4NN2A

Protein crystal structure of human borjeson-forssman-lehmann syndrome associated protein phf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
b'TRPKCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKLYCKNHSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 6
publication title Crystal Structure of the second extended PHD domain of human PHF6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13771 zf-HC5HC2H PHD-like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4nn2A00
3L11A 1WEVA 2MD7B 2Y1MA 1WEWA 4C9ZA 4AYCB 2YQMA 2MA6A 3HCTA 3O33A 2L80A 1T1HA 5C13A 2G43A 2M6MA 2VJEB 5TDWA 4IC3A 3LQJA 2LGLA 2K4DA 4GNGA 1WFKA 3KV6A 5H1UA 1BORA 4MVTA 5TABA 2LGKA 3ZVYA 4QF2A 3GL6A 4R7EA 5JG6A 1MM3A 4R8PK 5J3XA 4CCGX 1N87A 2M3HA 4YADA 2YU4A 4WZ3B 2MNYA 1WE9A 3DPLR 1DVPA 1HYIA 3T7LA 4L7XA 3GV4A 4YAXA 3KQIA 2KWOA 4YBSA 5LKZA 2YUCA 1VYXA 2Y1NA 3L1XA 2D8SA 2VJFB 5LKXA 4UI9B 2YURA 2MNZA 3PUQA 1RMDA 2ECJA 4XI1A 4LADB 4N4FA 4A49A 2MA5A 5H1TA 2ECWA 2LGVA 1WEOA 5B79A 3VK6A 3LQIA 2F6NA 3EB5A 2CSZA 2JMJA 2NAAA 4Q6FA 2YHOA 2BAYA 2K16A 5B78A 4I7DA 2MT5A 4I7CA 1WEMA 4WZ0A 4N3WA 3N9OA 2JRJA 2MUMA 2ZETC 4WA6A 2QJ0A 2ECGA 4P5OB 3T6RA 2G45A 5TBNA 2YYRA 4GB0A 4O64A 3SHBA 2CKLB 4CA1A 3FL2A 5TRBA 5LKUA 2YW8A 2E6RA 4AP4A 1JM7B 2C2LA 2Y43A 2KREA 2VPDA 4YABA 4B7YC 2IDAA 1WIMA 1WILA 2JMIA 2YSJA 3RPGB 5LCWB 2RI7A 2H0DA 2F42A 2QIZA 5I3LA 2KFTA 1CHCA 2VNFA 4LJNA 4FIPA 4LK9A 2MIQA 2VP7A 2DX8A 4W4UA 4LKAA 2YT5A 2EGPA 2ECVA 2YREA 4ZQLA 2F6JA 3IHPA 5DINA 3ZPV1 3L1ZB 5FERA 2CSYA 5EYAF 5B76A 4PTBA 5B77A 2JMDA 2MD8C 4R2YA 3V43A 5AIUA 1WEUA 1FBVA 2YQLA 4QF3A 4GNEA 3HTKC 2LDRA 2EODA 5D1MB 3ZPVE 3ZNIA 2AN6A 4BHWA 2VPGA 3HCUA 1V87A 2HDPA 3MHSA 2LV9A 4FJCA 2RSDA 4PPEA 3O36A 3PHDA 3M62A 2YHNA 3MHHA 4S3OB 3M99A 1HYJA 5D1LB 1XWHA 4ZDTA 2G6QA 2CT2A 4A4BA 4F52B 4NN2A 4UP5A 4BBQA 4YATA 3EB6A 3C6WA 3U5NA 5G0FA 3O35A 4AYCA 2XB1A 1E4UA 2LGGA 1X4JA 3LQHA 2L75A 4GNDA 1ZBDB 4X3GA 2XEUA 4LLBA 1WEQA 3NG2A 2ECTA 2VJEA 2KIZA 1WESA 2LRIC 3ASLA 2LXHC 4AVXA 2KR4A 3HCSA 1X4IA 2LQ6A 3DQVR 1G25A 1Z60A 3O37A 1WEEA 2KGGA 4WZ2A 5G05B 2LXPC 2L5UA 3O34A 3O70A 1Z2QA 3LRQA 4FK5A 4V3LC 2KYUA 2FUIA 5C11A 2KGIA 3O7AA 1MM2A 1WEPA 2YSMA 3RPGC 4IC2A 4L58A 4UP0A 4YC9A 2VJFA 1F62A 1WENA 2PNXA 3U5MA 3RTRB 3N9MA 2I50A 2KE1A 4A4CA 4B86C 2H0DB 2KWNA 3KNVA 2E6SA 5AITA 3M63A 4FO9A 3N9PA 3QZVA 4MSXA 4I7BA 3SOWA 1VD4A 3N9QA 5H1VA 4ZUXU 2KU3A 1LDKC 5FB0A 2KWKA 5D1KB 2KWJA 4YBTA 3PURA 3U5PA 5FB1A 2M1RA 3ZTGA 2VPEA 5KH9A 1U6GB 3N9LA 5B75A 3I2DA 4V3KC 1IYMA 5G04B 2C2VS 2L43A 3SOUA 2FUUA 1WGMA 2VPBA 2EA6A 5TDRA 5KH7A 2UZGA 2HYED 3C5KA 5KH3A 3N9NA 2L0BA 2PUYA 2FSAA 3ZVZB 2CKLA 4A0CD 3KV5A 1FP0A 2K1JA 1JM7A 2ECIA 3SOXA 2ECNA 1K2FA 1JOCA 4S3OC 4YBMA 1VFYA 5H9MA 1LDJB 4GNFA 5FEYA 2LN0A 5B8DA 3ZYQA 1X4UA 2M85A 2OXQC 5LKTA 3U5OA 1Z6UA 2QICA 5DKAA 4AUQB 2K17A 4TKPB
chains in the Genus database with same CATH superfamily
3L11A 2D8UA 1WEVA 2DJAA 2MD7B 2Y1MA 1WEWA 4C9ZA 4AYCB 2YQMA 2MA6A 3HCTA 3O33A 2L80A 1T1HA 5C13A 2G43A 2M6MA 2DSMA 2VJEB 3FJUB 5TDWA 4IC3A 3LQJA 2LGLA 2K4DA 4GNGA 1WFKA 3KV6A 5H1UA 1BORA 3O47A 2OWAA 4MVTA 5TABA 2LGKA 5K3QA 3ZVYA 4QF2A 3GL6A 4R7EA 5JG6A 1MM3A 3Q1DA 4R8PK 5J3XA 4CCGX 1N87A 2EXUA 2M3HA 3FM8C 2YU4A 4WZ3B 4YADA 2MNYA 1WE9A 2LAUA 3DPLR 1DVPA 1HYIA 3T7LA 4L7XA 3GV4A 4YAXA 3KQIA 5SVXA 2KWOA 4YBSA 5LKZA 2YUCA 1VYXA 2Y1NA 3LVRE 3L1XA 2IQJA 2D8SA 2VJFB 5LKXA 4UI9B 2YURA 2MNZA 3PUQA 1RMDA 2ECJA 4XI1A 4LADB 4N4FA 4A49A 2MA5A 5H1TA 2ECWA 2LGVA 1WEOA 5B79A 3VK6A 3LQIA 2F6NA 3EB5A 3FANA 2CSZA 2JMJA 2NAAA 4Q6FA 3FEHA 2YHOA 2BAYA 2K16A 5B78A 2KKYA 2MT5A 4I7DA 4I7CA 1WEMA 4WZ0A 4N3WA 2CRRA 3N9OA 2JRJA 2MUMA 2ZETC 4WA6A 2QJ0A 2ECGA 3SUBA 4P5OB 3T6RA 2G45A 5TBNA 2YYRA 4GB0A 4O64A 3SHBA 3PLWA 2CKLB 4CA1A 3FL2A 5TRBA 5LKUA 2YW8A 2E6RA 4Z0RA 4AP4A 1JM7B 4Z0OA 2FD4A 2L7PA 2C2LA 2Y43A 2KREA 2VPDA 4YABA 4B7YC 2IDAA 1WIMA 1WILA 2JMIA 2YSJA 3RPGB 5LCWB 2RI7A 2H0DA 2F42A 2QIZA 5I3LA 3KDEC 2KFTA 4O62A 1CHCA 2VNFA 4LJNA 5SVIB 4FIPA 4LK9A 2MIQA 2VP7A 2DX8A 4W4UA 3LJUX 3LVQE 4LKAA 2XOZA 2CONA 2YT5A 2EGPA 2ECVA 2YREA 4ZQLA 2F6JA 3IHPA 5DINA 3ZPV1 3L1ZB 5FERA 2CSYA 2E61A 3LDYA 5EYAF 5B76A 4PTBA 5B77A 2JMDA 2MD8C 4R2YA 3V43A 5AIUA 1WEUA 1FBVA 2YQLA 4QF3A 4GNEA 3HTKC 2LDRA 2EODA 5D1MB 3ZPVE 3ZNIA 2AN6A 4BHWA 2VPGA 3HCUA 1V87A 2HDPA 3MHSA 2LV9A 4FJCA 2RSDA 4PPEA 3O36A 3PHDA 3M62A 2YHNA 3MHHA 4S3OB 3M99A 2JM3A 1HYJA 5D1LB 1XWHA 3MDBC 4ZDTA 2G6QA 2CT2A 4A4BA 4F52B 4NN2A 4UP5A 4BBQA 4YATA 3EB6A 3C6WA 3U5NA 5G0FA 3O35A 4AYCA 2XB1A 1E4UA 2LGGA 1X4JA 3LQHA 2B0OE 2L75A 2CRWA 4GNDA 2CSVA 1ZBDB 4X3GA 2XEUA 4LLBA 4OGCA 1WEQA 3NG2A 2ECTA 2VJEA 2KIZA 1WESA 3JUEA 2LRIC 3ASLA 2LXHC 4AVXA 2KR4A 3HCSA 1X4IA 2LQ6A 3DQVR 1G25A 1Z60A 3O37A 3FAOA 4OGEA 1WEEA 2KGGA 3T9KA 4WZ2A 5G05B 2LXPC 2L5UA 3O34A 2XOCA 3O70A 1Z2QA 3LRQA 4FK5A 4V3LC 2KYUA 2FUIA 5C11A 2KGIA 2JUNA 3O7AA 1MM2A 2KKXA 1WEPA 2YSMA 3RPGC 4IC2A 4L58A 4UP0A 4YC9A 2VJFA 1F62A 1WENA 2PNXA 3U5MA 3RTRB 3N9MA 2I50A 2KE1A 4A4CA 4QQ4A 4B86C 2H0DB 2KWNA 3KNVA 2E6SA 5AITA 3M63A 4FO9A 3N9PA 2XP0A 3QZVA 4MSXA 4I7BA 2MKEA 3SOWA 1VD4A 3N9QA 5H1VA 4ZUXU 2KU3A 1LDKC 5FB0A 2KWKA 5D1KB 2KWJA 4YBTA 3PURA 3U5PA 5FB1A 2M1RA 3ZTGA 2VPEA 5KH9A 3H7HA 1U6GB 3N9LA 5B75A 3I2DA 1MBMA 2M13A 4V3KC 1IYMA 5G04B 2C2VS 2L43A 2EGMA 3SOUA 2FUUA 1WGMA 2VPBA 2EA6A 5TDRA 5KH7A 2UZGA 3DDTA 2HYED 4H9DA 3C5KA 5KH3A 2XOYA 3N9NA 2L0BA 2PUYA 2FSAA 3E2DA 2CKLA 3ZVZB 4A0CD 3KV5A 1FP0A 2K1JA 1JM7A 2ECIA 3SOXA 2ECNA 1K2FA 1JOCA 2RR4A 4S3OC 4YBMA 1VFYA 3M7KA 5H9MA 5SVYA 1LDJB 2P57A 4GNFA 5FEYA 2LN0A 3DWDA 5B8DA 1DCQA 3ZYQA 1X4UA 2M85A 2OXQC 5LKTA 3U5OA 4F1PA 1Z6UA 2QICA 5DKAA 4AUQB 2K17A 2YVRA 5SVIA 2FFWA 4TKPB
chains in the Genus database with same CATH topology
3L11A 1WEVA 2MD7B 2Y1MA 1WEWA 4C9ZA 4AYCB 2YQMA 2MA6A 3HCTA 3O33A 2L80A 1T1HA 5C13A 2G43A 2M6MA 2VJEB 5TDWA 4IC3A 3LQJA 2LGLA 2K4DA 4GNGA 1WFKA 3KV6A 5H1UA 1BORA 4MVTA 5TABA 2LGKA 3ZVYA 4QF2A 3GL6A 4R7EA 5JG6A 1MM3A 4R8PK 5J3XA 4CCGX 1N87A 2M3HA 4YADA 2YU4A 4WZ3B 2MNYA 1WE9A 3DPLR 1DVPA 1HYIA 3T7LA 4L7XA 3GV4A 4YAXA 3KQIA 2KWOA 4YBSA 5LKZA 2YUCA 1VYXA 2Y1NA 3L1XA 2D8SA 2VJFB 5LKXA 4UI9B 2YURA 2MNZA 3PUQA 1RMDA 2ECJA 4XI1A 4LADB 4N4FA 4A49A 2MA5A 5H1TA 2ECWA 2LGVA 1WEOA 5B79A 3VK6A 3LQIA 2F6NA 3EB5A 2CSZA 2JMJA 2NAAA 4Q6FA 2YHOA 2BAYA 2K16A 5B78A 4I7DA 2MT5A 4I7CA 1WEMA 4WZ0A 4N3WA 3N9OA 2JRJA 2MUMA 2ZETC 4WA6A 2QJ0A 2ECGA 4P5OB 3T6RA 2G45A 5TBNA 2YYRA 4GB0A 4O64A 3SHBA 2CKLB 4CA1A 3FL2A 5TRBA 5LKUA 2YW8A 2E6RA 4AP4A 1JM7B 2C2LA 2Y43A 2KREA 2VPDA 4YABA 4B7YC 2IDAA 1WIMA 1WILA 2JMIA 2YSJA 3RPGB 5LCWB 2RI7A 2H0DA 2F42A 2QIZA 5I3LA 2KFTA 1CHCA 2VNFA 4LJNA 4FIPA 4LK9A 2MIQA 2VP7A 2DX8A 4W4UA 4LKAA 2YT5A 2EGPA 2ECVA 2YREA 4ZQLA 2F6JA 3IHPA 5DINA 3ZPV1 3L1ZB 5FERA 2CSYA 5EYAF 5B76A 4PTBA 5B77A 2JMDA 2MD8C 4R2YA 3V43A 5AIUA 1WEUA 1FBVA 2YQLA 4QF3A 4GNEA 3HTKC 2LDRA 2EODA 5D1MB 3ZPVE 3ZNIA 2AN6A 4BHWA 2VPGA 3HCUA 1V87A 2HDPA 3MHSA 2LV9A 4FJCA 2RSDA 4PPEA 3O36A 3PHDA 3M62A 2YHNA 3MHHA 4S3OB 3M99A 1HYJA 5D1LB 1XWHA 4ZDTA 2G6QA 2CT2A 4A4BA 4F52B 4NN2A 4UP5A 4BBQA 4YATA 3EB6A 3C6WA 3U5NA 5G0FA 3O35A 4AYCA 2XB1A 1E4UA 2LGGA 1X4JA 3LQHA 2L75A 4GNDA 1ZBDB 4X3GA 2XEUA 4LLBA 1WEQA 3NG2A 2ECTA 2VJEA 2KIZA 1WESA 2LRIC 3ASLA 2LXHC 4AVXA 2KR4A 3HCSA 1X4IA 2LQ6A 3DQVR 1G25A 1Z60A 3O37A 1WEEA 2KGGA 4WZ2A 5G05B 2LXPC 2L5UA 3O34A 3O70A 1Z2QA 3LRQA 4FK5A 4V3LC 2KYUA 2FUIA 5C11A 2KGIA 3O7AA 1MM2A 1WEPA 2YSMA 3RPGC 4IC2A 4L58A 4UP0A 4YC9A 2VJFA 1F62A 1WENA 2PNXA 3U5MA 3RTRB 3N9MA 2I50A 2KE1A 4A4CA 4B86C 2H0DB 2KWNA 3KNVA 2E6SA 5AITA 3M63A 4FO9A 3N9PA 3QZVA 4MSXA 4I7BA 3SOWA 1VD4A 3N9QA 5H1VA 4ZUXU 2KU3A 1LDKC 5FB0A 2KWKA 5D1KB 2KWJA 4YBTA 3PURA 3U5PA 5FB1A 2M1RA 3ZTGA 2VPEA 5KH9A 1U6GB 3N9LA 5B75A 3I2DA 4V3KC 1IYMA 5G04B 2C2VS 2L43A 3SOUA 2FUUA 1WGMA 2VPBA 2EA6A 5TDRA 5KH7A 2UZGA 2HYED 3C5KA 5KH3A 3N9NA 2L0BA 2PUYA 2FSAA 3ZVZB 2CKLA 4A0CD 3KV5A 1FP0A 2K1JA 1JM7A 2ECIA 3SOXA 2ECNA 1K2FA 1JOCA 4S3OC 4YBMA 1VFYA 5H9MA 1LDJB 4GNFA 5FEYA 2LN0A 5B8DA 3ZYQA 1X4UA 2M85A 2OXQC 5LKTA 3U5OA 1Z6UA 2QICA 5DKAA 4AUQB 2K17A 4TKPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  1WEV A;  2MD7 B;  2Y1M A;  1WEW A;  4C9Z A;  4AYC B;  2YQM A;  2MA6 A;  3HCT A;  3O33 A;  2L80 A;  1T1H A;  5C13 A;  2G43 A;  2M6M A;  2VJE B;  5TDW A;  4IC3 A;  3LQJ A;  2LGL A;  2K4D A;  4GNG A;  1WFK A;  3KV6 A;  5H1U A;  1BOR A;  4MVT A;  5TAB A;  2LGK A;  3ZVY A;  4QF2 A;  3GL6 A;  4R7E A;  5JG6 A;  1MM3 A;  4R8P K;  5J3X A;  4CCG X;  1N87 A;  2M3H A;  4YAD A;  2YU4 A;  4WZ3 B;  2MNY A;  1WE9 A;  3DPL R;  1DVP A;  1HYI A;  3T7L A;  4L7X A;  3GV4 A;  4YAX A;  3KQI A;  2KWO A;  4YBS A;  5LKZ A;  2YUC A;  1VYX A;  2Y1N A;  3L1X A;  2D8S A;  2VJF B;  5LKX A;  4UI9 B;  2YUR A;  2MNZ A;  3PUQ A;  1RMD A;  2ECJ A;  4XI1 A;  4LAD B;  4N4F A;  4A49 A;  2MA5 A;  5H1T A;  2ECW A;  2LGV A;  1WEO A;  5B79 A;  3VK6 A;  3LQI A;  2F6N A;  3EB5 A;  2CSZ A;  2JMJ A;  2NAA A;  4Q6F A;  2YHO A;  2BAY A;  2K16 A;  5B78 A;  4I7D A;  2MT5 A;  4I7C A;  1WEM A;  4WZ0 A;  4N3W A;  3N9O A;  2JRJ A;  2MUM A;  2ZET C;  4WA6 A;  2QJ0 A;  2ECG A;  4P5O B;  3T6R A;  2G45 A;  5TBN A;  2YYR A;  4GB0 A;  4O64 A;  3SHB A;  2CKL B;  4CA1 A;  3FL2 A;  5TRB A;  5LKU A;  2YW8 A;  2E6R A;  4AP4 A;  1JM7 B;  2C2L A;  2Y43 A;  2KRE A;  2VPD A;  4YAB A;  4B7Y C;  2IDA A;  1WIM A;  1WIL A;  2JMI A;  2YSJ A;  3RPG B;  5LCW B;  2RI7 A;  2H0D A;  2F42 A;  2QIZ A;  5I3L A;  2KFT A;  1CHC A;  2VNF A;  4LJN A;  4FIP A;  4LK9 A;  2MIQ A;  2VP7 A;  2DX8 A;  4W4U A;  4LKA A;  2YT5 A;  2EGP A;  2ECV A;  2YRE A;  4ZQL A;  2F6J A;  3IHP A;  5DIN A;  3ZPV 1;  3L1Z B;  5FER A;  2CSY A;  5EYA F;  5B76 A;  4PTB A;  5B77 A;  2JMD A;  2MD8 C;  4R2Y A;  3V43 A;  5AIU A;  1WEU A;  1FBV A;  2YQL A;  4QF3 A;  4GNE A;  3HTK C;  2LDR A;  2EOD A;  5D1M B;  3ZPV E;  3ZNI A;  2AN6 A;  4BHW A;  2VPG A;  3HCU A;  1V87 A;  2HDP A;  3MHS A;  2LV9 A;  4FJC A;  2RSD A;  4PPE A;  3O36 A;  3PHD A;  3M62 A;  2YHN A;  3MHH A;  4S3O B;  3M99 A;  1HYJ A;  5D1L B;  1XWH A;  4ZDT A;  2G6Q A;  2CT2 A;  4A4B A;  4F52 B;  4NN2 A;  4UP5 A;  4BBQ A;  4YAT A;  3EB6 A;  3C6W A;  3U5N A;  5G0F A;  3O35 A;  4AYC A;  2XB1 A;  1E4U A;  2LGG A;  1X4J A;  3LQH A;  2L75 A;  4GND A;  1ZBD B;  4X3G A;  2XEU A;  4LLB A;  1WEQ A;  3NG2 A;  2ECT A;  2VJE A;  2KIZ A;  1WES A;  2LRI C;  3ASL A;  2LXH C;  4AVX A;  2KR4 A;  3HCS A;  1X4I A;  2LQ6 A;  3DQV R;  1G25 A;  1Z60 A;  3O37 A;  1WEE A;  2KGG A;  4WZ2 A;  5G05 B;  2LXP C;  2L5U A;  3O34 A;  3O70 A;  1Z2Q A;  3LRQ A;  4FK5 A;  4V3L C;  2KYU A;  2FUI A;  5C11 A;  2KGI A;  3O7A A;  1MM2 A;  1WEP A;  2YSM A;  3RPG C;  4IC2 A;  4L58 A;  4UP0 A;  4YC9 A;  2VJF A;  1F62 A;  1WEN A;  2PNX A;  3U5M A;  3RTR B;  3N9M A;  2I50 A;  2KE1 A;  4A4C A;  4B86 C;  2H0D B;  2KWN A;  3KNV A;  2E6S A;  5AIT A;  3M63 A;  4FO9 A;  3N9P A;  3QZV A;  4MSX A;  4I7B A;  3SOW A;  1VD4 A;  3N9Q A;  5H1V A;  4ZUX U;  2KU3 A;  1LDK C;  5FB0 A;  2KWK A;  5D1K B;  2KWJ A;  4YBT A;  3PUR A;  3U5P A;  5FB1 A;  2M1R A;  3ZTG A;  2VPE A;  5KH9 A;  1U6G B;  3N9L A;  5B75 A;  3I2D A;  4V3K C;  1IYM A;  5G04 B;  2C2V S;  2L43 A;  3SOU A;  2FUU A;  1WGM A;  2VPB A;  2EA6 A;  5TDR A;  5KH7 A;  2UZG A;  2HYE D;  3C5K A;  5KH3 A;  3N9N A;  2L0B A;  2PUY A;  2FSA A;  3ZVZ B;  2CKL A;  4A0C D;  3KV5 A;  1FP0 A;  2K1J A;  1JM7 A;  2ECI A;  3SOX A;  2ECN A;  1K2F A;  1JOC A;  4S3O C;  4YBM A;  1VFY A;  5H9M A;  1LDJ B;  4GNF A;  5FEY A;  2LN0 A;  5B8D A;  3ZYQ A;  1X4U A;  2M85 A;  2OXQ C;  5LKT A;  3U5O A;  1Z6U A;  2QIC A;  5DKA A;  4AUQ B;  2K17 A;  4TKP B; 
#chains in the Genus database with same CATH topology
 3L11 A;  2D8U A;  1WEV A;  2DJA A;  2MD7 B;  2Y1M A;  1WEW A;  4C9Z A;  4AYC B;  2YQM A;  2MA6 A;  3HCT A;  3O33 A;  2L80 A;  1T1H A;  5C13 A;  2G43 A;  2M6M A;  2DSM A;  2VJE B;  3FJU B;  5TDW A;  4IC3 A;  3LQJ A;  2LGL A;  2K4D A;  4GNG A;  1WFK A;  3KV6 A;  5H1U A;  1BOR A;  3O47 A;  2OWA A;  4MVT A;  5TAB A;  2LGK A;  5K3Q A;  3ZVY A;  4QF2 A;  3GL6 A;  4R7E A;  5JG6 A;  1MM3 A;  3Q1D A;  4R8P K;  5J3X A;  4CCG X;  1N87 A;  2EXU A;  2M3H A;  3FM8 C;  2YU4 A;  4WZ3 B;  4YAD A;  2MNY A;  1WE9 A;  2LAU A;  3DPL R;  1DVP A;  1HYI A;  3T7L A;  4L7X A;  3GV4 A;  4YAX A;  3KQI A;  5SVX A;  2KWO A;  4YBS A;  5LKZ A;  2YUC A;  1VYX A;  2Y1N A;  3LVR E;  3L1X A;  2IQJ A;  2D8S A;  2VJF B;  5LKX A;  4UI9 B;  2YUR A;  2MNZ A;  3PUQ A;  1RMD A;  2ECJ A;  4XI1 A;  4LAD B;  4N4F A;  4A49 A;  2MA5 A;  5H1T A;  2ECW A;  2LGV A;  1WEO A;  5B79 A;  3VK6 A;  3LQI A;  2F6N A;  3EB5 A;  3FAN A;  2CSZ A;  2JMJ A;  2NAA A;  4Q6F A;  3FEH A;  2YHO A;  2BAY A;  2K16 A;  5B78 A;  2KKY A;  2MT5 A;  4I7D A;  4I7C A;  1WEM A;  4WZ0 A;  4N3W A;  2CRR A;  3N9O A;  2JRJ A;  2MUM A;  2ZET C;  4WA6 A;  2QJ0 A;  2ECG A;  3SUB A;  4P5O B;  3T6R A;  2G45 A;  5TBN A;  2YYR A;  4GB0 A;  4O64 A;  3SHB A;  3PLW A;  2CKL B;  4CA1 A;  3FL2 A;  5TRB A;  5LKU A;  2YW8 A;  2E6R A;  4Z0R A;  4AP4 A;  1JM7 B;  4Z0O A;  2FD4 A;  2L7P A;  2C2L A;  2Y43 A;  2KRE A;  2VPD A;  4YAB A;  4B7Y C;  2IDA A;  1WIM A;  1WIL A;  2JMI A;  2YSJ A;  3RPG B;  5LCW B;  2RI7 A;  2H0D A;  2F42 A;  2QIZ A;  5I3L A;  3KDE C;  2KFT A;  4O62 A;  1CHC A;  2VNF A;  4LJN A;  5SVI B;  4FIP A;  4LK9 A;  2MIQ A;  2VP7 A;  2DX8 A;  4W4U A;  3LJU X;  3LVQ E;  4LKA A;  2XOZ A;  2CON A;  2YT5 A;  2EGP A;  2ECV A;  2YRE A;  4ZQL A;  2F6J A;  3IHP A;  5DIN A;  3ZPV 1;  3L1Z B;  5FER A;  2CSY A;  2E61 A;  3LDY A;  5EYA F;  5B76 A;  4PTB A;  5B77 A;  2JMD A;  2MD8 C;  4R2Y A;  3V43 A;  5AIU A;  1WEU A;  1FBV A;  2YQL A;  4QF3 A;  4GNE A;  3HTK C;  2LDR A;  2EOD A;  5D1M B;  3ZPV E;  3ZNI A;  2AN6 A;  4BHW A;  2VPG A;  3HCU A;  1V87 A;  2HDP A;  3MHS A;  2LV9 A;  4FJC A;  2RSD A;  4PPE A;  3O36 A;  3PHD A;  3M62 A;  2YHN A;  3MHH A;  4S3O B;  3M99 A;  2JM3 A;  1HYJ A;  5D1L B;  1XWH A;  3MDB C;  4ZDT A;  2G6Q A;  2CT2 A;  4A4B A;  4F52 B;  4NN2 A;  4UP5 A;  4BBQ A;  4YAT A;  3EB6 A;  3C6W A;  3U5N A;  5G0F A;  3O35 A;  4AYC A;  2XB1 A;  1E4U A;  2LGG A;  1X4J A;  3LQH A;  2B0O E;  2L75 A;  2CRW A;  4GND A;  2CSV A;  1ZBD B;  4X3G A;  2XEU A;  4LLB A;  4OGC A;  1WEQ A;  3NG2 A;  2ECT A;  2VJE A;  2KIZ A;  1WES A;  3JUE A;  2LRI C;  3ASL A;  2LXH C;  4AVX A;  2KR4 A;  3HCS A;  1X4I A;  2LQ6 A;  3DQV R;  1G25 A;  1Z60 A;  3O37 A;  3FAO A;  4OGE A;  1WEE A;  2KGG A;  3T9K A;  4WZ2 A;  5G05 B;  2LXP C;  2L5U A;  3O34 A;  2XOC A;  3O70 A;  1Z2Q A;  3LRQ A;  4FK5 A;  4V3L C;  2KYU A;  2FUI A;  5C11 A;  2KGI A;  2JUN A;  3O7A A;  1MM2 A;  2KKX A;  1WEP A;  2YSM A;  3RPG C;  4IC2 A;  4L58 A;  4UP0 A;  4YC9 A;  2VJF A;  1F62 A;  1WEN A;  2PNX A;  3U5M A;  3RTR B;  3N9M A;  2I50 A;  2KE1 A;  4A4C A;  4QQ4 A;  4B86 C;  2H0D B;  2KWN A;  3KNV A;  2E6S A;  5AIT A;  3M63 A;  4FO9 A;  3N9P A;  2XP0 A;  3QZV A;  4MSX A;  4I7B A;  2MKE A;  3SOW A;  1VD4 A;  3N9Q A;  5H1V A;  4ZUX U;  2KU3 A;  1LDK C;  5FB0 A;  2KWK A;  5D1K B;  2KWJ A;  4YBT A;  3PUR A;  3U5P A;  5FB1 A;  2M1R A;  3ZTG A;  2VPE A;  5KH9 A;  3H7H A;  1U6G B;  3N9L A;  5B75 A;  3I2D A;  1MBM A;  2M13 A;  4V3K C;  1IYM A;  5G04 B;  2C2V S;  2L43 A;  2EGM A;  3SOU A;  2FUU A;  1WGM A;  2VPB A;  2EA6 A;  5TDR A;  5KH7 A;  2UZG A;  3DDT A;  2HYE D;  4H9D A;  3C5K A;  5KH3 A;  2XOY A;  3N9N A;  2L0B A;  2PUY A;  2FSA A;  3E2D A;  2CKL A;  3ZVZ B;  4A0C D;  3KV5 A;  1FP0 A;  2K1J A;  1JM7 A;  2ECI A;  3SOX A;  2ECN A;  1K2F A;  1JOC A;  2RR4 A;  4S3O C;  4YBM A;  1VFY A;  3M7K A;  5H9M A;  5SVY A;  1LDJ B;  2P57 A;  4GNF A;  5FEY A;  2LN0 A;  3DWD A;  5B8D A;  1DCQ A;  3ZYQ A;  1X4U A;  2M85 A;  2OXQ C;  5LKT A;  3U5O A;  4F1P A;  1Z6U A;  2QIC A;  5DKA A;  4AUQ B;  2K17 A;  2YVR A;  5SVI A;  2FFW A;  4TKP B; 
#chains in the Genus database with same CATH homology
 3L11 A;  1WEV A;  2MD7 B;  2Y1M A;  1WEW A;  4C9Z A;  4AYC B;  2YQM A;  2MA6 A;  3HCT A;  3O33 A;  2L80 A;  1T1H A;  5C13 A;  2G43 A;  2M6M A;  2VJE B;  5TDW A;  4IC3 A;  3LQJ A;  2LGL A;  2K4D A;  4GNG A;  1WFK A;  3KV6 A;  5H1U A;  1BOR A;  4MVT A;  5TAB A;  2LGK A;  3ZVY A;  4QF2 A;  3GL6 A;  4R7E A;  5JG6 A;  1MM3 A;  4R8P K;  5J3X A;  4CCG X;  1N87 A;  2M3H A;  4YAD A;  2YU4 A;  4WZ3 B;  2MNY A;  1WE9 A;  3DPL R;  1DVP A;  1HYI A;  3T7L A;  4L7X A;  3GV4 A;  4YAX A;  3KQI A;  2KWO A;  4YBS A;  5LKZ A;  2YUC A;  1VYX A;  2Y1N A;  3L1X A;  2D8S A;  2VJF B;  5LKX A;  4UI9 B;  2YUR A;  2MNZ A;  3PUQ A;  1RMD A;  2ECJ A;  4XI1 A;  4LAD B;  4N4F A;  4A49 A;  2MA5 A;  5H1T A;  2ECW A;  2LGV A;  1WEO A;  5B79 A;  3VK6 A;  3LQI A;  2F6N A;  3EB5 A;  2CSZ A;  2JMJ A;  2NAA A;  4Q6F A;  2YHO A;  2BAY A;  2K16 A;  5B78 A;  4I7D A;  2MT5 A;  4I7C A;  1WEM A;  4WZ0 A;  4N3W A;  3N9O A;  2JRJ A;  2MUM A;  2ZET C;  4WA6 A;  2QJ0 A;  2ECG A;  4P5O B;  3T6R A;  2G45 A;  5TBN A;  2YYR A;  4GB0 A;  4O64 A;  3SHB A;  2CKL B;  4CA1 A;  3FL2 A;  5TRB A;  5LKU A;  2YW8 A;  2E6R A;  4AP4 A;  1JM7 B;  2C2L A;  2Y43 A;  2KRE A;  2VPD A;  4YAB A;  4B7Y C;  2IDA A;  1WIM A;  1WIL A;  2JMI A;  2YSJ A;  3RPG B;  5LCW B;  2RI7 A;  2H0D A;  2F42 A;  2QIZ A;  5I3L A;  2KFT A;  1CHC A;  2VNF A;  4LJN A;  4FIP A;  4LK9 A;  2MIQ A;  2VP7 A;  2DX8 A;  4W4U A;  4LKA A;  2YT5 A;  2EGP A;  2ECV A;  2YRE A;  4ZQL A;  2F6J A;  3IHP A;  5DIN A;  3ZPV 1;  3L1Z B;  5FER A;  2CSY A;  5EYA F;  5B76 A;  4PTB A;  5B77 A;  2JMD A;  2MD8 C;  4R2Y A;  3V43 A;  5AIU A;  1WEU A;  1FBV A;  2YQL A;  4QF3 A;  4GNE A;  3HTK C;  2LDR A;  2EOD A;  5D1M B;  3ZPV E;  3ZNI A;  2AN6 A;  4BHW A;  2VPG A;  3HCU A;  1V87 A;  2HDP A;  3MHS A;  2LV9 A;  4FJC A;  2RSD A;  4PPE A;  3O36 A;  3PHD A;  3M62 A;  2YHN A;  3MHH A;  4S3O B;  3M99 A;  1HYJ A;  5D1L B;  1XWH A;  4ZDT A;  2G6Q A;  2CT2 A;  4A4B A;  4F52 B;  4NN2 A;  4UP5 A;  4BBQ A;  4YAT A;  3EB6 A;  3C6W A;  3U5N A;  5G0F A;  3O35 A;  4AYC A;  2XB1 A;  1E4U A;  2LGG A;  1X4J A;  3LQH A;  2L75 A;  4GND A;  1ZBD B;  4X3G A;  2XEU A;  4LLB A;  1WEQ A;  3NG2 A;  2ECT A;  2VJE A;  2KIZ A;  1WES A;  2LRI C;  3ASL A;  2LXH C;  4AVX A;  2KR4 A;  3HCS A;  1X4I A;  2LQ6 A;  3DQV R;  1G25 A;  1Z60 A;  3O37 A;  1WEE A;  2KGG A;  4WZ2 A;  5G05 B;  2LXP C;  2L5U A;  3O34 A;  3O70 A;  1Z2Q A;  3LRQ A;  4FK5 A;  4V3L C;  2KYU A;  2FUI A;  5C11 A;  2KGI A;  3O7A A;  1MM2 A;  1WEP A;  2YSM A;  3RPG C;  4IC2 A;  4L58 A;  4UP0 A;  4YC9 A;  2VJF A;  1F62 A;  1WEN A;  2PNX A;  3U5M A;  3RTR B;  3N9M A;  2I50 A;  2KE1 A;  4A4C A;  4B86 C;  2H0D B;  2KWN A;  3KNV A;  2E6S A;  5AIT A;  3M63 A;  4FO9 A;  3N9P A;  3QZV A;  4MSX A;  4I7B A;  3SOW A;  1VD4 A;  3N9Q A;  5H1V A;  4ZUX U;  2KU3 A;  1LDK C;  5FB0 A;  2KWK A;  5D1K B;  2KWJ A;  4YBT A;  3PUR A;  3U5P A;  5FB1 A;  2M1R A;  3ZTG A;  2VPE A;  5KH9 A;  1U6G B;  3N9L A;  5B75 A;  3I2D A;  4V3K C;  1IYM A;  5G04 B;  2C2V S;  2L43 A;  3SOU A;  2FUU A;  1WGM A;  2VPB A;  2EA6 A;  5TDR A;  5KH7 A;  2UZG A;  2HYE D;  3C5K A;  5KH3 A;  3N9N A;  2L0B A;  2PUY A;  2FSA A;  3ZVZ B;  2CKL A;  4A0C D;  3KV5 A;  1FP0 A;  2K1J A;  1JM7 A;  2ECI A;  3SOX A;  2ECN A;  1K2F A;  1JOC A;  4S3O C;  4YBM A;  1VFY A;  5H9M A;  1LDJ B;  4GNF A;  5FEY A;  2LN0 A;  5B8D A;  3ZYQ A;  1X4U A;  2M85 A;  2OXQ C;  5LKT A;  3U5O A;  1Z6U A;  2QIC A;  5DKA A;  4AUQ B;  2K17 A;  4TKP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...