2CONA

Solution structure of rsgi ruh-035, a zn-ribbon module in mouse cdna
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
79
structure length
79
Chain Sequence
GSSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-035, a Zn-ribbon module in Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Ribosome
molecule keywords nin one binding protein
total genus 1
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.120 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2conA00
2CONA
chains in the Genus database with same CATH superfamily
3O37A 2K17A 2XP0A 2MNZA 1IYMA 5SVYA 2LRIC 2YURA 1N87A 2ECGA 5LCWB 5K3QA 2VJFA 2JMJA 1X4JA 1WEVA 3MHHA 2YYRA 5SVXA 1WEWA 4R8PK 4I7BA 2EA6A 5C11A 2EXUA 4B7YC 2XB1A 1WEQA 1MM2A 2KYUA 2RR4A 3LQJA 3DDTA 4L7XA 2YW8A 3Q1DA 2EGPA 2LDRA 2B0OE 4Z0OA 4XI1A 4A4CA 5D1KB 1WENA 5H9MA 5I3LA 4L58A 5TABA 2Y43A 4N4FA 1WIMA 2CKLA 4LK9A 2KKYA 2L75A 4LJNA 2HDPA 1ZBDB 3U5MA 5SVIA 2ECTA 3U5PA 4YBMA 4YBTA 2G45A 4S3OB 3HCUA 3C6WA 3N9OA 2KGIA 2L0BA 3U5NA 2YSJA 1VD4A 2MNYA 3QZVA 1F62A 4LKAA 4F1PA 4A49A 5G05B 2M3HA 5J3XA 2LGLA 2CSZA 2MIQA 1CHCA 2CSVA 2LN0A 4A4BA 3M62A 2DSMA 3O47A 3SOUA 4V3KC 2FSAA 1K2FA 3KV6A 2L80A 2K1JA 2F6NA 2LGVA 2QJ0A 1WGMA 3HCSA 3FEHA 1X4IA 2RSDA 3SUBA 2MD7B 2M6MA 1RMDA 3ZYQA 2KWOA 3FANA 4FO9A 3ZPVE 2XOCA 4QF3A 4O62A 3L1ZB 4LLBA 3LVQE 2VP7A 2MUMA 3I2DA 4AYCB 2JMDA 2F6JA 1HYIA 2FD4A 4H9DA 4WZ0A 2ECIA 2ZETC 4C9ZA 1XWHA 2CKLB 2KWJA 2PUYA 2XOZA 4AVXA 2ECJA 3PUQA 1T1HA 1FP0A 4AUQB 5TDWA 4YC9A 2C2VS 2L43A 4I7CA 1WEUA 2DX8A 5LKZA 2YQLA 3N9NA 4R2YA 5LKUA 3ASLA 3VK6A 4S3OC 2FUUA 2MT5A 1Z60A 2MA5A 5SVIB 3M7KA 4ZQLA 3SHBA 2MD8C 3PHDA 2FFWA 2VJEB 3HCTA 4OGCA 2CT2A 2MA6A 4YBSA 1JM7A 5B76A 4WZ2A 3L11A 3DQVR 3FAOA 4GNGA 4PTBA 1WEMA 2IQJA 2M85A 2VPDA 4MSXA 2NAAA 1U6GB 2LXHC 4QQ4A 5D1LB 3O35A 3ZNIA 4AP4A 2KR4A 5KH9A 5KH7A 3T7LA 1MM3A 3N9QA 2HYED 1FBVA 2FUIA 2LQ6A 3E2DA 5D1MB 3EB5A 4UP5A 2H0DB 4WA6A 5B8DA 2YU4A 1LDKC 4CCGX 2QIZA 3O36A 2VJFB 2KKXA 2K4DA 4X3GA 3GV4A 3RTRB 5H1UA 1X4UA 1BORA 1MBMA 2L5UA 3GL6A 4BBQA 2YHOA 3N9MA 1V87A 2I50A 2JUNA 2XOYA 3LJUX 2Y1MA 2CONA 5G04B 2DJAA 3PLWA 3T6RA 2EODA 1WILA 5FB0A 2Y1NA 3RPGB 2ECVA 2KREA 4IC3A 2KGGA 2XEUA 4F52B 5EYAF 1WEPA 3LVRE 4WZ3B 5LKXA 5FB1A 2D8SA 2E6RA 4UI9B 4UP0A 1WEOA 3PURA 5TRBA 2M13A 2E6SA 4O64A 4FJCA 4Z0RA 3KDEC 2KFTA 2MKEA 2KIZA 4IC2A 1LDJB 3IHPA 1Z6UA 5B75A 4NN2A 5DKAA 5TBNA 2LGKA 3RPGC 1Z2QA 3SOXA 3LDYA 2KU3A 1HYJA 2PNXA 4Q6FA 2UZGA 5H1TA 4N3WA 3FL2A 2VPBA 5LKTA 3DWDA 3U5OA 3ZVZB 2JRJA 4BHWA 1WE9A 3O7AA 4QF2A 3FJUB 2K16A 2LGGA 1G25A 4R7EA 4GB0A 3ZPV1 3KV5A 4FIPA 3N9LA 3JUEA 4LADB 3O33A 2VPEA 5KH3A 4W4UA 3O70A 1VFYA 4TKPB 1DVPA 2CRWA 5FEYA 3HTKC 3EB6A 4GNFA 1JOCA 4ZDTA 2G43A 3O34A 5C13A 3NG2A 4ZUXU 2AN6A 5G0FA 1VYXA 4CA1A 5B78A 3C5KA 3MHSA 2LXPC 5FERA 3V43A 3ZTGA 1WFKA 2YQMA 1WESA 4I7DA 2ECWA 2H0DA 4YATA 2BAYA 3SOWA 5B79A 1WEEA 3ZVYA 2F42A 5TDRA 4AYCA 4YAXA 3KQIA 2VPGA 5DINA 1DCQA 4OGEA 2C2LA 3M63A 3KNVA 2EGMA 3M99A 4V3LC 2YUCA 2G6QA 3FM8C 4GNEA 4PPEA 4YABA 2D8UA 4YADA 2JM3A 4B86C 4A0CD 2YSMA 2ECNA 4FK5A 2KE1A 3L1XA 4MVTA 2CSYA 2YHNA 4GNDA 4P5OB 5AIUA 3LRQA 5B77A 2KWKA 3N9PA 5H1VA 5AITA 3MDBC 2CRRA 2YT5A 2E61A 2LV9A 3LQHA 2P57A 2VNFA 2M1RA 2YREA 1E4UA 2LAUA 3LQIA 3T9KA 2JMIA 2VJEA 2IDAA 2YVRA 2OWAA 5JG6A 3DPLR 2RI7A 1JM7B 2OXQC 3H7HA 2L7PA 2QICA 2KWNA
chains in the Genus database with same CATH topology
2XP0A 2E61A 4OGCA 3SUBA 2D8UA 3FJUB 5SVIA 5SVYA 2CSVA 2P57A 2XOZA 2XOCA 3LVRE 3E2DA 4O62A 2RR4A 4H9DA 2JM3A 5K3QA 2YREA 2JUNA 3DDTA 3LDYA 2XOYA 3LJUX 2CRRA 3JUEA 3O47A 1DCQA 3LVQE 2LAUA 2IQJA 4OGEA 3Q1DA 3T9KA 2CONA 2B0OE 2M13A 2YVRA 2OWAA 4Z0OA 2DJAA 3PLWA 5SVXA 4Z0RA 2KKXA 2EGMA 3KDEC 3MDBC 3DWDA 2MKEA 3H7HA 2L7PA 2FD4A 4QQ4A 5SVIB 3M7KA 4F1PA 3FM8C 2KKYA 2CRWA 2EXUA 3FEHA 2FFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CON A; 
#chains in the Genus database with same CATH topology
 3O37 A;  2K17 A;  2XP0 A;  2MNZ A;  1IYM A;  5SVY A;  2LRI C;  2YUR A;  1N87 A;  2ECG A;  5LCW B;  5K3Q A;  2VJF A;  2JMJ A;  1X4J A;  1WEV A;  3MHH A;  2YYR A;  5SVX A;  1WEW A;  4R8P K;  4I7B A;  2EA6 A;  5C11 A;  2EXU A;  4B7Y C;  2XB1 A;  1WEQ A;  1MM2 A;  2KYU A;  2RR4 A;  3LQJ A;  3DDT A;  4L7X A;  2YW8 A;  3Q1D A;  2EGP A;  2LDR A;  2B0O E;  4Z0O A;  4XI1 A;  4A4C A;  5D1K B;  1WEN A;  5H9M A;  5I3L A;  4L58 A;  5TAB A;  2Y43 A;  4N4F A;  1WIM A;  2CKL A;  4LK9 A;  2KKY A;  2L75 A;  4LJN A;  2HDP A;  1ZBD B;  3U5M A;  5SVI A;  2ECT A;  3U5P A;  4YBM A;  4YBT A;  2G45 A;  4S3O B;  3HCU A;  3C6W A;  3N9O A;  2KGI A;  2L0B A;  3U5N A;  2YSJ A;  1VD4 A;  2MNY A;  3QZV A;  1F62 A;  4LKA A;  4F1P A;  4A49 A;  5G05 B;  2M3H A;  5J3X A;  2LGL A;  2CSZ A;  2MIQ A;  1CHC A;  2CSV A;  2LN0 A;  4A4B A;  3M62 A;  2DSM A;  3O47 A;  3SOU A;  4V3K C;  2FSA A;  1K2F A;  3KV6 A;  2L80 A;  2K1J A;  2F6N A;  2LGV A;  2QJ0 A;  1WGM A;  3HCS A;  3FEH A;  1X4I A;  2RSD A;  3SUB A;  2MD7 B;  2M6M A;  1RMD A;  3ZYQ A;  2KWO A;  3FAN A;  4FO9 A;  3ZPV E;  2XOC A;  4QF3 A;  4O62 A;  3L1Z B;  4LLB A;  3LVQ E;  2VP7 A;  2MUM A;  3I2D A;  4AYC B;  2JMD A;  2F6J A;  1HYI A;  2FD4 A;  4H9D A;  4WZ0 A;  2ECI A;  2ZET C;  4C9Z A;  1XWH A;  2CKL B;  2KWJ A;  2PUY A;  2XOZ A;  4AVX A;  2ECJ A;  3PUQ A;  1T1H A;  1FP0 A;  4AUQ B;  5TDW A;  4YC9 A;  2C2V S;  2L43 A;  4I7C A;  1WEU A;  2DX8 A;  5LKZ A;  2YQL A;  3N9N A;  4R2Y A;  5LKU A;  3ASL A;  3VK6 A;  4S3O C;  2FUU A;  2MT5 A;  1Z60 A;  2MA5 A;  5SVI B;  3M7K A;  4ZQL A;  3SHB A;  2MD8 C;  3PHD A;  2FFW A;  2VJE B;  3HCT A;  4OGC A;  2CT2 A;  2MA6 A;  4YBS A;  1JM7 A;  5B76 A;  4WZ2 A;  3L11 A;  3DQV R;  3FAO A;  4GNG A;  4PTB A;  1WEM A;  2IQJ A;  2M85 A;  2VPD A;  4MSX A;  2NAA A;  1U6G B;  2LXH C;  4QQ4 A;  5D1L B;  3O35 A;  3ZNI A;  4AP4 A;  2KR4 A;  5KH9 A;  5KH7 A;  3T7L A;  1MM3 A;  3N9Q A;  2HYE D;  1FBV A;  2FUI A;  2LQ6 A;  3E2D A;  5D1M B;  3EB5 A;  4UP5 A;  2H0D B;  4WA6 A;  5B8D A;  2YU4 A;  1LDK C;  4CCG X;  2QIZ A;  3O36 A;  2VJF B;  2KKX A;  2K4D A;  4X3G A;  3GV4 A;  3RTR B;  5H1U A;  1X4U A;  1BOR A;  1MBM A;  2L5U A;  3GL6 A;  4BBQ A;  2YHO A;  3N9M A;  1V87 A;  2I50 A;  2JUN A;  2XOY A;  3LJU X;  2Y1M A;  2CON A;  5G04 B;  2DJA A;  3PLW A;  3T6R A;  2EOD A;  1WIL A;  5FB0 A;  2Y1N A;  3RPG B;  2ECV A;  2KRE A;  4IC3 A;  2KGG A;  2XEU A;  4F52 B;  5EYA F;  1WEP A;  3LVR E;  4WZ3 B;  5LKX A;  5FB1 A;  2D8S A;  2E6R A;  4UI9 B;  4UP0 A;  1WEO A;  3PUR A;  5TRB A;  2M13 A;  2E6S A;  4O64 A;  4FJC A;  4Z0R A;  3KDE C;  2KFT A;  2MKE A;  2KIZ A;  4IC2 A;  1LDJ B;  3IHP A;  1Z6U A;  5B75 A;  4NN2 A;  5DKA A;  5TBN A;  2LGK A;  3RPG C;  1Z2Q A;  3SOX A;  3LDY A;  2KU3 A;  1HYJ A;  2PNX A;  4Q6F A;  2UZG A;  5H1T A;  4N3W A;  3FL2 A;  2VPB A;  5LKT A;  3DWD A;  3U5O A;  3ZVZ B;  2JRJ A;  4BHW A;  1WE9 A;  3O7A A;  4QF2 A;  3FJU B;  2K16 A;  2LGG A;  1G25 A;  4R7E A;  4GB0 A;  3ZPV 1;  3KV5 A;  4FIP A;  3N9L A;  3JUE A;  4LAD B;  3O33 A;  2VPE A;  5KH3 A;  4W4U A;  3O70 A;  1VFY A;  4TKP B;  1DVP A;  2CRW A;  5FEY A;  3HTK C;  3EB6 A;  4GNF A;  1JOC A;  4ZDT A;  2G43 A;  3O34 A;  5C13 A;  3NG2 A;  4ZUX U;  2AN6 A;  5G0F A;  1VYX A;  4CA1 A;  5B78 A;  3C5K A;  3MHS A;  2LXP C;  5FER A;  3V43 A;  3ZTG A;  1WFK A;  2YQM A;  1WES A;  4I7D A;  2ECW A;  2H0D A;  4YAT A;  2BAY A;  3SOW A;  5B79 A;  1WEE A;  3ZVY A;  2F42 A;  5TDR A;  4AYC A;  4YAX A;  3KQI A;  2VPG A;  5DIN A;  1DCQ A;  4OGE A;  2C2L A;  3M63 A;  3KNV A;  2EGM A;  3M99 A;  4V3L C;  2YUC A;  2G6Q A;  3FM8 C;  4GNE A;  4PPE A;  4YAB A;  2D8U A;  4YAD A;  2JM3 A;  4B86 C;  4A0C D;  2YSM A;  2ECN A;  4FK5 A;  2KE1 A;  3L1X A;  4MVT A;  2CSY A;  2YHN A;  4GND A;  4P5O B;  5AIU A;  3LRQ A;  5B77 A;  2KWK A;  3N9P A;  5H1V A;  5AIT A;  3MDB C;  2CRR A;  2YT5 A;  2E61 A;  2LV9 A;  3LQH A;  2P57 A;  2VNF A;  2M1R A;  2YRE A;  1E4U A;  2LAU A;  3LQI A;  3T9K A;  2JMI A;  2VJE A;  2IDA A;  2YVR A;  2OWA A;  5JG6 A;  3DPL R;  2RI7 A;  1JM7 B;  2OXQ C;  3H7H A;  2L7P A;  2QIC A;  2KWN A; 
#chains in the Genus database with same CATH homology
 2XP0 A;  2E61 A;  4OGC A;  3SUB A;  2D8U A;  3FJU B;  5SVI A;  5SVY A;  2CSV A;  2P57 A;  2XOZ A;  2XOC A;  3LVR E;  3E2D A;  4O62 A;  2RR4 A;  4H9D A;  2JM3 A;  5K3Q A;  2YRE A;  2JUN A;  3DDT A;  3LDY A;  2XOY A;  3LJU X;  2CRR A;  3JUE A;  3O47 A;  1DCQ A;  3LVQ E;  2LAU A;  2IQJ A;  4OGE A;  3Q1D A;  3T9K A;  2CON A;  2B0O E;  2M13 A;  2YVR A;  2OWA A;  4Z0O A;  2DJA A;  3PLW A;  5SVX A;  4Z0R A;  2KKX A;  2EGM A;  3KDE C;  3MDB C;  3DWD A;  2MKE A;  3H7H A;  2L7P A;  2FD4 A;  4QQ4 A;  5SVI B;  3M7K A;  4F1P A;  3FM8 C;  2KKY A;  2CRW A;  2EXU A;  3FEH A;  2FFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...