2CONA

Solution structure of rsgi ruh-035, a zn-ribbon module in mouse cdna
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
79
structure length
79
Chain Sequence
GSSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords nin one binding protein
publication title Solution Structure of RSGI RUH-035, a Zn-ribbon module in Mouse cDNA
rcsb
source organism Mus musculus
total genus 1
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.120 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2conA00
2CONA
chains in the Genus database with same CATH superfamily
3ZTGA 3SOWA 2XOYA 1CHCA 2XB1A 2L43A 1MM2A 2VP7A 4A4BA 3ZYQA 4O62A 1LDKC 3LVRE 2CKLA 3LRQA 1X4JA 3IHPA 4LK9A 4A49A 3U5OA 2CONA 5LCWB 2HYED 2VNFA 2E6SA 2KWNA 2I50A 3O7AA 3KNVA 2KKYA 4YBTA 1Z60A 3L1XA 4A0CD 3ZNIA 5KH9A 2C2VS 3EB6A 5TBNA 1BORA 1VFYA 2B0OE 5SVIB 4P5OB 2LN0A 4OGEA 4I7DA 2DJAA 5LKUA 2MT5A 2L0BA 1HYIA 2YHNA 1K2FA 2JRJA 5H1VA 3M63A 4V3LC 3N9NA 3T6RA 2MNZA 3KQIA 2YSMA 1N87A 1DVPA 2ZETC 2DX8A 2KGIA 5B8DA 2K1JA 2KREA 2KWOA 4QQ4A 1WE9A 3V43A 3U5MA 3N9QA 2RI7A 2L75A 2EA6A 4MSXA 3LDYA 3O70A 2H0DB 5SVXA 4GNFA 3SUBA 2KIZA 2ECNA 1T1HA 4R7EA 5H9MA 4L7XA 4ZUXU 4QF2A 4AYCB 3ASLA 2MNYA 5B77A 1U6GB 2KWKA 3PLWA 2VJEB 2XOCA 2VPBA 2ECIA 3VK6A 5LKTA 3FAOA 5H1TA 5LKZA 2KGGA 2YW8A 3L1ZB 3ZPVE 3MDBC 4W4UA 4QF3A 3M99A 2YQLA 4N4FA 2DSMA 5TDWA 3M62A 1ZBDB 4PTBA 4YATA 5FERA 4O64A 3LQIA 2Y1MA 4WZ2A 3MHHA 2LGLA 2CKLB 3KV5A 1JM7A 3LJUX 1VD4A 2VJEA 5B79A 3PUQA 2F6NA 2C2LA 2MIQA 3N9PA 2K4DA 1WEWA 1WEEA 4S3OB 2Y1NA 1Z6UA 2M1RA 2FD4A 1V87A 4S3OC 4UP5A 2ECVA 5I3LA 2M3HA 3DQVR 3PHDA 4N3WA 4XI1A 5D1MB 3N9MA 3GL6A 4OGCA 2EGMA 1X4IA 2MUMA 4FO9A 2MKEA 2JMDA 3DPLR 1F62A 2VPGA 4V3KC 4Z0OA 2G45A 4GNGA 2LV9A 2YVRA 2LXHC 5D1KB 2VJFA 2ECGA 5KH7A 3Q1DA 2KFTA 2AN6A 5B76A 1HYJA 3DWDA 2YUCA 1WGMA 4AP4A 1WEOA 2LRIC 2CSZA 1WEMA 5C13A 5TABA 5KH3A 5AIUA 3QZVA 4H9DA 2ECWA 1WEPA 2OXQC 2Y43A 2ECTA 3N9OA 1WENA 5G05B 3N9LA 3FEHA 1E4UA 4B86C 3SOXA 1MM3A 3DDTA 2MD8C 2XOZA 4BHWA 2KKXA 5LKXA 2VPEA 2RR4A 3KDEC 2LGKA 2YYRA 4GNEA 4WA6A 2EGPA 4PPEA 3L11A 1JM7B 3T7LA 2L5UA 5DKAA 2LAUA 2QICA 2IDAA 2LDRA 4YABA 3SHBA 5J3XA 2YURA 4LLBA 2KYUA 2JM3A 2E61A 2P57A 2FSAA 3PURA 2HDPA 2FFWA 2YHOA 4MVTA 3O47A 2M13A 4YADA 3O33A 2CRWA 4X3GA 3FJUB 3LQJA 4LJNA 2LXPC 2IQJA 2F6JA 4F1PA 2M6MA 5H1UA 4A4CA 4AUQB 5JG6A 4R8PK 2NAAA 4I7BA 2G43A 4R2YA 3H7HA 3O37A 4NN2A 2LGVA 5B78A 2EODA 3LQHA 4LADB 2KWJA 2MD7B 2VJFB 2YU4A 3O35A 3M7KA 1WEUA 2LQ6A 2M85A 4WZ0A 1XWHA 4ZQLA 2YQMA 1WEVA 5FEYA 3ZVZB 5TRBA 2CSVA 5FB0A 3HCUA 2YREA 4TKPB 4FK5A 2CRRA 4ZDTA 3C6WA 2YSJA 2KU3A 4B7YC 4AVXA 1Z2QA 3HCTA 4F52B 3NG2A 5B75A 3ZPV1 2OWAA 2UZGA 3HCSA 5K3QA 2FUIA 3O34A 5TDRA 4YAXA 5G04B 1RMDA 3FL2A 5DINA 5C11A 4CA1A 3KV6A 2KR4A 2QIZA 2FUUA 1WEQA 3T9KA 4BBQA 3RTRB 4GNDA 4IC2A 2L80A 1FBVA 1WESA 4Q6FA 2D8UA 3EB5A 2XP0A 2ECJA 2VPDA 1MBMA 3GV4A 3U5PA 3SOUA 2MA5A 2CSYA 4I7CA 4UP0A 1JOCA 4FJCA 1G25A 2L7PA 1WILA 4L58A 1WFKA 2RSDA 2MA6A 4CCGX 2K17A 5SVIA 5SVYA 2EXUA 3C5KA 2QJ0A 4YBSA 1LDJB 3HTKC 2JUNA 3JUEA 5D1LB 2PNXA 3MHSA 1VYXA 1DCQA 2XEUA 4YBMA 2D8SA 1IYMA 4YC9A 2KE1A 2LGGA 2K16A 4WZ3B 3O36A 3LVQE 5EYAF 2JMJA 2CT2A 3RPGB 2F42A 4C9ZA 2H0DA 3U5NA 2JMIA 3RPGC 4AYCA 2YT5A 5AITA 4Z0RA 4IC3A 3FANA 3I2DA 4FIPA 1X4UA 2E6RA 3ZVYA 3FM8C 2G6QA 4LKAA 4GB0A 1WIMA 3E2DA 2BAYA 5G0FA 4UI9B 1FP0A 5FB1A 2PUYA
chains in the Genus database with same CATH topology
2CRWA 2KKYA 2D8UA 2FD4A 2YVRA 2XOYA 3FJUB 3M7KA 2JUNA 2XP0A 3JUEA 3PLWA 2IQJA 2LAUA 2XOCA 3FEHA 3Q1DA 4Z0RA 1DCQA 4F1PA 3LJUX 3KDEC 3DWDA 4O62A 3LVRE 5SVIB 2B0OE 3T9KA 3MDBC 4QQ4A 2L7PA 3FM8C 4OGCA 2EGMA 3E2DA 2CSVA 3LVQE 2MKEA 3DDTA 3H7HA 4OGEA 3LDYA 2DJAA 5SVIA 2JM3A 5SVYA 2EXUA 2CONA 2E61A 2XOZA 2YREA 2P57A 2KKXA 5SVXA 2CRRA 2OWAA 3SUBA 4H9DA 2FFWA 2RR4A 4Z0OA 5K3QA 3O47A 2M13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CON A; 
#chains in the Genus database with same CATH topology
 3ZTG A;  3SOW A;  2XOY A;  1CHC A;  2XB1 A;  2L43 A;  1MM2 A;  2VP7 A;  4A4B A;  3ZYQ A;  4O62 A;  1LDK C;  3LVR E;  2CKL A;  3LRQ A;  1X4J A;  3IHP A;  4LK9 A;  4A49 A;  3U5O A;  2CON A;  5LCW B;  2HYE D;  2VNF A;  2E6S A;  2KWN A;  2I50 A;  3O7A A;  3KNV A;  2KKY A;  4YBT A;  1Z60 A;  3L1X A;  4A0C D;  3ZNI A;  5KH9 A;  2C2V S;  3EB6 A;  5TBN A;  1BOR A;  1VFY A;  2B0O E;  5SVI B;  4P5O B;  2LN0 A;  4OGE A;  4I7D A;  2DJA A;  5LKU A;  2MT5 A;  2L0B A;  1HYI A;  2YHN A;  1K2F A;  2JRJ A;  5H1V A;  3M63 A;  4V3L C;  3N9N A;  3T6R A;  2MNZ A;  3KQI A;  2YSM A;  1N87 A;  1DVP A;  2ZET C;  2DX8 A;  2KGI A;  5B8D A;  2K1J A;  2KRE A;  2KWO A;  4QQ4 A;  1WE9 A;  3V43 A;  3U5M A;  3N9Q A;  2RI7 A;  2L75 A;  2EA6 A;  4MSX A;  3LDY A;  3O70 A;  2H0D B;  5SVX A;  4GNF A;  3SUB A;  2KIZ A;  2ECN A;  1T1H A;  4R7E A;  5H9M A;  4L7X A;  4ZUX U;  4QF2 A;  4AYC B;  3ASL A;  2MNY A;  5B77 A;  1U6G B;  2KWK A;  3PLW A;  2VJE B;  2XOC A;  2VPB A;  2ECI A;  3VK6 A;  5LKT A;  3FAO A;  5H1T A;  5LKZ A;  2KGG A;  2YW8 A;  3L1Z B;  3ZPV E;  3MDB C;  4W4U A;  4QF3 A;  3M99 A;  2YQL A;  4N4F A;  2DSM A;  5TDW A;  3M62 A;  1ZBD B;  4PTB A;  4YAT A;  5FER A;  4O64 A;  3LQI A;  2Y1M A;  4WZ2 A;  3MHH A;  2LGL A;  2CKL B;  3KV5 A;  1JM7 A;  3LJU X;  1VD4 A;  2VJE A;  5B79 A;  3PUQ A;  2F6N A;  2C2L A;  2MIQ A;  3N9P A;  2K4D A;  1WEW A;  1WEE A;  4S3O B;  2Y1N A;  1Z6U A;  2M1R A;  2FD4 A;  1V87 A;  4S3O C;  4UP5 A;  2ECV A;  5I3L A;  2M3H A;  3DQV R;  3PHD A;  4N3W A;  4XI1 A;  5D1M B;  3N9M A;  3GL6 A;  4OGC A;  2EGM A;  1X4I A;  2MUM A;  4FO9 A;  2MKE A;  2JMD A;  3DPL R;  1F62 A;  2VPG A;  4V3K C;  4Z0O A;  2G45 A;  4GNG A;  2LV9 A;  2YVR A;  2LXH C;  5D1K B;  2VJF A;  2ECG A;  5KH7 A;  3Q1D A;  2KFT A;  2AN6 A;  5B76 A;  1HYJ A;  3DWD A;  2YUC A;  1WGM A;  4AP4 A;  1WEO A;  2LRI C;  2CSZ A;  1WEM A;  5C13 A;  5TAB A;  5KH3 A;  5AIU A;  3QZV A;  4H9D A;  2ECW A;  1WEP A;  2OXQ C;  2Y43 A;  2ECT A;  3N9O A;  1WEN A;  5G05 B;  3N9L A;  3FEH A;  1E4U A;  4B86 C;  3SOX A;  1MM3 A;  3DDT A;  2MD8 C;  2XOZ A;  4BHW A;  2KKX A;  5LKX A;  2VPE A;  2RR4 A;  3KDE C;  2LGK A;  2YYR A;  4GNE A;  4WA6 A;  2EGP A;  4PPE A;  3L11 A;  1JM7 B;  3T7L A;  2L5U A;  5DKA A;  2LAU A;  2QIC A;  2IDA A;  2LDR A;  4YAB A;  3SHB A;  5J3X A;  2YUR A;  4LLB A;  2KYU A;  2JM3 A;  2E61 A;  2P57 A;  2FSA A;  3PUR A;  2HDP A;  2FFW A;  2YHO A;  4MVT A;  3O47 A;  2M13 A;  4YAD A;  3O33 A;  2CRW A;  4X3G A;  3FJU B;  3LQJ A;  4LJN A;  2LXP C;  2IQJ A;  2F6J A;  4F1P A;  2M6M A;  5H1U A;  4A4C A;  4AUQ B;  5JG6 A;  4R8P K;  2NAA A;  4I7B A;  2G43 A;  4R2Y A;  3H7H A;  3O37 A;  4NN2 A;  2LGV A;  5B78 A;  2EOD A;  3LQH A;  4LAD B;  2KWJ A;  2MD7 B;  2VJF B;  2YU4 A;  3O35 A;  3M7K A;  1WEU A;  2LQ6 A;  2M85 A;  4WZ0 A;  1XWH A;  4ZQL A;  2YQM A;  1WEV A;  5FEY A;  3ZVZ B;  5TRB A;  2CSV A;  5FB0 A;  3HCU A;  2YRE A;  4TKP B;  4FK5 A;  2CRR A;  4ZDT A;  3C6W A;  2YSJ A;  2KU3 A;  4B7Y C;  4AVX A;  1Z2Q A;  3HCT A;  4F52 B;  3NG2 A;  5B75 A;  3ZPV 1;  2OWA A;  2UZG A;  3HCS A;  5K3Q A;  2FUI A;  3O34 A;  5TDR A;  4YAX A;  5G04 B;  1RMD A;  3FL2 A;  5DIN A;  5C11 A;  4CA1 A;  3KV6 A;  2KR4 A;  2QIZ A;  2FUU A;  1WEQ A;  3T9K A;  4BBQ A;  3RTR B;  4GND A;  4IC2 A;  2L80 A;  1FBV A;  1WES A;  4Q6F A;  2D8U A;  3EB5 A;  2XP0 A;  2ECJ A;  2VPD A;  1MBM A;  3GV4 A;  3U5P A;  3SOU A;  2MA5 A;  2CSY A;  4I7C A;  4UP0 A;  1JOC A;  4FJC A;  1G25 A;  2L7P A;  1WIL A;  4L58 A;  1WFK A;  2RSD A;  2MA6 A;  4CCG X;  2K17 A;  5SVI A;  5SVY A;  2EXU A;  3C5K A;  2QJ0 A;  4YBS A;  1LDJ B;  3HTK C;  2JUN A;  3JUE A;  5D1L B;  2PNX A;  3MHS A;  1VYX A;  1DCQ A;  2XEU A;  4YBM A;  2D8S A;  1IYM A;  4YC9 A;  2KE1 A;  2LGG A;  2K16 A;  4WZ3 B;  3O36 A;  3LVQ E;  5EYA F;  2JMJ A;  2CT2 A;  3RPG B;  2F42 A;  4C9Z A;  2H0D A;  3U5N A;  2JMI A;  3RPG C;  4AYC A;  2YT5 A;  5AIT A;  4Z0R A;  4IC3 A;  3FAN A;  3I2D A;  4FIP A;  1X4U A;  2E6R A;  3ZVY A;  3FM8 C;  2G6Q A;  4LKA A;  4GB0 A;  1WIM A;  3E2D A;  2BAY A;  5G0F A;  4UI9 B;  1FP0 A;  5FB1 A;  2PUY A; 
#chains in the Genus database with same CATH homology
 2CRW A;  2KKY A;  2D8U A;  2FD4 A;  2YVR A;  2XOY A;  3FJU B;  3M7K A;  2JUN A;  2XP0 A;  3JUE A;  3PLW A;  2IQJ A;  2LAU A;  2XOC A;  3FEH A;  3Q1D A;  4Z0R A;  1DCQ A;  4F1P A;  3LJU X;  3KDE C;  3DWD A;  4O62 A;  3LVR E;  5SVI B;  2B0O E;  3T9K A;  3MDB C;  4QQ4 A;  2L7P A;  3FM8 C;  4OGC A;  2EGM A;  3E2D A;  2CSV A;  3LVQ E;  2MKE A;  3DDT A;  3H7H A;  4OGE A;  3LDY A;  2DJA A;  5SVI A;  2JM3 A;  5SVY A;  2EXU A;  2CON A;  2E61 A;  2XOZ A;  2YRE A;  2P57 A;  2KKX A;  5SVX A;  2CRR A;  2OWA A;  3SUB A;  4H9D A;  2FFW A;  2RR4 A;  4Z0O A;  5K3Q A;  3O47 A;  2M13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...