3PLWA

Ref protein from p1 bacteriophage
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
GRTPTAEERRIANALGALPCIACYMHGVISNEVSLHHIAGRTAPGCHKKQLPLCRWHHQHAAPAEVREKYPWLVPVHADGVVGGKKEFTLLNKSEMELLADAYEMANIMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination enhancement function protein
publication title Creating Directed Double-strand Breaks with the Ref Protein: A NOVEL RecA-DEPENDENT NUCLEASE FROM BACTERIOPHAGE P1.
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Hydrolase
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16786 RecA_dep_nuc Recombination enhancement, RecA-dependent nuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.190 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3plwA00
3PLWA
chains in the Genus database with same CATH superfamily
2JUNA 1U6GB 4I7CA 2CSYA 2VPBA 5LKTA 3SOWA 2VJFB 2KE1A 1DVPA 4WZ2A 2KWKA 2ECTA 2KWNA 2JRJA 4R2YA 3N9QA 2ECWA 3H7HA 1JM7B 2CT2A 1N87A 1WENA 3O35A 4V3LC 4ZQLA 3FAOA 3O34A 5TABA 1RMDA 3MDBC 3HCTA 4GNDA 3M99A 2E6RA 4V3KC 2YSJA 2JMJA 2EXUA 3KQIA 4AUQB 1MM3A 1WEMA 2E61A 2YUCA 4LK9A 2RR4A 2MIQA 4FJCA 3U5PA 5J3XA 2F42A 3GV4A 2KREA 3LQHA 5G04B 5H1UA 4FK5A 1K2FA 5SVYA 2CONA 2CRWA 4WA6A 2M6MA 2LDRA 5LCWB 4L58A 3E2DA 4QQ4A 4S3OB 4F1PA 2PNXA 3N9OA 2OXQC 1ZBDB 4B86C 2Y1NA 3N9PA 4Z0RA 3M7KA 4OGCA 4C9ZA 2YSMA 3FEHA 3LQIA 4GNGA 4A4BA 3LQJA 3ZTGA 2FUUA 2PUYA 3PURA 3PLWA 1XWHA 5B77A 3O36A 3N9MA 4FO9A 3ZVYA 5FERA 2YU4A 5C13A 1WEQA 2LAUA 4A0CD 3L11A 5KH9A 3O7AA 4LADB 2KYUA 2G45A 2L0BA 3SOXA 2KKXA 5TRBA 5FEYA 3NG2A 4F52B 4R8PK 2MA5A 4UP0A 2KWJA 3SOUA 3JUEA 5SVIA 4AYCB 3U5NA 1WEOA 2H0DA 2HYED 5FB1A 3I2DA 1FP0A 2L5UA 2LXHC 2KU3A 3L1ZB 1IYMA 2I50A 4AP4A 2CKLA 3FANA 2CSVA 2C2VS 2H0DB 1VYXA 5DKAA 2VJFA 3LJUX 4LJNA 5B78A 2CKLB 2JMDA 2KGIA 3LRQA 4P5OB 5K3QA 5TBNA 1BORA 4I7BA 2XB1A 2UZGA 4S3OC 5TDWA 1JM7A 1MM2A 2KIZA 5LKUA 4AVXA 5G0FA 4CCGX 1X4IA 3ASLA 1VD4A 4TKPB 2ECNA 2YT5A 2VJEA 2LRIC 2VPDA 2D8UA 2KGGA 3O37A 2LXPC 2LN0A 2FUIA 3LVQE 2VJEB 5B76A 4CA1A 1X4JA 2EGPA 3O47A 4MVTA 4YBSA 2MT5A 2KFTA 2XP0A 4A49A 3FL2A 2KWOA 2QJ0A 4OGEA 3KNVA 3T7LA 2QICA 2IQJA 2XOZA 2D8SA 1HYJA 2JMIA 4BHWA 3IHPA 1JOCA 1WILA 4GNEA 2MUMA 4I7DA 4R7EA 2VPEA 2FSAA 4PTBA 4W4UA 4UI9B 2M3HA 3U5OA 4YBMA 5DINA 2LGVA 3EB6A 4LLBA 5H1TA 1WESA 4YC9A 3KDEC 2LGKA 5TDRA 1WEPA 4L7XA 2XOYA 4YADA 5B75A 2VPGA 2HDPA 1WEWA 2DSMA 3HTKC 2LV9A 3MHSA 2LGLA 3KV6A 3PUQA 3ZVZB 2QIZA 3L1XA 1E4UA 3LVRE 1Z2QA 4QF2A 2CRRA 2M1RA 4XI1A 1Z6UA 3EB5A 2EGMA 2DJAA 4AYCA 4O62A 1WEVA 2C2LA 2E6SA 3PHDA 1HYIA 2ZETC 5AIUA 1WIMA 3LDYA 1LDJB 1WFKA 3FJUB 4N3WA 1DCQA 3C6WA 4ZDTA 4IC3A 2YHNA 3T9KA 1V87A 2RI7A 4UP5A 4PPEA 3DPLR 2XEUA 5D1KB 5KH7A 1WGMA 3QZVA 1FBVA 2MKEA 3RTRB 3V43A 4YAXA 2MD8C 2KKYA 2MA6A 2MD7B 3O70A 3Q1DA 5FB0A 4A4CA 2VP7A 1WEUA 5H9MA 1Z60A 1VFYA 1CHCA 4Q6FA 4GNFA 2Y1MA 2IDAA 5B8DA 2Y43A 4QF3A 4MSXA 3ZPV1 3DDTA 2K4DA 2AN6A 3ZYQA 2YHOA 5LKXA 2VNFA 2OWAA 1G25A 2K17A 4BBQA 3O33A 4LKAA 1WEEA 2YURA 3ZNIA 2F6JA 4WZ0A 4WZ3B 4B7YC 2YYRA 5C11A 4ZUXU 4H9DA 2B0OE 5KH3A 3FM8C 2YW8A 4IC2A 1WE9A 3M63A 3RPGC 5EYAF 4YABA 5JG6A 2FD4A 3HCUA 4NN2A 1LDKC 2L43A 2YREA 4Z0OA 2F6NA 2L80A 3MHHA 4O64A 3VK6A 1F62A 2LQ6A 3T6RA 4YATA 4N4FA 3U5MA 2M85A 2XOCA 3DQVR 2YVRA 3N9NA 2KR4A 5D1MB 5H1VA 2NAAA 2ECGA 2G6QA 4YBTA 3HCSA 2L7PA 2DX8A 2BAYA 4FIPA 2FFWA 2JM3A 2P57A 4GB0A 3ZPVE 1T1HA 2MNZA 3SHBA 2ECVA 5B79A 3KV5A 3RPGB 3GL6A 3N9LA 2M13A 2LGGA 2ECJA 2EODA 2MNYA 3DWDA 3M62A 2YQMA 5I3LA 5D1LB 2G43A 3C5KA 2K16A 3SUBA 2L75A 2EA6A 2ECIA 5AITA 5LKZA 4X3GA 5SVIB 1X4UA 2K1JA 5G05B 2CSZA 5SVXA 1MBMA 2RSDA 2YQLA
chains in the Genus database with same CATH topology
2JUNA 2IQJA 2DJAA 3FJUB 2JM3A 2P57A 3FM8C 3KDEC 2KKYA 2KKXA 2XOZA 3MDBC 2CONA 2CRWA 1DCQA 3LJUX 3Q1DA 5SVYA 3DDTA 2EXUA 2M13A 3PLWA 5K3QA 4O62A 2XOCA 2D8UA 3E2DA 2FD4A 2OWAA 2XOYA 4QQ4A 3DWDA 2YVRA 3T9KA 4F1PA 3LVQE 3JUEA 5SVIA 3SUBA 2E61A 4Z0RA 3M7KA 3LDYA 2LAUA 2L7PA 4OGCA 3O47A 2RR4A 2YREA 3FEHA 3LVRE 4Z0OA 5SVIB 3H7HA 2XP0A 2FFWA 2CRRA 2CSVA 2MKEA 5SVXA 4OGEA 4H9DA 2B0OE 2EGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLW A; 
#chains in the Genus database with same CATH topology
 2JUN A;  1U6G B;  4I7C A;  2CSY A;  2VPB A;  5LKT A;  3SOW A;  2VJF B;  2KE1 A;  1DVP A;  4WZ2 A;  2KWK A;  2ECT A;  2KWN A;  2JRJ A;  4R2Y A;  3N9Q A;  2ECW A;  3H7H A;  1JM7 B;  2CT2 A;  1N87 A;  1WEN A;  3O35 A;  4V3L C;  4ZQL A;  3FAO A;  3O34 A;  5TAB A;  1RMD A;  3MDB C;  3HCT A;  4GND A;  3M99 A;  2E6R A;  4V3K C;  2YSJ A;  2JMJ A;  2EXU A;  3KQI A;  4AUQ B;  1MM3 A;  1WEM A;  2E61 A;  2YUC A;  4LK9 A;  2RR4 A;  2MIQ A;  4FJC A;  3U5P A;  5J3X A;  2F42 A;  3GV4 A;  2KRE A;  3LQH A;  5G04 B;  5H1U A;  4FK5 A;  1K2F A;  5SVY A;  2CON A;  2CRW A;  4WA6 A;  2M6M A;  2LDR A;  5LCW B;  4L58 A;  3E2D A;  4QQ4 A;  4S3O B;  4F1P A;  2PNX A;  3N9O A;  2OXQ C;  1ZBD B;  4B86 C;  2Y1N A;  3N9P A;  4Z0R A;  3M7K A;  4OGC A;  4C9Z A;  2YSM A;  3FEH A;  3LQI A;  4GNG A;  4A4B A;  3LQJ A;  3ZTG A;  2FUU A;  2PUY A;  3PUR A;  3PLW A;  1XWH A;  5B77 A;  3O36 A;  3N9M A;  4FO9 A;  3ZVY A;  5FER A;  2YU4 A;  5C13 A;  1WEQ A;  2LAU A;  4A0C D;  3L11 A;  5KH9 A;  3O7A A;  4LAD B;  2KYU A;  2G45 A;  2L0B A;  3SOX A;  2KKX A;  5TRB A;  5FEY A;  3NG2 A;  4F52 B;  4R8P K;  2MA5 A;  4UP0 A;  2KWJ A;  3SOU A;  3JUE A;  5SVI A;  4AYC B;  3U5N A;  1WEO A;  2H0D A;  2HYE D;  5FB1 A;  3I2D A;  1FP0 A;  2L5U A;  2LXH C;  2KU3 A;  3L1Z B;  1IYM A;  2I50 A;  4AP4 A;  2CKL A;  3FAN A;  2CSV A;  2C2V S;  2H0D B;  1VYX A;  5DKA A;  2VJF A;  3LJU X;  4LJN A;  5B78 A;  2CKL B;  2JMD A;  2KGI A;  3LRQ A;  4P5O B;  5K3Q A;  5TBN A;  1BOR A;  4I7B A;  2XB1 A;  2UZG A;  4S3O C;  5TDW A;  1JM7 A;  1MM2 A;  2KIZ A;  5LKU A;  4AVX A;  5G0F A;  4CCG X;  1X4I A;  3ASL A;  1VD4 A;  4TKP B;  2ECN A;  2YT5 A;  2VJE A;  2LRI C;  2VPD A;  2D8U A;  2KGG A;  3O37 A;  2LXP C;  2LN0 A;  2FUI A;  3LVQ E;  2VJE B;  5B76 A;  4CA1 A;  1X4J A;  2EGP A;  3O47 A;  4MVT A;  4YBS A;  2MT5 A;  2KFT A;  2XP0 A;  4A49 A;  3FL2 A;  2KWO A;  2QJ0 A;  4OGE A;  3KNV A;  3T7L A;  2QIC A;  2IQJ A;  2XOZ A;  2D8S A;  1HYJ A;  2JMI A;  4BHW A;  3IHP A;  1JOC A;  1WIL A;  4GNE A;  2MUM A;  4I7D A;  4R7E A;  2VPE A;  2FSA A;  4PTB A;  4W4U A;  4UI9 B;  2M3H A;  3U5O A;  4YBM A;  5DIN A;  2LGV A;  3EB6 A;  4LLB A;  5H1T A;  1WES A;  4YC9 A;  3KDE C;  2LGK A;  5TDR A;  1WEP A;  4L7X A;  2XOY A;  4YAD A;  5B75 A;  2VPG A;  2HDP A;  1WEW A;  2DSM A;  3HTK C;  2LV9 A;  3MHS A;  2LGL A;  3KV6 A;  3PUQ A;  3ZVZ B;  2QIZ A;  3L1X A;  1E4U A;  3LVR E;  1Z2Q A;  4QF2 A;  2CRR A;  2M1R A;  4XI1 A;  1Z6U A;  3EB5 A;  2EGM A;  2DJA A;  4AYC A;  4O62 A;  1WEV A;  2C2L A;  2E6S A;  3PHD A;  1HYI A;  2ZET C;  5AIU A;  1WIM A;  3LDY A;  1LDJ B;  1WFK A;  3FJU B;  4N3W A;  1DCQ A;  3C6W A;  4ZDT A;  4IC3 A;  2YHN A;  3T9K A;  1V87 A;  2RI7 A;  4UP5 A;  4PPE A;  3DPL R;  2XEU A;  5D1K B;  5KH7 A;  1WGM A;  3QZV A;  1FBV A;  2MKE A;  3RTR B;  3V43 A;  4YAX A;  2MD8 C;  2KKY A;  2MA6 A;  2MD7 B;  3O70 A;  3Q1D A;  5FB0 A;  4A4C A;  2VP7 A;  1WEU A;  5H9M A;  1Z60 A;  1VFY A;  1CHC A;  4Q6F A;  4GNF A;  2Y1M A;  2IDA A;  5B8D A;  2Y43 A;  4QF3 A;  4MSX A;  3ZPV 1;  3DDT A;  2K4D A;  2AN6 A;  3ZYQ A;  2YHO A;  5LKX A;  2VNF A;  2OWA A;  1G25 A;  2K17 A;  4BBQ A;  3O33 A;  4LKA A;  1WEE A;  2YUR A;  3ZNI A;  2F6J A;  4WZ0 A;  4WZ3 B;  4B7Y C;  2YYR A;  5C11 A;  4ZUX U;  4H9D A;  2B0O E;  5KH3 A;  3FM8 C;  2YW8 A;  4IC2 A;  1WE9 A;  3M63 A;  3RPG C;  5EYA F;  4YAB A;  5JG6 A;  2FD4 A;  3HCU A;  4NN2 A;  1LDK C;  2L43 A;  2YRE A;  4Z0O A;  2F6N A;  2L80 A;  3MHH A;  4O64 A;  3VK6 A;  1F62 A;  2LQ6 A;  3T6R A;  4YAT A;  4N4F A;  3U5M A;  2M85 A;  2XOC A;  3DQV R;  2YVR A;  3N9N A;  2KR4 A;  5D1M B;  5H1V A;  2NAA A;  2ECG A;  2G6Q A;  4YBT A;  3HCS A;  2L7P A;  2DX8 A;  2BAY A;  4FIP A;  2FFW A;  2JM3 A;  2P57 A;  4GB0 A;  3ZPV E;  1T1H A;  2MNZ A;  3SHB A;  2ECV A;  5B79 A;  3KV5 A;  3RPG B;  3GL6 A;  3N9L A;  2M13 A;  2LGG A;  2ECJ A;  2EOD A;  2MNY A;  3DWD A;  3M62 A;  2YQM A;  5I3L A;  5D1L B;  2G43 A;  3C5K A;  2K16 A;  3SUB A;  2L75 A;  2EA6 A;  2ECI A;  5AIT A;  5LKZ A;  4X3G A;  5SVI B;  1X4U A;  2K1J A;  5G05 B;  2CSZ A;  5SVX A;  1MBM A;  2RSD A;  2YQL A; 
#chains in the Genus database with same CATH homology
 2JUN A;  2IQJ A;  2DJA A;  3FJU B;  2JM3 A;  2P57 A;  3FM8 C;  3KDE C;  2KKY A;  2KKX A;  2XOZ A;  3MDB C;  2CON A;  2CRW A;  1DCQ A;  3LJU X;  3Q1D A;  5SVY A;  3DDT A;  2EXU A;  2M13 A;  3PLW A;  5K3Q A;  4O62 A;  2XOC A;  2D8U A;  3E2D A;  2FD4 A;  2OWA A;  2XOY A;  4QQ4 A;  3DWD A;  2YVR A;  3T9K A;  4F1P A;  3LVQ E;  3JUE A;  5SVI A;  3SUB A;  2E61 A;  4Z0R A;  3M7K A;  3LDY A;  2LAU A;  2L7P A;  4OGC A;  3O47 A;  2RR4 A;  2YRE A;  3FEH A;  3LVR E;  4Z0O A;  5SVI B;  3H7H A;  2XP0 A;  2FFW A;  2CRR A;  2CSV A;  2MKE A;  5SVX A;  4OGE A;  4H9D A;  2B0O E;  2EGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...