3PLWA

Ref protein from p1 bacteriophage
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
GRTPTAEERRIANALGALPCIACYMHGVISNEVSLHHIAGRTAPGCHKKQLPLCRWHHQHAAPAEVREKYPWLVPVHADGVVGGKKEFTLLNKSEMELLADAYEMANIMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Creating Directed Double-strand Breaks with the Ref Protein: A NOVEL RecA-DEPENDENT NUCLEASE FROM BACTERIOPHAGE P1.
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Hydrolase
molecule keywords Recombination enhancement function protein
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16786 RecA_dep_nuc Recombination enhancement, RecA-dependent nuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.190 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3plwA00
3PLWA
chains in the Genus database with same CATH superfamily
2EXUA 2LXPC 2E61A 2CKLB 2YQMA 1LDJB 2DJAA 2L7PA 5EYAF 3HCTA 2YURA 2Y43A 3N9LA 3SOXA 2EODA 2M6MA 2ECJA 3MHSA 2VPGA 2FUUA 5FEYA 2ECNA 4IC3A 2FSAA 3ASLA 4UP0A 5H1TA 3SHBA 2YREA 3Q1DA 5I3LA 3O35A 2LV9A 2D8SA 5D1MB 3EB6A 4R7EA 3HCSA 1T1HA 3O36A 4YC9A 3SOWA 4V3LC 4LJNA 3PUQA 2MKEA 2I50A 1WEEA 5AITA 2E6RA 1WEQA 1F62A 4P5OB 2QIZA 3SUBA 1X4JA 3GV4A 5G04B 2PNXA 4GNEA 5SVIB 2YHNA 3C5KA 1E4UA 4OGEA 2L80A 5K3QA 3O34A 3M7KA 2KIZA 2CT2A 2DSMA 5SVIA 3U5MA 4WZ2A 2KWNA 3KV5A 4IC2A 2KKXA 5G0FA 4S3OC 2CSVA 2CONA 1K2FA 3N9QA 2KE1A 4BHWA 2DX8A 4N3WA 3N9MA 4YATA 2MT5A 2CRWA 4Z0RA 1Z2QA 4I7CA 4A49A 3ZPV1 1WGMA 1X4IA 2Y1NA 2L43A 2IDAA 2YUCA 2CKLA 4ZUXU 2YVRA 2FD4A 3L1ZB 2MA6A 2OWAA 5SVYA 2L5UA 2VJFA 1ZBDB 3I2DA 3O33A 4I7BA 2F6JA 1WE9A 2VJFB 2CRRA 4LADB 4B86C 2KGIA 1WILA 5DINA 2ZETC 5AIUA 3HCUA 5B8DA 4F52B 1CHCA 2VPBA 3LQHA 3V43A 1HYIA 2VJEB 4ZDTA 2MNYA 3O70A 4FK5A 4QF3A 2YSJA 2ECWA 2RR4A 2EGPA 2D8UA 4GNDA 3MHHA 2EGMA 3QZVA 3FEHA 2YYRA 3LVRE 2FUIA 2KGGA 3FM8C 3M99A 3VK6A 3NG2A 5LKXA 1V87A 3LRQA 4V3KC 4MVTA 2L0BA 2ECVA 3JUEA 4B7YC 1VD4A 1X4UA 1DCQA 3T7LA 3ZPVE 3KDEC 3ZNIA 4YBSA 4LK9A 4AVXA 4FO9A 2HYED 2H0DB 2F6NA 4WZ0A 4F1PA 3O37A 2LGVA 2KWKA 2KWJA 2JMIA 4PTBA 2LAUA 5H1UA 3M62A 5SVXA 3N9PA 2H0DA 3T6RA 5TRBA 3KNVA 4OGCA 3E2DA 5FB1A 4N4FA 1JM7B 2KR4A 5D1KB 2KU3A 4FIPA 2XOCA 3FAOA 2NAAA 4L7XA 2C2LA 4BBQA 5TDRA 1JM7A 4PPEA 2G45A 2KYUA 2LDRA 5B75A 5TABA 2JRJA 2ECGA 4GB0A 2JMJA 2XP0A 3DQVR 3EB5A 3PURA 2CSYA 2K17A 4CCGX 2LGKA 3GL6A 5D1LB 2M3HA 4AUQB 4UP5A 2OXQC 3RTRB 1IYMA 2XB1A 2UZGA 3L1XA 5B78A 4O64A 4R8PK 1JOCA 3M63A 2YT5A 1HYJA 1WIMA 1XWHA 1MM2A 3DWDA 1RMDA 4LLBA 2ECTA 3N9NA 2JMDA 2YHOA 2LGGA 2XOYA 1VYXA 2MD7B 2XEUA 5B79A 3FL2A 5JG6A 2M1RA 5G05B 1WEWA 4O62A 2JM3A 2VPDA 3DPLR 5KH7A 5KH9A 3T9KA 3LDYA 2MD8C 2M85A 2E6SA 2JUNA 2LQ6A 3LQIA 2EA6A 3U5PA 2VPEA 3RPGC 1WEVA 4I7DA 3U5OA 2RI7A 4YAXA 4A4BA 2M13A 4QF2A 3ZYQA 2QICA 3LVQE 5TDWA 2MA5A 2YU4A 3KV6A 2B0OE 1G25A 1WEUA 2AN6A 2YW8A 1VFYA 4AYCA 2RSDA 5LCWB 4MSXA 2KFTA 1WEPA 4FJCA 3HTKC 4L58A 2MNZA 3H7HA 1U6GB 2VNFA 5H1VA 5FERA 2YQLA 1DVPA 2VJEA 1MBMA 2Y1MA 4UI9B 5B77A 3FJUB 4XI1A 3LQJA 1WESA 1Z6UA 4YABA 5LKZA 1Z60A 1WEMA 1N87A 2ECIA 4LKAA 1FBVA 3FANA 5H9MA 2MUMA 3PHDA 1WEOA 3L11A 3PLWA 4YADA 5FB0A 3U5NA 5KH3A 2K16A 1BORA 2QJ0A 4GNFA 3SOUA 2K4DA 1LDKC 5TBNA 3DDTA 4NN2A 5C11A 2BAYA 4WZ3B 3ZVYA 2G6QA 4CA1A 2LRIC 3C6WA 5B76A 4H9DA 3O47A 2CSZA 2KKYA 2MIQA 5LKTA 2K1JA 3LJUX 4GNGA 2F42A 1MM3A 4X3GA 4Q6FA 1FP0A 5LKUA 4A0CD 3MDBC 4W4UA 4S3OB 4AYCB 4ZQLA 3O7AA 1WFKA 3IHPA 3ZVZB 4YBMA 5DKAA 2L75A 2LGLA 2IQJA 4YBTA 4A4CA 4TKPB 4AP4A 2LXHC 2LN0A 4QQ4A 2C2VS 3RPGB 4R2YA 2XOZA 4C9ZA 2P57A 2VP7A 2PUYA 3N9OA 5J3XA 4Z0OA 5C13A 2YSMA 2HDPA 3KQIA 2G43A 3ZTGA 1WENA 2FFWA 4WA6A 2KREA 2KWOA
chains in the Genus database with same CATH topology
2EXUA 2CRWA 3JUEA 3FJUB 3SUBA 4QQ4A 4Z0RA 1DCQA 2E61A 4O62A 2EGMA 2CRRA 2JM3A 2XOCA 3MDBC 3DDTA 2XOZA 3KDEC 3FEHA 5SVIB 3LVRE 2YREA 2P57A 4OGEA 2DJAA 3FM8C 3PLWA 3Q1DA 2YVRA 2FD4A 4Z0OA 5K3QA 3M7KA 2L7PA 2M13A 2OWAA 5SVYA 3H7HA 5SVIA 4OGCA 4F1PA 3LVQE 2KKXA 2XP0A 3DWDA 2CSVA 4H9DA 2CONA 2LAUA 2FFWA 3O47A 3T9KA 3LDYA 2IQJA 2MKEA 2KKYA 5SVXA 2RR4A 2JUNA 2B0OE 2D8UA 3LJUX 2XOYA 3E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLW A; 
#chains in the Genus database with same CATH topology
 2EXU A;  2LXP C;  2E61 A;  2CKL B;  2YQM A;  1LDJ B;  2DJA A;  2L7P A;  5EYA F;  3HCT A;  2YUR A;  2Y43 A;  3N9L A;  3SOX A;  2EOD A;  2M6M A;  2ECJ A;  3MHS A;  2VPG A;  2FUU A;  5FEY A;  2ECN A;  4IC3 A;  2FSA A;  3ASL A;  4UP0 A;  5H1T A;  3SHB A;  2YRE A;  3Q1D A;  5I3L A;  3O35 A;  2LV9 A;  2D8S A;  5D1M B;  3EB6 A;  4R7E A;  3HCS A;  1T1H A;  3O36 A;  4YC9 A;  3SOW A;  4V3L C;  4LJN A;  3PUQ A;  2MKE A;  2I50 A;  1WEE A;  5AIT A;  2E6R A;  1WEQ A;  1F62 A;  4P5O B;  2QIZ A;  3SUB A;  1X4J A;  3GV4 A;  5G04 B;  2PNX A;  4GNE A;  5SVI B;  2YHN A;  3C5K A;  1E4U A;  4OGE A;  2L80 A;  5K3Q A;  3O34 A;  3M7K A;  2KIZ A;  2CT2 A;  2DSM A;  5SVI A;  3U5M A;  4WZ2 A;  2KWN A;  3KV5 A;  4IC2 A;  2KKX A;  5G0F A;  4S3O C;  2CSV A;  2CON A;  1K2F A;  3N9Q A;  2KE1 A;  4BHW A;  2DX8 A;  4N3W A;  3N9M A;  4YAT A;  2MT5 A;  2CRW A;  4Z0R A;  1Z2Q A;  4I7C A;  4A49 A;  3ZPV 1;  1WGM A;  1X4I A;  2Y1N A;  2L43 A;  2IDA A;  2YUC A;  2CKL A;  4ZUX U;  2YVR A;  2FD4 A;  3L1Z B;  2MA6 A;  2OWA A;  5SVY A;  2L5U A;  2VJF A;  1ZBD B;  3I2D A;  3O33 A;  4I7B A;  2F6J A;  1WE9 A;  2VJF B;  2CRR A;  4LAD B;  4B86 C;  2KGI A;  1WIL A;  5DIN A;  2ZET C;  5AIU A;  3HCU A;  5B8D A;  4F52 B;  1CHC A;  2VPB A;  3LQH A;  3V43 A;  1HYI A;  2VJE B;  4ZDT A;  2MNY A;  3O70 A;  4FK5 A;  4QF3 A;  2YSJ A;  2ECW A;  2RR4 A;  2EGP A;  2D8U A;  4GND A;  3MHH A;  2EGM A;  3QZV A;  3FEH A;  2YYR A;  3LVR E;  2FUI A;  2KGG A;  3FM8 C;  3M99 A;  3VK6 A;  3NG2 A;  5LKX A;  1V87 A;  3LRQ A;  4V3K C;  4MVT A;  2L0B A;  2ECV A;  3JUE A;  4B7Y C;  1VD4 A;  1X4U A;  1DCQ A;  3T7L A;  3ZPV E;  3KDE C;  3ZNI A;  4YBS A;  4LK9 A;  4AVX A;  4FO9 A;  2HYE D;  2H0D B;  2F6N A;  4WZ0 A;  4F1P A;  3O37 A;  2LGV A;  2KWK A;  2KWJ A;  2JMI A;  4PTB A;  2LAU A;  5H1U A;  3M62 A;  5SVX A;  3N9P A;  2H0D A;  3T6R A;  5TRB A;  3KNV A;  4OGC A;  3E2D A;  5FB1 A;  4N4F A;  1JM7 B;  2KR4 A;  5D1K B;  2KU3 A;  4FIP A;  2XOC A;  3FAO A;  2NAA A;  4L7X A;  2C2L A;  4BBQ A;  5TDR A;  1JM7 A;  4PPE A;  2G45 A;  2KYU A;  2LDR A;  5B75 A;  5TAB A;  2JRJ A;  2ECG A;  4GB0 A;  2JMJ A;  2XP0 A;  3DQV R;  3EB5 A;  3PUR A;  2CSY A;  2K17 A;  4CCG X;  2LGK A;  3GL6 A;  5D1L B;  2M3H A;  4AUQ B;  4UP5 A;  2OXQ C;  3RTR B;  1IYM A;  2XB1 A;  2UZG A;  3L1X A;  5B78 A;  4O64 A;  4R8P K;  1JOC A;  3M63 A;  2YT5 A;  1HYJ A;  1WIM A;  1XWH A;  1MM2 A;  3DWD A;  1RMD A;  4LLB A;  2ECT A;  3N9N A;  2JMD A;  2YHO A;  2LGG A;  2XOY A;  1VYX A;  2MD7 B;  2XEU A;  5B79 A;  3FL2 A;  5JG6 A;  2M1R A;  5G05 B;  1WEW A;  4O62 A;  2JM3 A;  2VPD A;  3DPL R;  5KH7 A;  5KH9 A;  3T9K A;  3LDY A;  2MD8 C;  2M85 A;  2E6S A;  2JUN A;  2LQ6 A;  3LQI A;  2EA6 A;  3U5P A;  2VPE A;  3RPG C;  1WEV A;  4I7D A;  3U5O A;  2RI7 A;  4YAX A;  4A4B A;  2M13 A;  4QF2 A;  3ZYQ A;  2QIC A;  3LVQ E;  5TDW A;  2MA5 A;  2YU4 A;  3KV6 A;  2B0O E;  1G25 A;  1WEU A;  2AN6 A;  2YW8 A;  1VFY A;  4AYC A;  2RSD A;  5LCW B;  4MSX A;  2KFT A;  1WEP A;  4FJC A;  3HTK C;  4L58 A;  2MNZ A;  3H7H A;  1U6G B;  2VNF A;  5H1V A;  5FER A;  2YQL A;  1DVP A;  2VJE A;  1MBM A;  2Y1M A;  4UI9 B;  5B77 A;  3FJU B;  4XI1 A;  3LQJ A;  1WES A;  1Z6U A;  4YAB A;  5LKZ A;  1Z60 A;  1WEM A;  1N87 A;  2ECI A;  4LKA A;  1FBV A;  3FAN A;  5H9M A;  2MUM A;  3PHD A;  1WEO A;  3L11 A;  3PLW A;  4YAD A;  5FB0 A;  3U5N A;  5KH3 A;  2K16 A;  1BOR A;  2QJ0 A;  4GNF A;  3SOU A;  2K4D A;  1LDK C;  5TBN A;  3DDT A;  4NN2 A;  5C11 A;  2BAY A;  4WZ3 B;  3ZVY A;  2G6Q A;  4CA1 A;  2LRI C;  3C6W A;  5B76 A;  4H9D A;  3O47 A;  2CSZ A;  2KKY A;  2MIQ A;  5LKT A;  2K1J A;  3LJU X;  4GNG A;  2F42 A;  1MM3 A;  4X3G A;  4Q6F A;  1FP0 A;  5LKU A;  4A0C D;  3MDB C;  4W4U A;  4S3O B;  4AYC B;  4ZQL A;  3O7A A;  1WFK A;  3IHP A;  3ZVZ B;  4YBM A;  5DKA A;  2L75 A;  2LGL A;  2IQJ A;  4YBT A;  4A4C A;  4TKP B;  4AP4 A;  2LXH C;  2LN0 A;  4QQ4 A;  2C2V S;  3RPG B;  4R2Y A;  2XOZ A;  4C9Z A;  2P57 A;  2VP7 A;  2PUY A;  3N9O A;  5J3X A;  4Z0O A;  5C13 A;  2YSM A;  2HDP A;  3KQI A;  2G43 A;  3ZTG A;  1WEN A;  2FFW A;  4WA6 A;  2KRE A;  2KWO A; 
#chains in the Genus database with same CATH homology
 2EXU A;  2CRW A;  3JUE A;  3FJU B;  3SUB A;  4QQ4 A;  4Z0R A;  1DCQ A;  2E61 A;  4O62 A;  2EGM A;  2CRR A;  2JM3 A;  2XOC A;  3MDB C;  3DDT A;  2XOZ A;  3KDE C;  3FEH A;  5SVI B;  3LVR E;  2YRE A;  2P57 A;  4OGE A;  2DJA A;  3FM8 C;  3PLW A;  3Q1D A;  2YVR A;  2FD4 A;  4Z0O A;  5K3Q A;  3M7K A;  2L7P A;  2M13 A;  2OWA A;  5SVY A;  3H7H A;  5SVI A;  4OGC A;  4F1P A;  3LVQ E;  2KKX A;  2XP0 A;  3DWD A;  2CSV A;  4H9D A;  2CON A;  2LAU A;  2FFW A;  3O47 A;  3T9K A;  3LDY A;  2IQJ A;  2MKE A;  2KKY A;  5SVX A;  2RR4 A;  2JUN A;  2B0O E;  2D8U A;  3LJU X;  2XOY A;  3E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...