4NN2A

Protein crystal structure of human borjeson-forssman-lehmann syndrome associated protein phf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
TRPKCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKLYCKNHSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 6
publication title Crystal Structure of the second extended PHD domain of human PHF6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13771 zf-HC5HC2H PHD-like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4nn2A00
2QJ0A 2FUIA 4A49A 2XEUA 4BHWA 2MD7B 2YSJA 2KWOA 2C2LA 3O34A 5B75A 5G05B 2JMDA 1Z2QA 4YATA 1WGMA 3LQHA 2CKLB 4GNDA 2ECNA 3V43A 3L1XA 5D1LB 5G0FA 1WEOA 2NAAA 2YQLA 3LRQA 2ZETC 1LDJB 3EB5A 5B77A 3ZNIA 2KR4A 2PUYA 4AP4A 4AYCB 3PHDA 3ZTGA 5TDRA 4LADB 2ECVA 4I7DA 1N87A 4A0CD 2DX8A 2MA6A 3NG2A 5FB0A 4R2YA 2LQ6A 4L58A 3N9PA 5TBNA 1ZBDB 1DVPA 2KGIA 1HYIA 1VD4A 2ECWA 3HCSA 1WEPA 2KIZA 2QICA 4L7XA 3O33A 3ZYQA 2EODA 3HCUA 3SHBA 2LN0A 2LXHC 3DQVR 2VJEB 1WEWA 2JMJA 1VFYA 5B76A 2PNXA 2JMIA 5B79A 1X4UA 2YSMA 2K4DA 1CHCA 1U6GB 5TDWA 3O70A 1VYXA 3T6RA 2KREA 2MD8C 4CA1A 1WFKA 3QZVA 4N3WA 5LCWB 1Z60A 4YBTA 4ZQLA 2G6QA 2YYRA 2VPGA 2JRJA 4S3OB 4YBSA 2YQMA 5FB1A 1JM7B 2H0DB 2D8SA 2HYED 1XWHA 5DKAA 3GV4A 1LDKC 4GB0A 2CSZA 2KYUA 5C13A 5I3LA 4WA6A 4R8PK 2G43A 1IYMA 4QF2A 2UZGA 3N9LA 2FUUA 2M3HA 5LKZA 1F62A 5FERA 3SOWA 5JG6A 3C6WA 1WEUA 2LGVA 1K2FA 2L80A 1JOCA 2ECTA 3O35A 5C11A 5H1TA 4WZ2A 5KH7A 4IC2A 3IHPA 4WZ3B 2K1JA 1WEQA 2LGKA 4AVXA 2LXPC 4UI9B 3HTKC 4W4UA 2LDRA 2VPEA 2KU3A 5LKTA 2IDAA 4PPEA 3KNVA 4MVTA 3RPGB 2EGPA 2M85A 3N9OA 3RTRB 4I7BA 4YC9A 1WESA 2K16A 3T7LA 4A4BA 1WILA 4PTBA 1G25A 2YU4A 4GNGA 5G04B 2YT5A 2Y1MA 4I7CA 3KV6A 3RPGC 2YHNA 4WZ0A 1WE9A 2G45A 1X4IA 1WEEA 4UP5A 4BBQA 3U5MA 2YUCA 4GNEA 2MT5A 2FSAA 2KWKA 3KV5A 3O36A 2HDPA 2LV9A 5J3XA 4A4CA 2VP7A 2VJFA 1WEVA 2VPBA 4FK5A 4YABA 2LGLA 2CT2A 4XI1A 4C9ZA 2AN6A 2Y43A 1Z6UA 2ECJA 3ZVYA 5LKUA 3U5OA 2E6SA 2KGGA 3GL6A 4FIPA 2KWJA 3ZVZB 1X4JA 2KFTA 3PURA 4LJNA 4F52B 2CKLA 4O64A 4ZDTA 2RSDA 2L5UA 3O37A 5B8DA 3SOUA 4MSXA 2EA6A 3ASLA 3HCTA 5H1UA 4B86C 4V3KC 3DPLR 1FP0A 2E6RA 3N9NA 5TABA 3VK6A 2ECIA 4TKPB 3L11A 2LRIC 4P5OB 4AYCA 2Y1NA 3C5KA 1V87A 2YW8A 2YREA 2LGGA 3LQJA 3FL2A 4B7YC 3U5NA 4Q6FA 4GNFA 5H9MA 1MM3A 3ZPV1 2KWNA 3ZPVE 4QF3A 5D1KB 5KH3A 1WIMA 2MA5A 5LKXA 2MNYA 4X3GA 1MM2A 2VJEA 1E4UA 4R7EA 2OXQC 1BORA 3MHHA 4YBMA 2L0BA 1WEMA 2F42A 2MNZA 5B78A 3M62A 2QIZA 2YHOA 3N9QA 1FBVA 3U5PA 2M6MA 2K17A 5KH9A 4UP0A 4NN2A 3EB6A 4N4FA 2XB1A 4AUQB 4FO9A 4YADA 2VNFA 1JM7A 1WENA 2F6JA 3LQIA 2H0DA 4ZUXU 4LK9A 4V3LC 5FEYA 4FJCA 5AITA 2YURA 2M1RA 4YAXA 5H1VA 2F6NA 2L75A 2MUMA 3L1ZB 2C2VS 3MHSA 3KQIA 5AIUA 2ECGA 4LKAA 2BAYA 4LLBA 2VPDA 3PUQA 2CSYA 4IC3A 5D1MB 1HYJA 2MIQA 5EYAF 1T1HA 3O7AA 5TRBA 3SOXA 4CCGX 3I2DA 3M99A 3N9MA 1RMDA 3M63A 5DINA 2VJFB 2L43A 2RI7A 2I50A 2KE1A 4S3OC
chains in the Genus database with same CATH superfamily
2QJ0A 2FUIA 4A49A 2KKYA 2FD4A 2XEUA 4BHWA 2MD7B 2YSJA 2KWOA 2CSVA 2C2LA 3SUBA 2CRWA 3O34A 5B75A 5G05B 2JMDA 1Z2QA 4YATA 1WGMA 3LQHA 2CKLB 2D8UA 4GNDA 2ECNA 3JUEA 3V43A 3L1XA 5D1LB 5G0FA 1WEOA 2NAAA 2YQLA 3LRQA 2ZETC 1LDJB 2MKEA 3EB5A 5B77A 3ZNIA 2KR4A 2CONA 2PUYA 4AP4A 4AYCB 2XOCA 3PHDA 3ZTGA 5TDRA 4LADB 2ECVA 4I7DA 1N87A 4A0CD 2DX8A 2MA6A 3NG2A 5FB0A 2B0OE 4R2YA 2LQ6A 4L58A 3N9PA 5TBNA 1ZBDB 1DVPA 2KGIA 1HYIA 2XP0A 1VD4A 2ECWA 3HCSA 2LAUA 1WEPA 2KIZA 2QICA 4L7XA 3O33A 3ZYQA 5SVYA 2EODA 3HCUA 3SHBA 2LN0A 2LXHC 3DQVR 2VJEB 1WEWA 2JMJA 1VFYA 5B76A 2PNXA 2JMIA 5B79A 1X4UA 2YSMA 2K4DA 1CHCA 1U6GB 5TDWA 3O70A 1VYXA 3T6RA 2KREA 2MD8C 4CA1A 1WFKA 2JM3A 3QZVA 4N3WA 5LCWB 1Z60A 4YBTA 4ZQLA 2G6QA 2YYRA 2VPGA 2JRJA 4S3OB 4YBSA 2YQMA 5FB1A 1JM7B 2H0DB 2D8SA 2HYED 1XWHA 5DKAA 3GV4A 1LDKC 4GB0A 2CSZA 2KYUA 5C13A 5I3LA 4WA6A 4R8PK 2G43A 1IYMA 4QF2A 2UZGA 3N9LA 2FUUA 2M3HA 5LKZA 1F62A 5FERA 3SOWA 5JG6A 3MDBC 3C6WA 1WEUA 2LGVA 1K2FA 4F1PA 2L80A 1JOCA 2ECTA 3O35A 4QQ4A 5C11A 5H1TA 4WZ2A 5KH7A 4IC2A 3IHPA 2FFWA 2EXUA 4WZ3B 2K1JA 1WEQA 2LGKA 4AVXA 2LXPC 4UI9B 3HTKC 4W4UA 2KKXA 2LDRA 2OWAA 2VPEA 1DCQA 2KU3A 5LKTA 2IDAA 4PPEA 3KNVA 4MVTA 4OGEA 3RPGB 2EGPA 2M85A 3N9OA 3RTRB 4I7BA 4YC9A 1WESA 2K16A 3LVRE 3T7LA 2E61A 2XOYA 4A4BA 1WILA 4PTBA 2M13A 1G25A 2YU4A 2DSMA 4GNGA 5G04B 3M7KA 2YT5A 2Y1MA 4I7CA 3KV6A 3FM8C 3RPGC 2YHNA 4WZ0A 2DJAA 1WE9A 2G45A 1X4IA 4O62A 1WEEA 4UP5A 4BBQA 3U5MA 2YUCA 4GNEA 2MT5A 3FAOA 2FSAA 2KWKA 3KV5A 3O36A 2HDPA 3LDYA 2LV9A 2XOZA 5J3XA 4A4CA 3PLWA 2VP7A 2VJFA 4H9DA 1WEVA 2VPBA 4FK5A 4YABA 2LGLA 2CT2A 4XI1A 4C9ZA 5SVIA 2AN6A 2Y43A 1Z6UA 2ECJA 3ZVYA 5LKUA 3KDEC 3U5OA 2E6SA 2KGGA 3GL6A 4FIPA 2KWJA 3ZVZB 1X4JA 2KFTA 3PURA 4LJNA 4F52B 2CKLA 4O64A 4ZDTA 2RSDA 2L5UA 3DWDA 3O37A 5B8DA 3SOUA 4MSXA 2EA6A 3ASLA 3HCTA 2JUNA 3T9KA 5H1UA 4B86C 4V3KC 3DPLR 1FP0A 2E6RA 3N9NA 5TABA 3VK6A 2ECIA 4TKPB 3L11A 4P5OB 2LRIC 2CRRA 4AYCA 2Y1NA 3C5KA 1V87A 2P57A 3H7HA 2YW8A 2YREA 2EGMA 2LGGA 3LQJA 3FL2A 4B7YC 2IQJA 3U5NA 4Q6FA 4GNFA 5H9MA 1MM3A 3ZPV1 2KWNA 3ZPVE 4QF3A 5D1KB 5KH3A 1WIMA 2RR4A 2MA5A 5LKXA 2MNYA 4X3GA 1MM2A 2VJEA 1E4UA 3FANA 4R7EA 2OXQC 1BORA 3MHHA 4YBMA 2L0BA 3Q1DA 1WEMA 2F42A 2MNZA 3DDTA 5B78A 3M62A 2QIZA 2L7PA 2YHOA 3E2DA 3N9QA 1FBVA 3U5PA 2M6MA 2K17A 5KH9A 3FEHA 4UP0A 4NN2A 3EB6A 4N4FA 2XB1A 4AUQB 4FO9A 4YADA 2VNFA 4Z0OA 1JM7A 1WENA 2F6JA 3LQIA 2H0DA 4ZUXU 4LK9A 4V3LC 5FEYA 4FJCA 3FJUB 5AITA 2YURA 2M1RA 4YAXA 5H1VA 4Z0RA 2F6NA 2L75A 2MUMA 3L1ZB 2C2VS 3MHSA 3KQIA 5AIUA 2ECGA 4LKAA 5SVXA 4LLBA 2BAYA 3LVQE 3O47A 5K3QA 2VPDA 3PUQA 2CSYA 4IC3A 5D1MB 1HYJA 2MIQA 1T1HA 5EYAF 3O7AA 3LJUX 5TRBA 3SOXA 1MBMA 4CCGX 3I2DA 3M99A 3N9MA 1RMDA 3M63A 5DINA 2VJFB 2L43A 2RI7A 2YVRA 2I50A 5SVIB 4OGCA 2KE1A 4S3OC
chains in the Genus database with same CATH topology
2QJ0A 2FUIA 4A49A 2XEUA 4BHWA 2MD7B 2YSJA 2KWOA 2C2LA 3O34A 5B75A 5G05B 2JMDA 1Z2QA 4YATA 1WGMA 3LQHA 2CKLB 4GNDA 2ECNA 3V43A 3L1XA 5D1LB 5G0FA 1WEOA 2NAAA 2YQLA 3LRQA 2ZETC 1LDJB 3EB5A 5B77A 3ZNIA 2KR4A 2PUYA 4AP4A 4AYCB 3PHDA 3ZTGA 5TDRA 4LADB 2ECVA 4I7DA 1N87A 4A0CD 2DX8A 2MA6A 3NG2A 5FB0A 4R2YA 2LQ6A 4L58A 3N9PA 5TBNA 1ZBDB 1DVPA 2KGIA 1HYIA 1VD4A 2ECWA 3HCSA 1WEPA 2KIZA 2QICA 4L7XA 3O33A 3ZYQA 2EODA 3HCUA 3SHBA 2LN0A 2LXHC 3DQVR 2VJEB 1WEWA 2JMJA 1VFYA 5B76A 2PNXA 2JMIA 5B79A 1X4UA 2YSMA 2K4DA 1CHCA 1U6GB 5TDWA 3O70A 1VYXA 3T6RA 2KREA 2MD8C 4CA1A 1WFKA 3QZVA 4N3WA 5LCWB 1Z60A 4YBTA 4ZQLA 2G6QA 2YYRA 2VPGA 2JRJA 4S3OB 4YBSA 2YQMA 5FB1A 1JM7B 2H0DB 2D8SA 2HYED 1XWHA 5DKAA 3GV4A 1LDKC 4GB0A 2CSZA 2KYUA 5C13A 5I3LA 4WA6A 4R8PK 2G43A 1IYMA 4QF2A 2UZGA 3N9LA 2FUUA 2M3HA 5LKZA 1F62A 5FERA 3SOWA 5JG6A 3C6WA 1WEUA 2LGVA 1K2FA 2L80A 1JOCA 2ECTA 3O35A 5C11A 5H1TA 4WZ2A 5KH7A 4IC2A 3IHPA 4WZ3B 2K1JA 1WEQA 2LGKA 4AVXA 2LXPC 4UI9B 3HTKC 4W4UA 2LDRA 2VPEA 2KU3A 5LKTA 2IDAA 4PPEA 3KNVA 4MVTA 3RPGB 2EGPA 2M85A 3N9OA 3RTRB 4I7BA 4YC9A 1WESA 2K16A 3T7LA 4A4BA 1WILA 4PTBA 1G25A 2YU4A 4GNGA 5G04B 2YT5A 2Y1MA 4I7CA 3KV6A 3RPGC 2YHNA 4WZ0A 1WE9A 2G45A 1X4IA 1WEEA 4UP5A 4BBQA 3U5MA 2YUCA 4GNEA 2MT5A 2FSAA 2KWKA 3KV5A 3O36A 2HDPA 2LV9A 5J3XA 4A4CA 2VP7A 2VJFA 1WEVA 2VPBA 4FK5A 4YABA 2LGLA 2CT2A 4XI1A 4C9ZA 2AN6A 2Y43A 1Z6UA 2ECJA 3ZVYA 5LKUA 3U5OA 2E6SA 2KGGA 3GL6A 4FIPA 2KWJA 3ZVZB 1X4JA 2KFTA 3PURA 4LJNA 4F52B 2CKLA 4O64A 4ZDTA 2RSDA 2L5UA 3O37A 5B8DA 3SOUA 4MSXA 2EA6A 3ASLA 3HCTA 5H1UA 4B86C 4V3KC 3DPLR 1FP0A 2E6RA 3N9NA 5TABA 3VK6A 2ECIA 4TKPB 3L11A 2LRIC 4P5OB 4AYCA 2Y1NA 3C5KA 1V87A 2YW8A 2YREA 2LGGA 3LQJA 3FL2A 4B7YC 3U5NA 4Q6FA 4GNFA 5H9MA 1MM3A 3ZPV1 2KWNA 3ZPVE 4QF3A 5D1KB 5KH3A 1WIMA 2MA5A 5LKXA 2MNYA 4X3GA 1MM2A 2VJEA 1E4UA 4R7EA 2OXQC 1BORA 3MHHA 4YBMA 2L0BA 1WEMA 2F42A 2MNZA 5B78A 3M62A 2QIZA 2YHOA 3N9QA 1FBVA 3U5PA 2M6MA 2K17A 5KH9A 4UP0A 4NN2A 3EB6A 4N4FA 2XB1A 4AUQB 4FO9A 4YADA 2VNFA 1JM7A 1WENA 2F6JA 3LQIA 2H0DA 4ZUXU 4LK9A 4V3LC 5FEYA 4FJCA 5AITA 2YURA 2M1RA 4YAXA 5H1VA 2F6NA 2L75A 2MUMA 3L1ZB 2C2VS 3MHSA 3KQIA 5AIUA 2ECGA 4LKAA 2BAYA 4LLBA 2VPDA 3PUQA 2CSYA 4IC3A 5D1MB 1HYJA 2MIQA 5EYAF 1T1HA 3O7AA 5TRBA 3SOXA 4CCGX 3I2DA 3M99A 3N9MA 1RMDA 3M63A 5DINA 2VJFB 2L43A 2RI7A 2I50A 2KE1A 4S3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ0 A;  2FUI A;  4A49 A;  2XEU A;  4BHW A;  2MD7 B;  2YSJ A;  2KWO A;  2C2L A;  3O34 A;  5B75 A;  5G05 B;  2JMD A;  1Z2Q A;  4YAT A;  1WGM A;  3LQH A;  2CKL B;  4GND A;  2ECN A;  3V43 A;  3L1X A;  5D1L B;  5G0F A;  1WEO A;  2NAA A;  2YQL A;  3LRQ A;  2ZET C;  1LDJ B;  3EB5 A;  5B77 A;  3ZNI A;  2KR4 A;  2PUY A;  4AP4 A;  4AYC B;  3PHD A;  3ZTG A;  5TDR A;  4LAD B;  2ECV A;  4I7D A;  1N87 A;  4A0C D;  2DX8 A;  2MA6 A;  3NG2 A;  5FB0 A;  4R2Y A;  2LQ6 A;  4L58 A;  3N9P A;  5TBN A;  1ZBD B;  1DVP A;  2KGI A;  1HYI A;  1VD4 A;  2ECW A;  3HCS A;  1WEP A;  2KIZ A;  2QIC A;  4L7X A;  3O33 A;  3ZYQ A;  2EOD A;  3HCU A;  3SHB A;  2LN0 A;  2LXH C;  3DQV R;  2VJE B;  1WEW A;  2JMJ A;  1VFY A;  5B76 A;  2PNX A;  2JMI A;  5B79 A;  1X4U A;  2YSM A;  2K4D A;  1CHC A;  1U6G B;  5TDW A;  3O70 A;  1VYX A;  3T6R A;  2KRE A;  2MD8 C;  4CA1 A;  1WFK A;  3QZV A;  4N3W A;  5LCW B;  1Z60 A;  4YBT A;  4ZQL A;  2G6Q A;  2YYR A;  2VPG A;  2JRJ A;  4S3O B;  4YBS A;  2YQM A;  5FB1 A;  1JM7 B;  2H0D B;  2D8S A;  2HYE D;  1XWH A;  5DKA A;  3GV4 A;  1LDK C;  4GB0 A;  2CSZ A;  2KYU A;  5C13 A;  5I3L A;  4WA6 A;  4R8P K;  2G43 A;  1IYM A;  4QF2 A;  2UZG A;  3N9L A;  2FUU A;  2M3H A;  5LKZ A;  1F62 A;  5FER A;  3SOW A;  5JG6 A;  3C6W A;  1WEU A;  2LGV A;  1K2F A;  2L80 A;  1JOC A;  2ECT A;  3O35 A;  5C11 A;  5H1T A;  4WZ2 A;  5KH7 A;  4IC2 A;  3IHP A;  4WZ3 B;  2K1J A;  1WEQ A;  2LGK A;  4AVX A;  2LXP C;  4UI9 B;  3HTK C;  4W4U A;  2LDR A;  2VPE A;  2KU3 A;  5LKT A;  2IDA A;  4PPE A;  3KNV A;  4MVT A;  3RPG B;  2EGP A;  2M85 A;  3N9O A;  3RTR B;  4I7B A;  4YC9 A;  1WES A;  2K16 A;  3T7L A;  4A4B A;  1WIL A;  4PTB A;  1G25 A;  2YU4 A;  4GNG A;  5G04 B;  2YT5 A;  2Y1M A;  4I7C A;  3KV6 A;  3RPG C;  2YHN A;  4WZ0 A;  1WE9 A;  2G45 A;  1X4I A;  1WEE A;  4UP5 A;  4BBQ A;  3U5M A;  2YUC A;  4GNE A;  2MT5 A;  2FSA A;  2KWK A;  3KV5 A;  3O36 A;  2HDP A;  2LV9 A;  5J3X A;  4A4C A;  2VP7 A;  2VJF A;  1WEV A;  2VPB A;  4FK5 A;  4YAB A;  2LGL A;  2CT2 A;  4XI1 A;  4C9Z A;  2AN6 A;  2Y43 A;  1Z6U A;  2ECJ A;  3ZVY A;  5LKU A;  3U5O A;  2E6S A;  2KGG A;  3GL6 A;  4FIP A;  2KWJ A;  3ZVZ B;  1X4J A;  2KFT A;  3PUR A;  4LJN A;  4F52 B;  2CKL A;  4O64 A;  4ZDT A;  2RSD A;  2L5U A;  3O37 A;  5B8D A;  3SOU A;  4MSX A;  2EA6 A;  3ASL A;  3HCT A;  5H1U A;  4B86 C;  4V3K C;  3DPL R;  1FP0 A;  2E6R A;  3N9N A;  5TAB A;  3VK6 A;  2ECI A;  4TKP B;  3L11 A;  2LRI C;  4P5O B;  4AYC A;  2Y1N A;  3C5K A;  1V87 A;  2YW8 A;  2YRE A;  2LGG A;  3LQJ A;  3FL2 A;  4B7Y C;  3U5N A;  4Q6F A;  4GNF A;  5H9M A;  1MM3 A;  3ZPV 1;  2KWN A;  3ZPV E;  4QF3 A;  5D1K B;  5KH3 A;  1WIM A;  2MA5 A;  5LKX A;  2MNY A;  4X3G A;  1MM2 A;  2VJE A;  1E4U A;  4R7E A;  2OXQ C;  1BOR A;  3MHH A;  4YBM A;  2L0B A;  1WEM A;  2F42 A;  2MNZ A;  5B78 A;  3M62 A;  2QIZ A;  2YHO A;  3N9Q A;  1FBV A;  3U5P A;  2M6M A;  2K17 A;  5KH9 A;  4UP0 A;  4NN2 A;  3EB6 A;  4N4F A;  2XB1 A;  4AUQ B;  4FO9 A;  4YAD A;  2VNF A;  1JM7 A;  1WEN A;  2F6J A;  3LQI A;  2H0D A;  4ZUX U;  4LK9 A;  4V3L C;  5FEY A;  4FJC A;  5AIT A;  2YUR A;  2M1R A;  4YAX A;  5H1V A;  2F6N A;  2L75 A;  2MUM A;  3L1Z B;  2C2V S;  3MHS A;  3KQI A;  5AIU A;  2ECG A;  4LKA A;  2BAY A;  4LLB A;  2VPD A;  3PUQ A;  2CSY A;  4IC3 A;  5D1M B;  1HYJ A;  2MIQ A;  5EYA F;  1T1H A;  3O7A A;  5TRB A;  3SOX A;  4CCG X;  3I2D A;  3M99 A;  3N9M A;  1RMD A;  3M63 A;  5DIN A;  2VJF B;  2L43 A;  2RI7 A;  2I50 A;  2KE1 A;  4S3O C; 
#chains in the Genus database with same CATH topology
 2QJ0 A;  2FUI A;  4A49 A;  2KKY A;  2FD4 A;  2XEU A;  4BHW A;  2MD7 B;  2YSJ A;  2KWO A;  2CSV A;  2C2L A;  3SUB A;  2CRW A;  3O34 A;  5B75 A;  5G05 B;  2JMD A;  1Z2Q A;  4YAT A;  1WGM A;  3LQH A;  2CKL B;  2D8U A;  4GND A;  2ECN A;  3JUE A;  3V43 A;  3L1X A;  5D1L B;  5G0F A;  1WEO A;  2NAA A;  2YQL A;  3LRQ A;  2ZET C;  1LDJ B;  2MKE A;  3EB5 A;  5B77 A;  3ZNI A;  2KR4 A;  2CON A;  2PUY A;  4AP4 A;  4AYC B;  2XOC A;  3PHD A;  3ZTG A;  5TDR A;  4LAD B;  2ECV A;  4I7D A;  1N87 A;  4A0C D;  2DX8 A;  2MA6 A;  3NG2 A;  5FB0 A;  2B0O E;  4R2Y A;  2LQ6 A;  4L58 A;  3N9P A;  5TBN A;  1ZBD B;  1DVP A;  2KGI A;  1HYI A;  2XP0 A;  1VD4 A;  2ECW A;  3HCS A;  2LAU A;  1WEP A;  2KIZ A;  2QIC A;  4L7X A;  3O33 A;  3ZYQ A;  5SVY A;  2EOD A;  3HCU A;  3SHB A;  2LN0 A;  2LXH C;  3DQV R;  2VJE B;  1WEW A;  2JMJ A;  1VFY A;  5B76 A;  2PNX A;  2JMI A;  5B79 A;  1X4U A;  2YSM A;  2K4D A;  1CHC A;  1U6G B;  5TDW A;  3O70 A;  1VYX A;  3T6R A;  2KRE A;  2MD8 C;  4CA1 A;  1WFK A;  2JM3 A;  3QZV A;  4N3W A;  5LCW B;  1Z60 A;  4YBT A;  4ZQL A;  2G6Q A;  2YYR A;  2VPG A;  2JRJ A;  4S3O B;  4YBS A;  2YQM A;  5FB1 A;  1JM7 B;  2H0D B;  2D8S A;  2HYE D;  1XWH A;  5DKA A;  3GV4 A;  1LDK C;  4GB0 A;  2CSZ A;  2KYU A;  5C13 A;  5I3L A;  4WA6 A;  4R8P K;  2G43 A;  1IYM A;  4QF2 A;  2UZG A;  3N9L A;  2FUU A;  2M3H A;  5LKZ A;  1F62 A;  5FER A;  3SOW A;  5JG6 A;  3MDB C;  3C6W A;  1WEU A;  2LGV A;  1K2F A;  4F1P A;  2L80 A;  1JOC A;  2ECT A;  3O35 A;  4QQ4 A;  5C11 A;  5H1T A;  4WZ2 A;  5KH7 A;  4IC2 A;  3IHP A;  2FFW A;  2EXU A;  4WZ3 B;  2K1J A;  1WEQ A;  2LGK A;  4AVX A;  2LXP C;  4UI9 B;  3HTK C;  4W4U A;  2KKX A;  2LDR A;  2OWA A;  2VPE A;  1DCQ A;  2KU3 A;  5LKT A;  2IDA A;  4PPE A;  3KNV A;  4MVT A;  4OGE A;  3RPG B;  2EGP A;  2M85 A;  3N9O A;  3RTR B;  4I7B A;  4YC9 A;  1WES A;  2K16 A;  3LVR E;  3T7L A;  2E61 A;  2XOY A;  4A4B A;  1WIL A;  4PTB A;  2M13 A;  1G25 A;  2YU4 A;  2DSM A;  4GNG A;  5G04 B;  3M7K A;  2YT5 A;  2Y1M A;  4I7C A;  3KV6 A;  3FM8 C;  3RPG C;  2YHN A;  4WZ0 A;  2DJA A;  1WE9 A;  2G45 A;  1X4I A;  4O62 A;  1WEE A;  4UP5 A;  4BBQ A;  3U5M A;  2YUC A;  4GNE A;  2MT5 A;  3FAO A;  2FSA A;  2KWK A;  3KV5 A;  3O36 A;  2HDP A;  3LDY A;  2LV9 A;  2XOZ A;  5J3X A;  4A4C A;  3PLW A;  2VP7 A;  2VJF A;  4H9D A;  1WEV A;  2VPB A;  4FK5 A;  4YAB A;  2LGL A;  2CT2 A;  4XI1 A;  4C9Z A;  5SVI A;  2AN6 A;  2Y43 A;  1Z6U A;  2ECJ A;  3ZVY A;  5LKU A;  3KDE C;  3U5O A;  2E6S A;  2KGG A;  3GL6 A;  4FIP A;  2KWJ A;  3ZVZ B;  1X4J A;  2KFT A;  3PUR A;  4LJN A;  4F52 B;  2CKL A;  4O64 A;  4ZDT A;  2RSD A;  2L5U A;  3DWD A;  3O37 A;  5B8D A;  3SOU A;  4MSX A;  2EA6 A;  3ASL A;  3HCT A;  2JUN A;  3T9K A;  5H1U A;  4B86 C;  4V3K C;  3DPL R;  1FP0 A;  2E6R A;  3N9N A;  5TAB A;  3VK6 A;  2ECI A;  4TKP B;  3L11 A;  4P5O B;  2LRI C;  2CRR A;  4AYC A;  2Y1N A;  3C5K A;  1V87 A;  2P57 A;  3H7H A;  2YW8 A;  2YRE A;  2EGM A;  2LGG A;  3LQJ A;  3FL2 A;  4B7Y C;  2IQJ A;  3U5N A;  4Q6F A;  4GNF A;  5H9M A;  1MM3 A;  3ZPV 1;  2KWN A;  3ZPV E;  4QF3 A;  5D1K B;  5KH3 A;  1WIM A;  2RR4 A;  2MA5 A;  5LKX A;  2MNY A;  4X3G A;  1MM2 A;  2VJE A;  1E4U A;  3FAN A;  4R7E A;  2OXQ C;  1BOR A;  3MHH A;  4YBM A;  2L0B A;  3Q1D A;  1WEM A;  2F42 A;  2MNZ A;  3DDT A;  5B78 A;  3M62 A;  2QIZ A;  2L7P A;  2YHO A;  3E2D A;  3N9Q A;  1FBV A;  3U5P A;  2M6M A;  2K17 A;  5KH9 A;  3FEH A;  4UP0 A;  4NN2 A;  3EB6 A;  4N4F A;  2XB1 A;  4AUQ B;  4FO9 A;  4YAD A;  2VNF A;  4Z0O A;  1JM7 A;  1WEN A;  2F6J A;  3LQI A;  2H0D A;  4ZUX U;  4LK9 A;  4V3L C;  5FEY A;  4FJC A;  3FJU B;  5AIT A;  2YUR A;  2M1R A;  4YAX A;  5H1V A;  4Z0R A;  2F6N A;  2L75 A;  2MUM A;  3L1Z B;  2C2V S;  3MHS A;  3KQI A;  5AIU A;  2ECG A;  4LKA A;  5SVX A;  4LLB A;  2BAY A;  3LVQ E;  3O47 A;  5K3Q A;  2VPD A;  3PUQ A;  2CSY A;  4IC3 A;  5D1M B;  1HYJ A;  2MIQ A;  1T1H A;  5EYA F;  3O7A A;  3LJU X;  5TRB A;  3SOX A;  1MBM A;  4CCG X;  3I2D A;  3M99 A;  3N9M A;  1RMD A;  3M63 A;  5DIN A;  2VJF B;  2L43 A;  2RI7 A;  2YVR A;  2I50 A;  5SVI B;  4OGC A;  2KE1 A;  4S3O C; 
#chains in the Genus database with same CATH homology
 2QJ0 A;  2FUI A;  4A49 A;  2XEU A;  4BHW A;  2MD7 B;  2YSJ A;  2KWO A;  2C2L A;  3O34 A;  5B75 A;  5G05 B;  2JMD A;  1Z2Q A;  4YAT A;  1WGM A;  3LQH A;  2CKL B;  4GND A;  2ECN A;  3V43 A;  3L1X A;  5D1L B;  5G0F A;  1WEO A;  2NAA A;  2YQL A;  3LRQ A;  2ZET C;  1LDJ B;  3EB5 A;  5B77 A;  3ZNI A;  2KR4 A;  2PUY A;  4AP4 A;  4AYC B;  3PHD A;  3ZTG A;  5TDR A;  4LAD B;  2ECV A;  4I7D A;  1N87 A;  4A0C D;  2DX8 A;  2MA6 A;  3NG2 A;  5FB0 A;  4R2Y A;  2LQ6 A;  4L58 A;  3N9P A;  5TBN A;  1ZBD B;  1DVP A;  2KGI A;  1HYI A;  1VD4 A;  2ECW A;  3HCS A;  1WEP A;  2KIZ A;  2QIC A;  4L7X A;  3O33 A;  3ZYQ A;  2EOD A;  3HCU A;  3SHB A;  2LN0 A;  2LXH C;  3DQV R;  2VJE B;  1WEW A;  2JMJ A;  1VFY A;  5B76 A;  2PNX A;  2JMI A;  5B79 A;  1X4U A;  2YSM A;  2K4D A;  1CHC A;  1U6G B;  5TDW A;  3O70 A;  1VYX A;  3T6R A;  2KRE A;  2MD8 C;  4CA1 A;  1WFK A;  3QZV A;  4N3W A;  5LCW B;  1Z60 A;  4YBT A;  4ZQL A;  2G6Q A;  2YYR A;  2VPG A;  2JRJ A;  4S3O B;  4YBS A;  2YQM A;  5FB1 A;  1JM7 B;  2H0D B;  2D8S A;  2HYE D;  1XWH A;  5DKA A;  3GV4 A;  1LDK C;  4GB0 A;  2CSZ A;  2KYU A;  5C13 A;  5I3L A;  4WA6 A;  4R8P K;  2G43 A;  1IYM A;  4QF2 A;  2UZG A;  3N9L A;  2FUU A;  2M3H A;  5LKZ A;  1F62 A;  5FER A;  3SOW A;  5JG6 A;  3C6W A;  1WEU A;  2LGV A;  1K2F A;  2L80 A;  1JOC A;  2ECT A;  3O35 A;  5C11 A;  5H1T A;  4WZ2 A;  5KH7 A;  4IC2 A;  3IHP A;  4WZ3 B;  2K1J A;  1WEQ A;  2LGK A;  4AVX A;  2LXP C;  4UI9 B;  3HTK C;  4W4U A;  2LDR A;  2VPE A;  2KU3 A;  5LKT A;  2IDA A;  4PPE A;  3KNV A;  4MVT A;  3RPG B;  2EGP A;  2M85 A;  3N9O A;  3RTR B;  4I7B A;  4YC9 A;  1WES A;  2K16 A;  3T7L A;  4A4B A;  1WIL A;  4PTB A;  1G25 A;  2YU4 A;  4GNG A;  5G04 B;  2YT5 A;  2Y1M A;  4I7C A;  3KV6 A;  3RPG C;  2YHN A;  4WZ0 A;  1WE9 A;  2G45 A;  1X4I A;  1WEE A;  4UP5 A;  4BBQ A;  3U5M A;  2YUC A;  4GNE A;  2MT5 A;  2FSA A;  2KWK A;  3KV5 A;  3O36 A;  2HDP A;  2LV9 A;  5J3X A;  4A4C A;  2VP7 A;  2VJF A;  1WEV A;  2VPB A;  4FK5 A;  4YAB A;  2LGL A;  2CT2 A;  4XI1 A;  4C9Z A;  2AN6 A;  2Y43 A;  1Z6U A;  2ECJ A;  3ZVY A;  5LKU A;  3U5O A;  2E6S A;  2KGG A;  3GL6 A;  4FIP A;  2KWJ A;  3ZVZ B;  1X4J A;  2KFT A;  3PUR A;  4LJN A;  4F52 B;  2CKL A;  4O64 A;  4ZDT A;  2RSD A;  2L5U A;  3O37 A;  5B8D A;  3SOU A;  4MSX A;  2EA6 A;  3ASL A;  3HCT A;  5H1U A;  4B86 C;  4V3K C;  3DPL R;  1FP0 A;  2E6R A;  3N9N A;  5TAB A;  3VK6 A;  2ECI A;  4TKP B;  3L11 A;  2LRI C;  4P5O B;  4AYC A;  2Y1N A;  3C5K A;  1V87 A;  2YW8 A;  2YRE A;  2LGG A;  3LQJ A;  3FL2 A;  4B7Y C;  3U5N A;  4Q6F A;  4GNF A;  5H9M A;  1MM3 A;  3ZPV 1;  2KWN A;  3ZPV E;  4QF3 A;  5D1K B;  5KH3 A;  1WIM A;  2MA5 A;  5LKX A;  2MNY A;  4X3G A;  1MM2 A;  2VJE A;  1E4U A;  4R7E A;  2OXQ C;  1BOR A;  3MHH A;  4YBM A;  2L0B A;  1WEM A;  2F42 A;  2MNZ A;  5B78 A;  3M62 A;  2QIZ A;  2YHO A;  3N9Q A;  1FBV A;  3U5P A;  2M6M A;  2K17 A;  5KH9 A;  4UP0 A;  4NN2 A;  3EB6 A;  4N4F A;  2XB1 A;  4AUQ B;  4FO9 A;  4YAD A;  2VNF A;  1JM7 A;  1WEN A;  2F6J A;  3LQI A;  2H0D A;  4ZUX U;  4LK9 A;  4V3L C;  5FEY A;  4FJC A;  5AIT A;  2YUR A;  2M1R A;  4YAX A;  5H1V A;  2F6N A;  2L75 A;  2MUM A;  3L1Z B;  2C2V S;  3MHS A;  3KQI A;  5AIU A;  2ECG A;  4LKA A;  2BAY A;  4LLB A;  2VPD A;  3PUQ A;  2CSY A;  4IC3 A;  5D1M B;  1HYJ A;  2MIQ A;  5EYA F;  1T1H A;  3O7A A;  5TRB A;  3SOX A;  4CCG X;  3I2D A;  3M99 A;  3N9M A;  1RMD A;  3M63 A;  5DIN A;  2VJF B;  2L43 A;  2RI7 A;  2I50 A;  2KE1 A;  4S3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...