3PLWA

Ref protein from p1 bacteriophage
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
GRTPTAEERRIANALGALPCIACYMHGVISNEVSLHHIAGRTAPGCHKKQLPLCRWHHQHAAPAEVREKYPWLVPVHADGVVGGKKEFTLLNKSEMELLADAYEMANIMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Recombination enhancement function protein
publication title Creating Directed Double-strand Breaks with the Ref Protein: A NOVEL RecA-DEPENDENT NUCLEASE FROM BACTERIOPHAGE P1.
pubmed doi rcsb
source organism Enterobacteria phage p1
total genus 30
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16786 RecA_dep_nuc Recombination enhancement, RecA-dependent nuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.190 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3plwA00
3PLWA
chains in the Genus database with same CATH superfamily
5AITA 4R8PK 2ZETC 3N9LA 2MD8C 3N9MA 2LQ6A 2KIZA 1WEUA 4B7YC 2D8UA 1DVPA 2UZGA 2FSAA 3C5KA 2KE1A 3H7HA 2CSZA 3ZPV1 1DCQA 1U6GB 2ECGA 5TDRA 4AVXA 3GV4A 5KH3A 1WE9A 2IQJA 2YSMA 2EODA 3PLWA 1IYMA 2YSJA 4ZQLA 1BORA 3FJUB 4GNGA 4GNFA 3QZVA 5TRBA 2KFTA 4BHWA 4BBQA 3MHSA 3RPGC 4A4CA 2VPEA 2QICA 2I50A 5G04B 1CHCA 4F1PA 2LGLA 2VJEB 2NAAA 5TABA 4WZ2A 1WEPA 5JG6A 2ECWA 3I2DA 3ZTGA 1VFYA 3V43A 5KH7A 1JM7A 2K1JA 3HCTA 5DKAA 2Y1NA 2XP0A 3HTKC 3HCSA 4OGCA 2F42A 3IHPA 1RMDA 4FO9A 2L80A 4YBTA 3U5PA 5SVIA 2LGGA 5SVIB 2EGPA 2VPDA 2Y43A 2EGMA 1F62A 3SOWA 3PHDA 2KU3A 5FEYA 2CKLA 4P5OB 4YAXA 2MIQA 5B75A 4ZDTA 3O47A 2ECVA 4O64A 5LCWB 4MSXA 4I7DA 3VK6A 2CSYA 4WZ0A 3U5MA 2LN0A 4C9ZA 3PUQA 1WFKA 3FL2A 5EYAF 2DX8A 1E4UA 4V3LC 1XWHA 2ECJA 4UP5A 2K17A 2YU4A 2XEUA 2E6SA 2JMJA 4XI1A 4FK5A 2LXPC 3T7LA 3KDEC 3LDYA 3N9PA 3T6RA 3EB5A 3PURA 5K3QA 4A49A 2P57A 2JRJA 3DPLR 2L43A 2MUMA 1WENA 4TKPB 2RSDA 4YBMA 4UP0A 2L0BA 3N9QA 2F6JA 1FBVA 2L7PA 4LK9A 3RTRB 2IDAA 1MBMA 1MM3A 2KWOA 4MVTA 4NN2A 4PPEA 4YABA 3ZVYA 2YVRA 3FANA 4QF3A 3DQVR 2OWAA 2VPBA 2G6QA 5AIUA 5FERA 3SHBA 2DJAA 4ZUXU 5TBNA 4WZ3B 3KV5A 3O36A 1WEOA 2VJEA 3ZYQA 5C11A 2HDPA 2MNYA 4H9DA 2YHOA 4CA1A 2ECNA 3KQIA 2M3HA 2FUIA 2PNXA 3NG2A 3O7AA 3ZVZB 3T9KA 1HYIA 4LKAA 3O34A 5H1UA 4L58A 5H1TA 1LDJB 3SOXA 4LADB 2KKXA 2MA6A 2XOYA 2YREA 5B78A 4N3WA 1WEMA 3SUBA 4CCGX 5B8DA 2ECTA 2KGIA 5H9MA 4OGEA 3O33A 1T1HA 3KNVA 4V3KC 2YT5A 2E6RA 2MNZA 5J3XA 5B77A 4WA6A 2ECIA 3LQJA 2FFWA 4FIPA 4O62A 1WIMA 2QIZA 4L7XA 1MM2A 3KV6A 1WEWA 2FD4A 4S3OB 2FUUA 3FAOA 2LV9A 5D1LB 3L11A 3LRQA 1ZBDB 2LXHC 2KWNA 2L75A 4IC3A 3M7KA 4IC2A 1X4JA 4GNDA 5LKUA 1HYJA 2H0DA 1Z60A 2H0DB 2E61A 4Z0RA 2C2LA 3DWDA 2B0OE 1N87A 2LGVA 3C6WA 2K4DA 1JOCA 5B76A 4AYCB 1WGMA 2VP7A 5G05B 2QJ0A 2KREA 3FEHA 2KYUA 2XOCA 3MHHA 1WEVA 1X4IA 2KR4A 3LVRE 1WEEA 5I3LA 3LQIA 4A0CD 3FM8C 2M13A 1WESA 4QQ4A 2JUNA 2LRIC 2YYRA 2YHNA 3L1ZB 3JUEA 1G25A 5SVXA 2M1RA 4GB0A 4UI9B 5C13A 4YBSA 1V87A 4Q6FA 4A4BA 4PTBA 2PUYA 2KKYA 2G45A 5TDWA 2Y1MA 5LKTA 2KGGA 3O35A 3M99A 3HCUA 3MDBC 3E2DA 4AUQB 2DSMA 4LJNA 2L5UA 1K2FA 2YQLA 3Q1DA 2YUCA 5D1MB 2OXQC 5G0FA 2JMDA 2RI7A 2VNFA 3N9OA 5D1KB 2CRWA 2VPGA 2MT5A 3N9NA 1X4UA 3RPGB 4R2YA 4S3OC 3U5OA 1VD4A 2KWKA 3ZNIA 1JM7B 5KH9A 5B79A 4I7BA 2M6MA 4N4FA 4X3GA 3O70A 3LVQE 2RR4A 2G43A 4YC9A 2F6NA 2LDRA 3ZPVE 2CONA 4YADA 5SVYA 5LKXA 2LAUA 1VYXA 2LGKA 5FB0A 4FJCA 2C2VS 2EXUA 1LDKC 2VJFA 2CKLB 2VJFB 1Z2QA 1WILA 2CT2A 4AP4A 5H1VA 3DDTA 2HYED 2XB1A 5DINA 2D8SA 4LLBA 4Z0OA 2YQMA 4AYCA 2MA5A 2EA6A 4GNEA 2M85A 3L1XA 2YW8A 4W4UA 1FP0A 3EB6A 4B86C 3LJUX 3SOUA 2CSVA 2KWJA 5LKZA 2CRRA 4YATA 2JMIA 3O37A 3ASLA 2JM3A 3GL6A 2BAYA 3M62A 1Z6UA 3U5NA 4I7CA 2YURA 2K16A 2MKEA 1WEQA 2AN6A 4R7EA 5FB1A 4F52B 2MD7B 4QF2A 3M63A 2XOZA 3LQHA
chains in the Genus database with same CATH topology
2XP0A 2FFWA 2XOCA 3FEHA 3O47A 3Q1DA 4O62A 4OGCA 2DJAA 3LJUX 2L7PA 5SVXA 2CSVA 3KDEC 4F1PA 2CRRA 2KKXA 2XOYA 2E61A 3LVRE 4Z0RA 3LVQE 3DDTA 2YREA 2RR4A 2FD4A 3LDYA 2D8UA 3DWDA 2B0OE 2KKYA 2JM3A 5SVIA 4H9DA 3SUBA 5SVIB 2CRWA 3H7HA 5K3QA 1DCQA 2CONA 4Z0OA 5SVYA 2IQJA 2MKEA 2P57A 2EGMA 2LAUA 2YVRA 2M13A 3FM8C 3PLWA 4OGEA 3FJUB 3MDBC 3T9KA 4QQ4A 3M7KA 2JUNA 3E2DA 2EXUA 2OWAA 2XOZA 3JUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLW A; 
#chains in the Genus database with same CATH topology
 5AIT A;  4R8P K;  2ZET C;  3N9L A;  2MD8 C;  3N9M A;  2LQ6 A;  2KIZ A;  1WEU A;  4B7Y C;  2D8U A;  1DVP A;  2UZG A;  2FSA A;  3C5K A;  2KE1 A;  3H7H A;  2CSZ A;  3ZPV 1;  1DCQ A;  1U6G B;  2ECG A;  5TDR A;  4AVX A;  3GV4 A;  5KH3 A;  1WE9 A;  2IQJ A;  2YSM A;  2EOD A;  3PLW A;  1IYM A;  2YSJ A;  4ZQL A;  1BOR A;  3FJU B;  4GNG A;  4GNF A;  3QZV A;  5TRB A;  2KFT A;  4BHW A;  4BBQ A;  3MHS A;  3RPG C;  4A4C A;  2VPE A;  2QIC A;  2I50 A;  5G04 B;  1CHC A;  4F1P A;  2LGL A;  2VJE B;  2NAA A;  5TAB A;  4WZ2 A;  1WEP A;  5JG6 A;  2ECW A;  3I2D A;  3ZTG A;  1VFY A;  3V43 A;  5KH7 A;  1JM7 A;  2K1J A;  3HCT A;  5DKA A;  2Y1N A;  2XP0 A;  3HTK C;  3HCS A;  4OGC A;  2F42 A;  3IHP A;  1RMD A;  4FO9 A;  2L80 A;  4YBT A;  3U5P A;  5SVI A;  2LGG A;  5SVI B;  2EGP A;  2VPD A;  2Y43 A;  2EGM A;  1F62 A;  3SOW A;  3PHD A;  2KU3 A;  5FEY A;  2CKL A;  4P5O B;  4YAX A;  2MIQ A;  5B75 A;  4ZDT A;  3O47 A;  2ECV A;  4O64 A;  5LCW B;  4MSX A;  4I7D A;  3VK6 A;  2CSY A;  4WZ0 A;  3U5M A;  2LN0 A;  4C9Z A;  3PUQ A;  1WFK A;  3FL2 A;  5EYA F;  2DX8 A;  1E4U A;  4V3L C;  1XWH A;  2ECJ A;  4UP5 A;  2K17 A;  2YU4 A;  2XEU A;  2E6S A;  2JMJ A;  4XI1 A;  4FK5 A;  2LXP C;  3T7L A;  3KDE C;  3LDY A;  3N9P A;  3T6R A;  3EB5 A;  3PUR A;  5K3Q A;  4A49 A;  2P57 A;  2JRJ A;  3DPL R;  2L43 A;  2MUM A;  1WEN A;  4TKP B;  2RSD A;  4YBM A;  4UP0 A;  2L0B A;  3N9Q A;  2F6J A;  1FBV A;  2L7P A;  4LK9 A;  3RTR B;  2IDA A;  1MBM A;  1MM3 A;  2KWO A;  4MVT A;  4NN2 A;  4PPE A;  4YAB A;  3ZVY A;  2YVR A;  3FAN A;  4QF3 A;  3DQV R;  2OWA A;  2VPB A;  2G6Q A;  5AIU A;  5FER A;  3SHB A;  2DJA A;  4ZUX U;  5TBN A;  4WZ3 B;  3KV5 A;  3O36 A;  1WEO A;  2VJE A;  3ZYQ A;  5C11 A;  2HDP A;  2MNY A;  4H9D A;  2YHO A;  4CA1 A;  2ECN A;  3KQI A;  2M3H A;  2FUI A;  2PNX A;  3NG2 A;  3O7A A;  3ZVZ B;  3T9K A;  1HYI A;  4LKA A;  3O34 A;  5H1U A;  4L58 A;  5H1T A;  1LDJ B;  3SOX A;  4LAD B;  2KKX A;  2MA6 A;  2XOY A;  2YRE A;  5B78 A;  4N3W A;  1WEM A;  3SUB A;  4CCG X;  5B8D A;  2ECT A;  2KGI A;  5H9M A;  4OGE A;  3O33 A;  1T1H A;  3KNV A;  4V3K C;  2YT5 A;  2E6R A;  2MNZ A;  5J3X A;  5B77 A;  4WA6 A;  2ECI A;  3LQJ A;  2FFW A;  4FIP A;  4O62 A;  1WIM A;  2QIZ A;  4L7X A;  1MM2 A;  3KV6 A;  1WEW A;  2FD4 A;  4S3O B;  2FUU A;  3FAO A;  2LV9 A;  5D1L B;  3L11 A;  3LRQ A;  1ZBD B;  2LXH C;  2KWN A;  2L75 A;  4IC3 A;  3M7K A;  4IC2 A;  1X4J A;  4GND A;  5LKU A;  1HYJ A;  2H0D A;  1Z60 A;  2H0D B;  2E61 A;  4Z0R A;  2C2L A;  3DWD A;  2B0O E;  1N87 A;  2LGV A;  3C6W A;  2K4D A;  1JOC A;  5B76 A;  4AYC B;  1WGM A;  2VP7 A;  5G05 B;  2QJ0 A;  2KRE A;  3FEH A;  2KYU A;  2XOC A;  3MHH A;  1WEV A;  1X4I A;  2KR4 A;  3LVR E;  1WEE A;  5I3L A;  3LQI A;  4A0C D;  3FM8 C;  2M13 A;  1WES A;  4QQ4 A;  2JUN A;  2LRI C;  2YYR A;  2YHN A;  3L1Z B;  3JUE A;  1G25 A;  5SVX A;  2M1R A;  4GB0 A;  4UI9 B;  5C13 A;  4YBS A;  1V87 A;  4Q6F A;  4A4B A;  4PTB A;  2PUY A;  2KKY A;  2G45 A;  5TDW A;  2Y1M A;  5LKT A;  2KGG A;  3O35 A;  3M99 A;  3HCU A;  3MDB C;  3E2D A;  4AUQ B;  2DSM A;  4LJN A;  2L5U A;  1K2F A;  2YQL A;  3Q1D A;  2YUC A;  5D1M B;  2OXQ C;  5G0F A;  2JMD A;  2RI7 A;  2VNF A;  3N9O A;  5D1K B;  2CRW A;  2VPG A;  2MT5 A;  3N9N A;  1X4U A;  3RPG B;  4R2Y A;  4S3O C;  3U5O A;  1VD4 A;  2KWK A;  3ZNI A;  1JM7 B;  5KH9 A;  5B79 A;  4I7B A;  2M6M A;  4N4F A;  4X3G A;  3O70 A;  3LVQ E;  2RR4 A;  2G43 A;  4YC9 A;  2F6N A;  2LDR A;  3ZPV E;  2CON A;  4YAD A;  5SVY A;  5LKX A;  2LAU A;  1VYX A;  2LGK A;  5FB0 A;  4FJC A;  2C2V S;  2EXU A;  1LDK C;  2VJF A;  2CKL B;  2VJF B;  1Z2Q A;  1WIL A;  2CT2 A;  4AP4 A;  5H1V A;  3DDT A;  2HYE D;  2XB1 A;  5DIN A;  2D8S A;  4LLB A;  4Z0O A;  2YQM A;  4AYC A;  2MA5 A;  2EA6 A;  4GNE A;  2M85 A;  3L1X A;  2YW8 A;  4W4U A;  1FP0 A;  3EB6 A;  4B86 C;  3LJU X;  3SOU A;  2CSV A;  2KWJ A;  5LKZ A;  2CRR A;  4YAT A;  2JMI A;  3O37 A;  3ASL A;  2JM3 A;  3GL6 A;  2BAY A;  3M62 A;  1Z6U A;  3U5N A;  4I7C A;  2YUR A;  2K16 A;  2MKE A;  1WEQ A;  2AN6 A;  4R7E A;  5FB1 A;  4F52 B;  2MD7 B;  4QF2 A;  3M63 A;  2XOZ A;  3LQH A; 
#chains in the Genus database with same CATH homology
 2XP0 A;  2FFW A;  2XOC A;  3FEH A;  3O47 A;  3Q1D A;  4O62 A;  4OGC A;  2DJA A;  3LJU X;  2L7P A;  5SVX A;  2CSV A;  3KDE C;  4F1P A;  2CRR A;  2KKX A;  2XOY A;  2E61 A;  3LVR E;  4Z0R A;  3LVQ E;  3DDT A;  2YRE A;  2RR4 A;  2FD4 A;  3LDY A;  2D8U A;  3DWD A;  2B0O E;  2KKY A;  2JM3 A;  5SVI A;  4H9D A;  3SUB A;  5SVI B;  2CRW A;  3H7H A;  5K3Q A;  1DCQ A;  2CON A;  4Z0O A;  5SVY A;  2IQJ A;  2MKE A;  2P57 A;  2EGM A;  2LAU A;  2YVR A;  2M13 A;  3FM8 C;  3PLW A;  4OGE A;  3FJU B;  3MDB C;  3T9K A;  4QQ4 A;  3M7K A;  2JUN A;  3E2D A;  2EXU A;  2OWA A;  2XOZ A;  3JUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...