  3LRQ A;  2QJ0 A;  2KKX A;  2VJE B;  2KYU A;  2KGI A;  1FP0 A;  3IHP A;  4YBM A;  1IYM A;  5TBN A;  4NN2 A;  2MNZ A;  2LGL A;  2PNX A;  1WEN A;  2XOY A;  3ASL A;  3GV4 A;  3QZV A;  3PUQ A;  1BOR A;  4CCG X;  3MDB C;  2ECJ A;  3M7K A;  2C2L A;  3O7A A;  3M62 A;  3M99 A;  2ECI A;  5DIN A;  3ZVY A;  4LK9 A;  2KE1 A;  5B76 A;  2YQL A;  2K4D A;  2L7P A;  5LKZ A;  2EGM A;  4BBQ A;  3LVQ E;  4X3G A;  3MHH A;  3O70 A;  3KQI A;  2L43 A;  2EA6 A;  2CRR A;  3O36 A;  3JUE A;  3ZVZ B;  2Y1M A;  4PTB A;  2IQJ A;  2VPG A;  4Z0R A;  4LKA A;  1WEE A;  4WZ3 B;  2FUI A;  2VNF A;  4R8P K;  2YHO A;  4A49 A;  3LJU X;  5FER A;  1G25 A;  3T9K A;  1T1H A;  3DPL R;  5SVY A;  1U6G B;  3HTK C;  2ECN A;  2MIQ A;  3FAN A;  5B8D A;  2YUR A;  2CON A;  1VYX A;  2EGP A;  3O47 A;  4A4B A;  2QIC A;  1MM2 A;  2LGV A;  2LAU A;  5D1M B;  1WEQ A;  2YSM A;  5FB1 A;  3SOW A;  5TAB A;  4LAD B;  2VPB A;  2LGG A;  2IDA A;  1N87 A;  2RI7 A;  1Z60 A;  2MNY A;  2PUY A;  3HCT A;  2JMJ A;  2FFW A;  5KH7 A;  5G0F A;  3RPG B;  2FSA A;  2M13 A;  3N9M A;  4A0C D;  1FBV A;  4V3L C;  2LN0 A;  3DDT A;  3M63 A;  5B79 A;  2L75 A;  5AIU A;  2M3H A;  2CKL A;  2L5U A;  2G6Q A;  2YQM A;  4OGC A;  2KWK A;  2CSV A;  3LQH A;  5G04 B;  2B0O E;  4N3W A;  1WIL A;  1WEP A;  2LQ6 A;  1WFK A;  2HYE D;  3PHD A;  2K16 A;  3FM8 C;  1Z6U A;  2F6J A;  4FK5 A;  3LVR E;  4OGE A;  1X4I A;  2LXH C;  3EB6 A;  4L58 A;  5AIT A;  2F6N A;  2RR4 A;  3SHB A;  3U5N A;  1WEO A;  4UP5 A;  4MVT A;  1WGM A;  2NAA A;  2HDP A;  4AVX A;  2YHN A;  2K1J A;  1HYI A;  4QF3 A;  2G45 A;  5KH3 A;  5LKX A;  3ZPV E;  2KFT A;  2M6M A;  5KH9 A;  3E2D A;  3U5P A;  3SUB A;  3DQV R;  4CA1 A;  5B77 A;  3KNV A;  4LJN A;  2VPE A;  2AN6 A;  2YW8 A;  2YYR A;  1WEW A;  3DWD A;  4QQ4 A;  4AP4 A;  1JM7 B;  1WE9 A;  2JUN A;  1VD4 A;  4Q6F A;  4C9Z A;  1WIM A;  3L11 A;  3SOX A;  1RMD A;  2K17 A;  2YRE A;  3LDY A;  5FEY A;  5SVI A;  2MD7 B;  3I2D A;  4AYC A;  3C5K A;  4TKP B;  2YUC A;  2I50 A;  2E61 A;  1LDJ B;  4UP0 A;  1V87 A;  4AUQ B;  1K2F A;  5J3X A;  5K3Q A; 
#chains in the Genus database with same CATH homology
 2EXU A;  2FD4 A;  3KDE C;  3LJU X;  2CRW A;  2XOZ A;  2XP0 A;  3DDT A;  3T9K A;  4Z0O A;  3LVR E;  2XOC A;  3Q1D A;  4OGE A;  2JM3 A;  5SVY A;  2L7P A;  2EGM A;  2DJA A;  2YVR A;  3H7H A;  5K3Q A;  2XOY A;  3FEH A;  3E2D A;  3LVQ E;  4F1P A;  2YRE A;  3SUB A;  3LDY A;  5SVI A;  2KKY A;  2FFW A;  2RR4 A;  1DCQ A;  2CON A;  4OGC A;  2CRR A;  4H9D A;  2CSV A;  3O47 A;  2M13 A;  3JUE A;  2MKE A;  3DWD A;  3MDB C;  5SVI B;  2P57 A;  2E61 A;  2IQJ A;  4Z0R A;  3FJU B;  4QQ4 A;  5SVX A;  2B0O E;  3M7K A;  2LAU A;  2OWA A;  3PLW A;  4O62 A;  2JUN A;  2KKX A;  2D8U A;  3FM8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...