4NN2A

Protein crystal structure of human borjeson-forssman-lehmann syndrome associated protein phf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
TRPKCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKLYCKNHSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PHD finger protein 6
publication title Crystal Structure of the second extended PHD domain of human PHF6 protein
rcsb
source organism Homo sapiens
total genus 37
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13771 zf-HC5HC2H PHD-like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4nn2A00
2E6SA 4FK5A 2PNXA 4I7CA 3MHHA 4A49A 2LGGA 5LKUA 3KV5A 3IHPA 4YATA 2VPEA 3KNVA 5D1MB 4R2YA 1FP0A 3N9OA 5TRBA 4X3GA 4BBQA 3PURA 5B76A 1RMDA 5FB0A 4AVXA 2ECNA 4A4BA 3N9NA 4WZ0A 3PHDA 1WESA 4ZUXU 4YADA 5DINA 4B86C 3T6RA 1XWHA 4BHWA 4N3WA 4LLBA 2XB1A 3KQIA 4N4FA 4F52B 3HCSA 4S3OC 3GV4A 4CCGX 3ZPVE 2ZETC 2MD8C 5H9MA 5TBNA 4IC3A 3O35A 5G04B 2JRJA 2M1RA 3SOXA 1X4UA 5TABA 3SOUA 1VD4A 4GB0A 3T7LA 2ECIA 4UP0A 2YUCA 2K4DA 4WZ2A 2KGGA 4YABA 2QICA 2LGKA 3U5OA 1WIMA 4I7BA 3N9LA 2VPBA 3ZTGA 3RPGC 2IDAA 1WEOA 4AYCA 5H1VA 2RSDA 4TKPB 4GNDA 4W4UA 2KYUA 1X4JA 2LXPC 1WEWA 3RPGB 3ASLA 3SOWA 2YSMA 2RI7A 1JOCA 3C6WA 2ECJA 3C5KA 4WA6A 2L0BA 2MIQA 5J3XA 4NN2A 1BORA 1MM3A 1DVPA 5JG6A 2DX8A 2LRIC 2YT5A 2AN6A 2PUYA 4PPEA 5LKXA 4V3LC 2BAYA 2K16A 3L1ZB 1WEQA 4LADB 2LXHC 4AYCB 2YQLA 2VPGA 3O34A 4UI9B 1WGMA 2QJ0A 4A4CA 1WEVA 4GNEA 1Z60A 2HDPA 5LKTA 2YURA 2H0DB 2YQMA 4YAXA 2LQ6A 2ECWA 2LGLA 1Z6UA 3N9MA 2OXQC 3PUQA 2LGVA 2KR4A 2KU3A 2I50A 2CSZA 4I7DA 4ZDTA 2MA6A 2NAAA 5AITA 5B77A 1WENA 2M3HA 4P5OB 4UP5A 2Y1MA 3KV6A 5KH3A 3DPLR 2VP7A 2C2LA 2KWNA 3ZVZB 2M6MA 5DKAA 5TDRA 3GL6A 3N9PA 1G25A 2KFTA 3LQHA 1HYIA 1VFYA 3HTKC 2JMIA 3O70A 5KH9A 5D1LB 2QIZA 2Y1NA 1WE9A 2KGIA 2YYRA 2YU4A 2MA5A 2H0DA 2ECVA 1MM2A 2JMDA 1T1HA 1WEEA 5LKZA 3ZPV1 1WEUA 3VK6A 5KH7A 3LQJA 4R7EA 1IYMA 2CKLB 5B78A 2YREA 2F42A 4AP4A 2ECGA 3O7AA 2KE1A 4L7XA 1F62A 2KIZA 5FB1A 5TDWA 4YBMA 2FUUA 5FEYA 1K2FA 5H1TA 2L5UA 4CA1A 2K17A 3O33A 2FUIA 1LDKC 3HCUA 2VJEB 4YC9A 3ZNIA 2L75A 4ZQLA 2UZGA 2KREA 2JMJA 2D8SA 2CT2A 5EYAF 2MNYA 2XEUA 4XI1A 2VJFB 3ZYQA 2YHNA 1U6GB 2LV9A 3SHBA 2L43A 2Y43A 2KWJA 5AIUA 2K1JA 2C2VS 2MD7B 4L58A 3M99A 4LK9A 2F6NA 2FSAA 4B7YC 4QF2A 2ECTA 2VPDA 3O37A 3LRQA 5LCWB 5B75A 1LDJB 2F6JA 2VNFA 3DQVR 1VYXA 2G45A 1HYJA 3I2DA 3EB5A 3N9QA 2MNZA 3EB6A 3U5MA 2M85A 4GNFA 3O36A 1JM7B 1CHCA 1X4IA 2CKLA 2LDRA 2EA6A 4FO9A 2MT5A 2YSJA 2YW8A 5B8DA 3RTRB 5H1UA 2L80A 4MSXA 3MHSA 3HCTA 4QF3A 5C11A 4MVTA 1E4UA 4A0CD 2G6QA 2VJEA 4S3OB 4PTBA 4YBTA 2YHOA 2HYED 4Q6FA 4O64A 4C9ZA 1N87A 4LKAA 3L1XA 4V3KC 1ZBDB 1Z2QA 3ZVYA 2KWOA 2VJFA 5FERA 3U5NA 1WEPA 2EGPA 4GNGA 3M63A 3FL2A 2G43A 4FJCA 2E6RA 5B79A 3NG2A 4IC2A 4FIPA 1WFKA 1WEMA 2KWKA 5G0FA 4WZ3B 4AUQB 4LJNA 2LN0A 3U5PA 2CSYA 4R8PK 5I3LA 1WILA 3V43A 5G05B 1FBVA 4YBSA 3M62A 3L11A 3LQIA 2EODA 1JM7A 2MUMA 1V87A 3QZVA 5C13A 5D1KB
chains in the Genus database with same CATH superfamily
2E6SA 4FK5A 3JUEA 2PNXA 4I7CA 3MHHA 5SVIA 4A49A 2LGGA 5LKUA 2EGMA 3KV5A 3IHPA 4YATA 2VPEA 3KNVA 5D1MB 4R2YA 1FP0A 3N9OA 5TRBA 4X3GA 4BBQA 3LVRE 3PURA 4OGEA 5B76A 1RMDA 5FB0A 4AVXA 2ECNA 4A4BA 3N9NA 4WZ0A 3PHDA 1WESA 4ZUXU 4YADA 2LAUA 5DINA 4B86C 3T6RA 1XWHA 4BHWA 4N3WA 4LLBA 2XB1A 3KQIA 5SVXA 4N4FA 4F52B 3HCSA 4S3OC 3GV4A 4CCGX 3ZPVE 2DSMA 2ZETC 2MD8C 5H9MA 2JUNA 5TBNA 4IC3A 3FM8C 3O35A 5G04B 2JRJA 2M1RA 4OGCA 3SOXA 1X4UA 5TABA 3SOUA 1VD4A 2FD4A 4GB0A 3T7LA 2ECIA 4UP0A 2YUCA 2K4DA 4WZ2A 2KGGA 4YABA 2QICA 2LGKA 3U5OA 1WIMA 2CRRA 2KKYA 4I7BA 5K3QA 3N9LA 2VPBA 3ZTGA 3RPGC 2IDAA 1WEOA 4AYCA 3M7KA 3E2DA 5H1VA 2RSDA 2CRWA 4TKPB 3MDBC 4GNDA 2KYUA 4W4UA 1X4JA 3LDYA 2LXPC 1WEWA 3RPGB 3ASLA 3SOWA 1DCQA 2YSMA 2RI7A 1JOCA 3C6WA 2ECJA 3C5KA 4WA6A 2L0BA 2MIQA 5J3XA 3FJUB 4NN2A 1BORA 1MM3A 2YVRA 1DVPA 5JG6A 2DX8A 3H7HA 2LRIC 3FANA 2YT5A 2AN6A 2PUYA 4PPEA 5LKXA 2XP0A 4V3LC 2BAYA 2K16A 3L1ZB 1WEQA 4LADB 2DJAA 2LXHC 4AYCB 2YQLA 2VPGA 3O34A 4UI9B 1WGMA 2QJ0A 4A4CA 1WEVA 3DDTA 2JM3A 4GNEA 1Z60A 2HDPA 5SVYA 5LKTA 2YURA 2H0DB 2YQMA 4YAXA 2LQ6A 2ECWA 2LGLA 1Z6UA 2KKXA 3N9MA 2CONA 2OXQC 2E61A 3PUQA 2CSVA 2LGVA 2KR4A 2KU3A 2M13A 2OWAA 2I50A 2CSZA 4I7DA 4ZDTA 2MA6A 2NAAA 5AITA 5B77A 1WENA 2M3HA 4P5OB 4UP5A 2XOCA 2Y1MA 3KV6A 1MBMA 5KH3A 3DPLR 2VP7A 2C2LA 2KWNA 3ZVZB 2M6MA 5DKAA 4H9DA 5TDRA 3GL6A 2B0OE 3N9PA 1G25A 2KFTA 3LQHA 1HYIA 1VFYA 3HTKC 2JMIA 3O70A 5KH9A 5D1LB 2QIZA 2Y1NA 1WE9A 3SUBA 2KGIA 2YYRA 2YU4A 2MA5A 2H0DA 2ECVA 1MM2A 2JMDA 1T1HA 2RR4A 1WEEA 5LKZA 4QQ4A 3ZPV1 1WEUA 3VK6A 5KH7A 3LQJA 3FAOA 4R7EA 1IYMA 2CKLB 5B78A 2YREA 2F42A 4AP4A 2ECGA 3O7AA 2KE1A 4L7XA 1F62A 2KIZA 5FB1A 5TDWA 4YBMA 2FUUA 2P57A 5FEYA 1K2FA 5H1TA 2L5UA 4CA1A 2K17A 3O33A 2FUIA 1LDKC 3HCUA 2VJEB 4YC9A 3ZNIA 2L75A 4ZQLA 2UZGA 2KREA 2JMJA 3Q1DA 4F1PA 2D8SA 2D8UA 3LVQE 2CT2A 5EYAF 2MNYA 2XEUA 4XI1A 2VJFB 3ZYQA 2YHNA 4Z0OA 1U6GB 2LV9A 3SHBA 2L43A 2Y43A 2KWJA 5AIUA 2K1JA 2C2VS 2MD7B 4L58A 3M99A 4LK9A 2F6NA 2FSAA 4B7YC 2EXUA 4QF2A 2ECTA 2VPDA 3KDEC 3O37A 3LRQA 5LCWB 2L7PA 5B75A 1LDJB 2F6JA 2VNFA 3DQVR 1VYXA 2G45A 1HYJA 3I2DA 3EB5A 3N9QA 2MNZA 3EB6A 3U5MA 2M85A 4GNFA 3O36A 1JM7B 1CHCA 1X4IA 2CKLA 2LDRA 2EA6A 4FO9A 3O47A 2MT5A 2YSJA 2YW8A 5B8DA 3RTRB 5H1UA 2IQJA 2L80A 2FFWA 4MSXA 5SVIB 3MHSA 3HCTA 4QF3A 5C11A 4MVTA 1E4UA 4A0CD 2G6QA 2VJEA 4S3OB 4PTBA 2XOYA 4YBTA 2YHOA 2HYED 4Z0RA 2XOZA 3LJUX 4Q6FA 4O64A 4C9ZA 1N87A 4LKAA 3L1XA 4V3KC 1ZBDB 1Z2QA 3ZVYA 2KWOA 2VJFA 5FERA 3U5NA 1WEPA 2EGPA 4GNGA 3M63A 3FL2A 2G43A 4FJCA 3PLWA 2MKEA 3T9KA 2E6RA 5B79A 3NG2A 4IC2A 4FIPA 1WFKA 1WEMA 2KWKA 5G0FA 4WZ3B 4AUQB 4LJNA 2LN0A 3U5PA 2CSYA 4R8PK 5I3LA 1WILA 3V43A 5G05B 1FBVA 4YBSA 3M62A 4O62A 3L11A 3DWDA 3LQIA 2EODA 3FEHA 1JM7A 2MUMA 1V87A 3QZVA 5C13A 5D1KB
chains in the Genus database with same CATH topology
2E6SA 4FK5A 2PNXA 4I7CA 3MHHA 4A49A 2LGGA 5LKUA 3KV5A 3IHPA 4YATA 2VPEA 3KNVA 5D1MB 4R2YA 1FP0A 3N9OA 5TRBA 4X3GA 4BBQA 3PURA 5B76A 1RMDA 5FB0A 4AVXA 2ECNA 4A4BA 3N9NA 4WZ0A 3PHDA 1WESA 4ZUXU 4YADA 5DINA 4B86C 3T6RA 1XWHA 4BHWA 4N3WA 4LLBA 2XB1A 3KQIA 4N4FA 4F52B 3HCSA 4S3OC 3GV4A 4CCGX 3ZPVE 2ZETC 2MD8C 5H9MA 5TBNA 4IC3A 3O35A 5G04B 2JRJA 2M1RA 3SOXA 1X4UA 5TABA 3SOUA 1VD4A 4GB0A 3T7LA 2ECIA 4UP0A 2YUCA 2K4DA 4WZ2A 2KGGA 4YABA 2QICA 2LGKA 3U5OA 1WIMA 4I7BA 3N9LA 2VPBA 3ZTGA 3RPGC 2IDAA 1WEOA 4AYCA 5H1VA 2RSDA 4TKPB 4GNDA 4W4UA 2KYUA 1X4JA 2LXPC 1WEWA 3RPGB 3ASLA 3SOWA 2YSMA 2RI7A 1JOCA 3C6WA 2ECJA 3C5KA 4WA6A 2L0BA 2MIQA 5J3XA 4NN2A 1BORA 1MM3A 1DVPA 5JG6A 2DX8A 2LRIC 2YT5A 2AN6A 2PUYA 4PPEA 5LKXA 4V3LC 2BAYA 2K16A 3L1ZB 1WEQA 4LADB 2LXHC 4AYCB 2YQLA 2VPGA 3O34A 4UI9B 1WGMA 2QJ0A 4A4CA 1WEVA 4GNEA 1Z60A 2HDPA 5LKTA 2YURA 2H0DB 2YQMA 4YAXA 2LQ6A 2ECWA 2LGLA 1Z6UA 3N9MA 2OXQC 3PUQA 2LGVA 2KR4A 2KU3A 2I50A 2CSZA 4I7DA 4ZDTA 2MA6A 2NAAA 5AITA 5B77A 1WENA 2M3HA 4P5OB 4UP5A 2Y1MA 3KV6A 5KH3A 3DPLR 2VP7A 2C2LA 2KWNA 3ZVZB 2M6MA 5DKAA 5TDRA 3GL6A 3N9PA 1G25A 2KFTA 3LQHA 1HYIA 1VFYA 3HTKC 2JMIA 3O70A 5KH9A 5D1LB 2QIZA 2Y1NA 1WE9A 2KGIA 2YYRA 2YU4A 2MA5A 2H0DA 2ECVA 1MM2A 2JMDA 1T1HA 1WEEA 5LKZA 3ZPV1 1WEUA 3VK6A 5KH7A 3LQJA 4R7EA 1IYMA 2CKLB 5B78A 2YREA 2F42A 4AP4A 2ECGA 3O7AA 2KE1A 4L7XA 1F62A 2KIZA 5FB1A 5TDWA 4YBMA 2FUUA 5FEYA 1K2FA 5H1TA 2L5UA 4CA1A 2K17A 3O33A 2FUIA 1LDKC 3HCUA 2VJEB 4YC9A 3ZNIA 2L75A 4ZQLA 2UZGA 2KREA 2JMJA 2D8SA 2CT2A 5EYAF 2MNYA 2XEUA 4XI1A 2VJFB 3ZYQA 2YHNA 1U6GB 2LV9A 3SHBA 2L43A 2Y43A 2KWJA 5AIUA 2K1JA 2C2VS 2MD7B 4L58A 3M99A 4LK9A 2F6NA 2FSAA 4B7YC 4QF2A 2ECTA 2VPDA 3O37A 3LRQA 5LCWB 5B75A 1LDJB 2F6JA 2VNFA 3DQVR 1VYXA 2G45A 1HYJA 3I2DA 3EB5A 3N9QA 2MNZA 3EB6A 3U5MA 2M85A 4GNFA 3O36A 1JM7B 1CHCA 1X4IA 2CKLA 2LDRA 2EA6A 4FO9A 2MT5A 2YSJA 2YW8A 5B8DA 3RTRB 5H1UA 2L80A 4MSXA 3MHSA 3HCTA 4QF3A 5C11A 4MVTA 1E4UA 4A0CD 2G6QA 2VJEA 4S3OB 4PTBA 4YBTA 2YHOA 2HYED 4Q6FA 4O64A 4C9ZA 1N87A 4LKAA 3L1XA 4V3KC 1ZBDB 1Z2QA 3ZVYA 2KWOA 2VJFA 5FERA 3U5NA 1WEPA 2EGPA 4GNGA 3M63A 3FL2A 2G43A 4FJCA 2E6RA 5B79A 3NG2A 4IC2A 4FIPA 1WFKA 1WEMA 2KWKA 5G0FA 4WZ3B 4AUQB 4LJNA 2LN0A 3U5PA 2CSYA 4R8PK 5I3LA 1WILA 3V43A 5G05B 1FBVA 4YBSA 3M62A 3L11A 3LQIA 2EODA 1JM7A 2MUMA 1V87A 3QZVA 5C13A 5D1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6S A;  4FK5 A;  2PNX A;  4I7C A;  3MHH A;  4A49 A;  2LGG A;  5LKU A;  3KV5 A;  3IHP A;  4YAT A;  2VPE A;  3KNV A;  5D1M B;  4R2Y A;  1FP0 A;  3N9O A;  5TRB A;  4X3G A;  4BBQ A;  3PUR A;  5B76 A;  1RMD A;  5FB0 A;  4AVX A;  2ECN A;  4A4B A;  3N9N A;  4WZ0 A;  3PHD A;  1WES A;  4ZUX U;  4YAD A;  5DIN A;  4B86 C;  3T6R A;  1XWH A;  4BHW A;  4N3W A;  4LLB A;  2XB1 A;  3KQI A;  4N4F A;  4F52 B;  3HCS A;  4S3O C;  3GV4 A;  4CCG X;  3ZPV E;  2ZET C;  2MD8 C;  5H9M A;  5TBN A;  4IC3 A;  3O35 A;  5G04 B;  2JRJ A;  2M1R A;  3SOX A;  1X4U A;  5TAB A;  3SOU A;  1VD4 A;  4GB0 A;  3T7L A;  2ECI A;  4UP0 A;  2YUC A;  2K4D A;  4WZ2 A;  2KGG A;  4YAB A;  2QIC A;  2LGK A;  3U5O A;  1WIM A;  4I7B A;  3N9L A;  2VPB A;  3ZTG A;  3RPG C;  2IDA A;  1WEO A;  4AYC A;  5H1V A;  2RSD A;  4TKP B;  4GND A;  4W4U A;  2KYU A;  1X4J A;  2LXP C;  1WEW A;  3RPG B;  3ASL A;  3SOW A;  2YSM A;  2RI7 A;  1JOC A;  3C6W A;  2ECJ A;  3C5K A;  4WA6 A;  2L0B A;  2MIQ A;  5J3X A;  4NN2 A;  1BOR A;  1MM3 A;  1DVP A;  5JG6 A;  2DX8 A;  2LRI C;  2YT5 A;  2AN6 A;  2PUY A;  4PPE A;  5LKX A;  4V3L C;  2BAY A;  2K16 A;  3L1Z B;  1WEQ A;  4LAD B;  2LXH C;  4AYC B;  2YQL A;  2VPG A;  3O34 A;  4UI9 B;  1WGM A;  2QJ0 A;  4A4C A;  1WEV A;  4GNE A;  1Z60 A;  2HDP A;  5LKT A;  2YUR A;  2H0D B;  2YQM A;  4YAX A;  2LQ6 A;  2ECW A;  2LGL A;  1Z6U A;  3N9M A;  2OXQ C;  3PUQ A;  2LGV A;  2KR4 A;  2KU3 A;  2I50 A;  2CSZ A;  4I7D A;  4ZDT A;  2MA6 A;  2NAA A;  5AIT A;  5B77 A;  1WEN A;  2M3H A;  4P5O B;  4UP5 A;  2Y1M A;  3KV6 A;  5KH3 A;  3DPL R;  2VP7 A;  2C2L A;  2KWN A;  3ZVZ B;  2M6M A;  5DKA A;  5TDR A;  3GL6 A;  3N9P A;  1G25 A;  2KFT A;  3LQH A;  1HYI A;  1VFY A;  3HTK C;  2JMI A;  3O70 A;  5KH9 A;  5D1L B;  2QIZ A;  2Y1N A;  1WE9 A;  2KGI A;  2YYR A;  2YU4 A;  2MA5 A;  2H0D A;  2ECV A;  1MM2 A;  2JMD A;  1T1H A;  1WEE A;  5LKZ A;  3ZPV 1;  1WEU A;  3VK6 A;  5KH7 A;  3LQJ A;  4R7E A;  1IYM A;  2CKL B;  5B78 A;  2YRE A;  2F42 A;  4AP4 A;  2ECG A;  3O7A A;  2KE1 A;  4L7X A;  1F62 A;  2KIZ A;  5FB1 A;  5TDW A;  4YBM A;  2FUU A;  5FEY A;  1K2F A;  5H1T A;  2L5U A;  4CA1 A;  2K17 A;  3O33 A;  2FUI A;  1LDK C;  3HCU A;  2VJE B;  4YC9 A;  3ZNI A;  2L75 A;  4ZQL A;  2UZG A;  2KRE A;  2JMJ A;  2D8S A;  2CT2 A;  5EYA F;  2MNY A;  2XEU A;  4XI1 A;  2VJF B;  3ZYQ A;  2YHN A;  1U6G B;  2LV9 A;  3SHB A;  2L43 A;  2Y43 A;  2KWJ A;  5AIU A;  2K1J A;  2C2V S;  2MD7 B;  4L58 A;  3M99 A;  4LK9 A;  2F6N A;  2FSA A;  4B7Y C;  4QF2 A;  2ECT A;  2VPD A;  3O37 A;  3LRQ A;  5LCW B;  5B75 A;  1LDJ B;  2F6J A;  2VNF A;  3DQV R;  1VYX A;  2G45 A;  1HYJ A;  3I2D A;  3EB5 A;  3N9Q A;  2MNZ A;  3EB6 A;  3U5M A;  2M85 A;  4GNF A;  3O36 A;  1JM7 B;  1CHC A;  1X4I A;  2CKL A;  2LDR A;  2EA6 A;  4FO9 A;  2MT5 A;  2YSJ A;  2YW8 A;  5B8D A;  3RTR B;  5H1U A;  2L80 A;  4MSX A;  3MHS A;  3HCT A;  4QF3 A;  5C11 A;  4MVT A;  1E4U A;  4A0C D;  2G6Q A;  2VJE A;  4S3O B;  4PTB A;  4YBT A;  2YHO A;  2HYE D;  4Q6F A;  4O64 A;  4C9Z A;  1N87 A;  4LKA A;  3L1X A;  4V3K C;  1ZBD B;  1Z2Q A;  3ZVY A;  2KWO A;  2VJF A;  5FER A;  3U5N A;  1WEP A;  2EGP A;  4GNG A;  3M63 A;  3FL2 A;  2G43 A;  4FJC A;  2E6R A;  5B79 A;  3NG2 A;  4IC2 A;  4FIP A;  1WFK A;  1WEM A;  2KWK A;  5G0F A;  4WZ3 B;  4AUQ B;  4LJN A;  2LN0 A;  3U5P A;  2CSY A;  4R8P K;  5I3L A;  1WIL A;  3V43 A;  5G05 B;  1FBV A;  4YBS A;  3M62 A;  3L11 A;  3LQI A;  2EOD A;  1JM7 A;  2MUM A;  1V87 A;  3QZV A;  5C13 A;  5D1K B; 
#chains in the Genus database with same CATH topology
 2E6S A;  4FK5 A;  3JUE A;  2PNX A;  4I7C A;  3MHH A;  5SVI A;  4A49 A;  2LGG A;  5LKU A;  2EGM A;  3KV5 A;  3IHP A;  4YAT A;  2VPE A;  3KNV A;  5D1M B;  4R2Y A;  1FP0 A;  3N9O A;  5TRB A;  4X3G A;  4BBQ A;  3LVR E;  3PUR A;  4OGE A;  5B76 A;  1RMD A;  5FB0 A;  4AVX A;  2ECN A;  4A4B A;  3N9N A;  4WZ0 A;  3PHD A;  1WES A;  4ZUX U;  4YAD A;  2LAU A;  5DIN A;  4B86 C;  3T6R A;  1XWH A;  4BHW A;  4N3W A;  4LLB A;  2XB1 A;  3KQI A;  5SVX A;  4N4F A;  4F52 B;  3HCS A;  4S3O C;  3GV4 A;  4CCG X;  3ZPV E;  2DSM A;  2ZET C;  2MD8 C;  5H9M A;  2JUN A;  5TBN A;  4IC3 A;  3FM8 C;  3O35 A;  5G04 B;  2JRJ A;  2M1R A;  4OGC A;  3SOX A;  1X4U A;  5TAB A;  3SOU A;  1VD4 A;  2FD4 A;  4GB0 A;  3T7L A;  2ECI A;  4UP0 A;  2YUC A;  2K4D A;  4WZ2 A;  2KGG A;  4YAB A;  2QIC A;  2LGK A;  3U5O A;  1WIM A;  2CRR A;  2KKY A;  4I7B A;  5K3Q A;  3N9L A;  2VPB A;  3ZTG A;  3RPG C;  2IDA A;  1WEO A;  4AYC A;  3M7K A;  3E2D A;  5H1V A;  2RSD A;  2CRW A;  4TKP B;  3MDB C;  4GND A;  2KYU A;  4W4U A;  1X4J A;  3LDY A;  2LXP C;  1WEW A;  3RPG B;  3ASL A;  3SOW A;  1DCQ A;  2YSM A;  2RI7 A;  1JOC A;  3C6W A;  2ECJ A;  3C5K A;  4WA6 A;  2L0B A;  2MIQ A;  5J3X A;  3FJU B;  4NN2 A;  1BOR A;  1MM3 A;  2YVR A;  1DVP A;  5JG6 A;  2DX8 A;  3H7H A;  2LRI C;  3FAN A;  2YT5 A;  2AN6 A;  2PUY A;  4PPE A;  5LKX A;  2XP0 A;  4V3L C;  2BAY A;  2K16 A;  3L1Z B;  1WEQ A;  4LAD B;  2DJA A;  2LXH C;  4AYC B;  2YQL A;  2VPG A;  3O34 A;  4UI9 B;  1WGM A;  2QJ0 A;  4A4C A;  1WEV A;  3DDT A;  2JM3 A;  4GNE A;  1Z60 A;  2HDP A;  5SVY A;  5LKT A;  2YUR A;  2H0D B;  2YQM A;  4YAX A;  2LQ6 A;  2ECW A;  2LGL A;  1Z6U A;  2KKX A;  3N9M A;  2CON A;  2OXQ C;  2E61 A;  3PUQ A;  2CSV A;  2LGV A;  2KR4 A;  2KU3 A;  2M13 A;  2OWA A;  2I50 A;  2CSZ A;  4I7D A;  4ZDT A;  2MA6 A;  2NAA A;  5AIT A;  5B77 A;  1WEN A;  2M3H A;  4P5O B;  4UP5 A;  2XOC A;  2Y1M A;  3KV6 A;  1MBM A;  5KH3 A;  3DPL R;  2VP7 A;  2C2L A;  2KWN A;  3ZVZ B;  2M6M A;  5DKA A;  4H9D A;  5TDR A;  3GL6 A;  2B0O E;  3N9P A;  1G25 A;  2KFT A;  3LQH A;  1HYI A;  1VFY A;  3HTK C;  2JMI A;  3O70 A;  5KH9 A;  5D1L B;  2QIZ A;  2Y1N A;  1WE9 A;  3SUB A;  2KGI A;  2YYR A;  2YU4 A;  2MA5 A;  2H0D A;  2ECV A;  1MM2 A;  2JMD A;  1T1H A;  2RR4 A;  1WEE A;  5LKZ A;  4QQ4 A;  3ZPV 1;  1WEU A;  3VK6 A;  5KH7 A;  3LQJ A;  3FAO A;  4R7E A;  1IYM A;  2CKL B;  5B78 A;  2YRE A;  2F42 A;  4AP4 A;  2ECG A;  3O7A A;  2KE1 A;  4L7X A;  1F62 A;  2KIZ A;  5FB1 A;  5TDW A;  4YBM A;  2FUU A;  2P57 A;  5FEY A;  1K2F A;  5H1T A;  2L5U A;  4CA1 A;  2K17 A;  3O33 A;  2FUI A;  1LDK C;  3HCU A;  2VJE B;  4YC9 A;  3ZNI A;  2L75 A;  4ZQL A;  2UZG A;  2KRE A;  2JMJ A;  3Q1D A;  4F1P A;  2D8S A;  2D8U A;  3LVQ E;  2CT2 A;  5EYA F;  2MNY A;  2XEU A;  4XI1 A;  2VJF B;  3ZYQ A;  2YHN A;  4Z0O A;  1U6G B;  2LV9 A;  3SHB A;  2L43 A;  2Y43 A;  2KWJ A;  5AIU A;  2K1J A;  2C2V S;  2MD7 B;  4L58 A;  3M99 A;  4LK9 A;  2F6N A;  2FSA A;  4B7Y C;  2EXU A;  4QF2 A;  2ECT A;  2VPD A;  3KDE C;  3O37 A;  3LRQ A;  5LCW B;  2L7P A;  5B75 A;  1LDJ B;  2F6J A;  2VNF A;  3DQV R;  1VYX A;  2G45 A;  1HYJ A;  3I2D A;  3EB5 A;  3N9Q A;  2MNZ A;  3EB6 A;  3U5M A;  2M85 A;  4GNF A;  3O36 A;  1JM7 B;  1CHC A;  1X4I A;  2CKL A;  2LDR A;  2EA6 A;  4FO9 A;  3O47 A;  2MT5 A;  2YSJ A;  2YW8 A;  5B8D A;  3RTR B;  5H1U A;  2IQJ A;  2L80 A;  2FFW A;  4MSX A;  5SVI B;  3MHS A;  3HCT A;  4QF3 A;  5C11 A;  4MVT A;  1E4U A;  4A0C D;  2G6Q A;  2VJE A;  4S3O B;  4PTB A;  2XOY A;  4YBT A;  2YHO A;  2HYE D;  4Z0R A;  2XOZ A;  3LJU X;  4Q6F A;  4O64 A;  4C9Z A;  1N87 A;  4LKA A;  3L1X A;  4V3K C;  1ZBD B;  1Z2Q A;  3ZVY A;  2KWO A;  2VJF A;  5FER A;  3U5N A;  1WEP A;  2EGP A;  4GNG A;  3M63 A;  3FL2 A;  2G43 A;  4FJC A;  3PLW A;  2MKE A;  3T9K A;  2E6R A;  5B79 A;  3NG2 A;  4IC2 A;  4FIP A;  1WFK A;  1WEM A;  2KWK A;  5G0F A;  4WZ3 B;  4AUQ B;  4LJN A;  2LN0 A;  3U5P A;  2CSY A;  4R8P K;  5I3L A;  1WIL A;  3V43 A;  5G05 B;  1FBV A;  4YBS A;  3M62 A;  4O62 A;  3L11 A;  3DWD A;  3LQI A;  2EOD A;  3FEH A;  1JM7 A;  2MUM A;  1V87 A;  3QZV A;  5C13 A;  5D1K B; 
#chains in the Genus database with same CATH homology
 2E6S A;  4FK5 A;  2PNX A;  4I7C A;  3MHH A;  4A49 A;  2LGG A;  5LKU A;  3KV5 A;  3IHP A;  4YAT A;  2VPE A;  3KNV A;  5D1M B;  4R2Y A;  1FP0 A;  3N9O A;  5TRB A;  4X3G A;  4BBQ A;  3PUR A;  5B76 A;  1RMD A;  5FB0 A;  4AVX A;  2ECN A;  4A4B A;  3N9N A;  4WZ0 A;  3PHD A;  1WES A;  4ZUX U;  4YAD A;  5DIN A;  4B86 C;  3T6R A;  1XWH A;  4BHW A;  4N3W A;  4LLB A;  2XB1 A;  3KQI A;  4N4F A;  4F52 B;  3HCS A;  4S3O C;  3GV4 A;  4CCG X;  3ZPV E;  2ZET C;  2MD8 C;  5H9M A;  5TBN A;  4IC3 A;  3O35 A;  5G04 B;  2JRJ A;  2M1R A;  3SOX A;  1X4U A;  5TAB A;  3SOU A;  1VD4 A;  4GB0 A;  3T7L A;  2ECI A;  4UP0 A;  2YUC A;  2K4D A;  4WZ2 A;  2KGG A;  4YAB A;  2QIC A;  2LGK A;  3U5O A;  1WIM A;  4I7B A;  3N9L A;  2VPB A;  3ZTG A;  3RPG C;  2IDA A;  1WEO A;  4AYC A;  5H1V A;  2RSD A;  4TKP B;  4GND A;  4W4U A;  2KYU A;  1X4J A;  2LXP C;  1WEW A;  3RPG B;  3ASL A;  3SOW A;  2YSM A;  2RI7 A;  1JOC A;  3C6W A;  2ECJ A;  3C5K A;  4WA6 A;  2L0B A;  2MIQ A;  5J3X A;  4NN2 A;  1BOR A;  1MM3 A;  1DVP A;  5JG6 A;  2DX8 A;  2LRI C;  2YT5 A;  2AN6 A;  2PUY A;  4PPE A;  5LKX A;  4V3L C;  2BAY A;  2K16 A;  3L1Z B;  1WEQ A;  4LAD B;  2LXH C;  4AYC B;  2YQL A;  2VPG A;  3O34 A;  4UI9 B;  1WGM A;  2QJ0 A;  4A4C A;  1WEV A;  4GNE A;  1Z60 A;  2HDP A;  5LKT A;  2YUR A;  2H0D B;  2YQM A;  4YAX A;  2LQ6 A;  2ECW A;  2LGL A;  1Z6U A;  3N9M A;  2OXQ C;  3PUQ A;  2LGV A;  2KR4 A;  2KU3 A;  2I50 A;  2CSZ A;  4I7D A;  4ZDT A;  2MA6 A;  2NAA A;  5AIT A;  5B77 A;  1WEN A;  2M3H A;  4P5O B;  4UP5 A;  2Y1M A;  3KV6 A;  5KH3 A;  3DPL R;  2VP7 A;  2C2L A;  2KWN A;  3ZVZ B;  2M6M A;  5DKA A;  5TDR A;  3GL6 A;  3N9P A;  1G25 A;  2KFT A;  3LQH A;  1HYI A;  1VFY A;  3HTK C;  2JMI A;  3O70 A;  5KH9 A;  5D1L B;  2QIZ A;  2Y1N A;  1WE9 A;  2KGI A;  2YYR A;  2YU4 A;  2MA5 A;  2H0D A;  2ECV A;  1MM2 A;  2JMD A;  1T1H A;  1WEE A;  5LKZ A;  3ZPV 1;  1WEU A;  3VK6 A;  5KH7 A;  3LQJ A;  4R7E A;  1IYM A;  2CKL B;  5B78 A;  2YRE A;  2F42 A;  4AP4 A;  2ECG A;  3O7A A;  2KE1 A;  4L7X A;  1F62 A;  2KIZ A;  5FB1 A;  5TDW A;  4YBM A;  2FUU A;  5FEY A;  1K2F A;  5H1T A;  2L5U A;  4CA1 A;  2K17 A;  3O33 A;  2FUI A;  1LDK C;  3HCU A;  2VJE B;  4YC9 A;  3ZNI A;  2L75 A;  4ZQL A;  2UZG A;  2KRE A;  2JMJ A;  2D8S A;  2CT2 A;  5EYA F;  2MNY A;  2XEU A;  4XI1 A;  2VJF B;  3ZYQ A;  2YHN A;  1U6G B;  2LV9 A;  3SHB A;  2L43 A;  2Y43 A;  2KWJ A;  5AIU A;  2K1J A;  2C2V S;  2MD7 B;  4L58 A;  3M99 A;  4LK9 A;  2F6N A;  2FSA A;  4B7Y C;  4QF2 A;  2ECT A;  2VPD A;  3O37 A;  3LRQ A;  5LCW B;  5B75 A;  1LDJ B;  2F6J A;  2VNF A;  3DQV R;  1VYX A;  2G45 A;  1HYJ A;  3I2D A;  3EB5 A;  3N9Q A;  2MNZ A;  3EB6 A;  3U5M A;  2M85 A;  4GNF A;  3O36 A;  1JM7 B;  1CHC A;  1X4I A;  2CKL A;  2LDR A;  2EA6 A;  4FO9 A;  2MT5 A;  2YSJ A;  2YW8 A;  5B8D A;  3RTR B;  5H1U A;  2L80 A;  4MSX A;  3MHS A;  3HCT A;  4QF3 A;  5C11 A;  4MVT A;  1E4U A;  4A0C D;  2G6Q A;  2VJE A;  4S3O B;  4PTB A;  4YBT A;  2YHO A;  2HYE D;  4Q6F A;  4O64 A;  4C9Z A;  1N87 A;  4LKA A;  3L1X A;  4V3K C;  1ZBD B;  1Z2Q A;  3ZVY A;  2KWO A;  2VJF A;  5FER A;  3U5N A;  1WEP A;  2EGP A;  4GNG A;  3M63 A;  3FL2 A;  2G43 A;  4FJC A;  2E6R A;  5B79 A;  3NG2 A;  4IC2 A;  4FIP A;  1WFK A;  1WEM A;  2KWK A;  5G0F A;  4WZ3 B;  4AUQ B;  4LJN A;  2LN0 A;  3U5P A;  2CSY A;  4R8P K;  5I3L A;  1WIL A;  3V43 A;  5G05 B;  1FBV A;  4YBS A;  3M62 A;  3L11 A;  3LQI A;  2EOD A;  1JM7 A;  2MUM A;  1V87 A;  3QZV A;  5C13 A;  5D1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...