2F6NA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the free form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 57
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2f6nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f6nA01
4NRAA 5D3TA 4I7DA 4AYCB 3I3JA 4TQNA 2MNYA 4MVTA 5FE8A 4FK5A 4AUQB 5F5ZA 2K17A 4A9NA 5CGPA 2LGKA 2YT5A 3SVGA 5C13A 1JM7A 4O7AA 4CCGX 1XWHA 4PPEA 3ASLA 4WZ3B 1IYMA 5D1MB 1WUGA 4TT6A 2ECWA 5C7NA 4NYVA 4ZDTA 2KWKA 3P1DA 4UYFB 5C87A 5COIA 2R10A 4NR4A 5CTLA 5KH3A 3IHPA 5E9YA 1WGMA 2KYUA 4YYMA 3I2DA 4I7CA 2RNYA 5B77A 2Y1NA 4A9FA 2ECNA 2NXBA 4N4HA 4FLPA 5FFYA 5D26A 4YYHA 2PNXA 5F62A 2YYRA 3V43A 4MR3A 3SOWA 2YDWA 4QSQA 5LVQA 5DYCA 3P1EA 5FDZA 3ZNIA 4QC3A 5ENEA 4DONA 5HQ7A 4YH4A 3MQMA 2DKWA 2JRJA 5A5OA 5B76A 4ZW1A 5L8UA 4WA6A 3ZPVE 3O36A 4C9ZA 5A5NA 3S92A 1RMDA 4HXLA 3JVJA 4HXKA 3P5OA 3SVHA 5ENGA 4CFKA 4UIUA 4IC2A 2QIZA 4QSRA 5FERA 2N9GA 2YHNA 2IDAA 4IC3A 4YADA 5DKCA 4NUEA 4UIZA 4PKLA 4NR5A 3P1CA 4KV1A 3U5KA 4CUTA 5CQAA 4Y03A 4MENA 5EGUA 3LRQA 1V87A 1F68A 4QR4A 4IR6A 4QR5A 4UITA 5ACYA 5CQ4A 3G0LA 5FB1A 3HMHA 2E7NA 5HEMA 3N9QA 4WHWA 2KFTA 5CPEA 4BJXA 2YYNA 2PUYA 2RS9B 3GG3A 2VJEA 2YSJA 5E9VA 3HMFA 4I7BA 5DKHA 5G0FA 5CS8A 3O34A 2R0VA 5LJ1A 3S91A 3N9NA 5FG4A 4MSXA 4NYWA 4ZC9A 5BT4A 5HQ6A 5A5PA 5FE6A 5A81A 3ZTGA 5EK9A 4R8PK 2E6SA 4CA1A 1LDJB 3FKMX 3JVLA 5AMEA 4QNSA 4TTEA 2DVVA 5EPRA 3IU5A 5CZGA 5I1QA 4GPJA 4FO9A 2E7OA 5D25A 5DW2A 5BT3A 2WP1A 5D0CA 5D3SA 1WILA 4O64A 2FSAA 5D3JA 4A0CD 5ENFA 5ENCA 5E9MA 4O7CA 4CURA 5C85A 3MHHA 2CKLA 5I88A 3Q2FA 5G4RA 3UV4A 5D1KB 5HLSA 4CUSA 1HYJA 5A5RA 2D9EA 2RNWA 5C89A 5TBNA 2H0DB 4HXPA 5L96A 2YUCA 5B75A 4WIVA 5I86A 2LDRA 3RCWA 2KTBB 5KU3A 1JM4B 2KWOA 4MR5A 4Q6FA 4AKNA 5L98A 4PTBA 2L43A 4QEUA 3GV4A 5HENA 5HCLA 3ZVYA 4NRCA 4J1PA 5E9IA 5DX4A 5DFBA 5JG6A 2MIQA 1Z60A 4A9MA 5EU1A 4O7BA 4YY6A 1LDKC 5FB0A 4OGJA 2QJ0A 3HCTA 5CUGA 5FE3A 4N3WA 2HYED 5EPBA 5LKUA 2M85A 5FE9A 3UW9A 4Z1SA 3N9OA 4LR6A 5CRZA 3U5JA 2OSSA 5I83A 5LKXA 2VJFB 2L5UA 4GNFA 2VNFA 5I40A 2L75A 3VK6A 3ZPV1 5EWHA 5DFDA 5ETBA 5DYAA 5E0RA 4QUTA 4A9OA 2M1RA 4BHWA 5EYAF 5FE5A 2KWJA 4ZUXU 4NR8A 4R2YA 5IGLA 2CKLB 5I29A 4AVXA 4A9HA 4NRBA 4LYIA 5F1LA 1WEEA 3O7AA 2MA5A 3FL2A 5IIDA 4YC9A 5CRMA 4PCIA 5J0DA 5F1HA 5II1A 1JSPB 4Z93A 2DVRA 2M6MA 3KQIA 4NS5A 3RPGC 5IBNA 5D3RA 4GNDA 2BAYA 5FFVA 2DWWA 5BT5A 1F62A 4ALHA 5FFWA 5DLXA 4PY6A 4HXSA 2D82A 2VPBA 2HDPA 1X4UA 3MULA 4UIVA 4N4FA 2MUMA 3M62A 5EICA 4YYNA 5DINA 5L97A 5H1VA 4B7YC 4IORA 4YBSA 1WEWA 2VPEA 5E9KA 5IGNA 4S3OC 5EM3A 4BBQA 4BW1A 5DYUA 5EA1A 5HFQA 2G4AA 3L1XA 5F63A 5CUCA 2C2VS 3QZVA 2RSDA 2YELA 4J0SA 2F6NA 2LGGA 2YW5A 4QY4A 5KTUA 4TU4A 4CUUA 2Y43A 5DKAA 4YAXA 3RPGB 5EV9A 1BORA 4GNEA 4YH3A 2RNXA 4LDFA 1DVPA 3D7CA 2D8SA 4UYDA 4LRGA 4A9JA 5IGMA 2YW8A 2LV9A 4Q0NA 1N72A 3MB4A 1X0JA 5II2A 4BW4A 4ZQLA 2G6QA 1JOCA 5TDWA 4TKPB 2YREA 4S3OB 2DATA 4YYKA 4LYWA 4V3KC 3T6RA 1VD4A 3HCUA 5EWDA 2LXPC 5E3GA 2YHOA 1JM7B 5FBXA 5G05B 2L5EA 5E74A 1WEQA 3M63A 4LZRA 2QICA 5CP5A 4QSTA 4NQMA 4MR4A 5E73A 5FE2A 5G04B 4O72A 4ALGA 2FUUA 1WESA 4YBTA 5ENBA 1WEMA 5KH9A 3LQJA 3O35A 1HYIA 3MHSA 4KV4A 2R0SA 4TT4A 2KU3A 5D1LB 1X4IA 1Z6UA 4J0RA 2KREA 2MNZA 2EODA 4A4BA 4QBMA 4R7EA 5EVAA 4QEVA 4TZ8A 5CQ5A 5TCMA 4F3IA 2ECIA 3DWYA 3UV2A 3KV5A 3U5OA 4QSSA 2KGGA 2VPDA 1MM3A 5DY7A 4MEQA 4X3GA 5J3XA 1FP0A 2L84A 2ECVA 5EP7A 3UVXA 5CQ8A 4NR7A 4TYLA 5AMFA 4HXNA 5DBMA 5FE0A 2LGVA 5EWCA 5TDRA 4CUPA 3RTRB 4QSWA 2CSYA 5B79A 5D3PA 2ZETC 3UVYA 2VPGA 4UP5A 3UV5A 5C11A 1WEUA 2CSZA 4UIYA 3SOXA 4QYDA 2WP2A 1ZBDB 2DVQA 3HTKC 3AQAA 3LJWA 2L0BA 4P5OB 1ZS5A 3QZSA 4AYCA 4NN2A 2KGIA 2VJEB 5A82A 3MUKA 4QC1A 1MM2A 4YATA 2F42A 5I7XA 3UVWA 5D3LA 4YK0A 5A5QA 5D3NA 5EWVA 4QZSA 2KR4A 4O77A 3KNVA 3DQVR 1G25A 4QEWA 4C67A 5JI8A 4PS5A 1E4UA 4UYFA 1WEVA 4MEOA 4QSPA 3MXFA 5ENJA 4OUFA 2ECJA 2I50A 4CUQA 4BW2A 2YQLA 4FIPA 3N9LA 4OGIA 5H1UA 5I7YA 4YYIA 2GRCA 4B86C 4FJCA 2YQMA 3ZYQA 3O37A 2LSPB 3LXJA 2YSMA 4QF2A 4YY4A 5LJ0A 1Z2QA 3LQHA 5FG5A 4MR6A 4IOQA 5CU8A 2Y1MA 5HFRA 4CL9A 5FH7A 2E3KA 3M99A 4IR4A 3HCSA 5LKZA 3P1FA 5EISA 5EQ1A 4HXOA 5HM0A 2AN6A 5FE7A 3PUQA 2MD8C 5KTXA 2L85A 4NUDA 3LQIA 4Z1QA 4A9LA 4TU6A 2OXQC 4YYGA 3N9PA 5H1TA 3KV6A 4BW3A 4O74A 4A9IA 4TS8A 5CUDA 4HBVA 5A85A 4RVRA 5KO4A 2L80A 1EQFA 4O70A 5C8GA 3EB5A 1E6IA 3O70A 5KHMA 2ECTA 5E3DA 5LKTA 4XI1A 2MJVB 2JMJA 4UIXA 5F2PA 3DAIA 4LLBA 5FEYA 3U5LA 5I80A 2KWNA 1FBVA 5HRWA 3T7LA 5ENHA 3L11A 5K29A 4W4UA 4IR3A 2LRIC 4O76A 5D3HA 2DX8A 3ONIA 4HBWA 4YYDA 3PHDA 4IR5A 4N4IA 2RO1A 1T1HA 4N4GA 5IGKA 1WEOA 5FE1A 3IU6A 2R0YA 2F6JA 4UYEA 5IG6A 3TLPA 1VYXA 4UIWA 4XUBA 2G45A 4HBXA 4HXMA 4O78A 3C5KA 4A9KA 5LJ2A 4LK9A 4CFLA 4YYJA 2K1JA 2G43A 3U5PA 2LN0A 2XEUA 4LKAA 5TABA 4X2IA 1VFYA 5LCWB 5EPSA 5LVRA 3K2JA 5L99A 4CLBA 1U6GB 5FE4A 4UI9B 5ENIA 5FH8A 2JMDA 4NQNA 4C66A 3G0JA 2OO1A 2EGPA 5F25A 5C4QA 4XUAA 2K16A 4L7XA 2H0DA 4O7FA 5DLZA 5DW1A 1CHCA 3SHBA 4UP0A 4XY9A 5HJCA 5I3LA 2K4DA 3NG2A 5AD3A 3SVFA 2I7KA 5JWMA 5CY9A 4QB3A 4QSVA 5L8TA 2KIZA 2UZGA 4NYXA 4Z6IA 2YEKA 4HXRA 5DKDA 2YURA 4E96A 1WENA 2EA6A 3HMEA 5F36A 3PURA 3U5MA 4Z6HA 3ZVZB 5A7CA 4F52B 5TRBA 4O7EA 2DVSA 5EWWA 5CUBA 4O75A 5E9LA 5F3AA 2M3HA 2XB1A 5ETDA 4A49A 5LUUA 1WIMA 5B8DA 5D24A 5DYXA 5CQ3A 3DPLR 1WEPA 2YQDA 5KH7A 4QF3A 3NXBA 4J3IA 4UYGA 5KTWA 1X4JA 2VJFA 4LYSA 5FH6A 3SOUA 2C2LA 5TB6A 1WE9A 4XYAA 2CT2A 5B78A 3JVKA 5G4SA 4L58A 4MEPA 4WZ0A 5CFWA 4TZ2A 2NAAA 5AIUA 5H9MA 4O71A 4LZSA 2RI7A 2MD7B 5AITA 4QUUA 5CQ7A 4GB0A 2LQ6A 5CUAA 5CQTA 5D7XA 4WZ2A 5CUEA 4LADB 4NR6A 1WUMA 2VP7A 3UVDA 4HBYA 4V3LC 2YEMA 2RFJA 3U5NA 4NXJA 5A83A 5A5SA 2YU4A 4Q0OA 4QR3A 4A4CA 5HRVA 2JMIA 4PCEA 3L1ZB 5HQ5A 5HELA 2MT5A 4KCXA 5AD2A 5F61A 4A9EA 2LGLA 4YBMA 1N87A 4NUCA 4NR9A 5CQ6A 2KE1A 5I89A 3JVMA 4IOOA 2H60A 4QYLA 2ECGA 3GL6A 4LC2A 2E6RA 5E7DA 5HRXA 3EB6A 4TT2A 1K2FA 4QSXA 3ZYUA 3Q2EA 3O33A 5FG6A 3MB3A 3QZTA 4WHUA 4AP4A 2FUIA 3N9MA 5EI4A 3C6WA 2LXHC 4XY8A 5H85A 2OUOA 3AADA 2I8NA 5DFCA 5F60A 4UYHA 1WFKA 2MA6A 4YABA 4GNGA 4QSUA 4LZ2A 4LJNA
chains in the Genus database with same CATH superfamily
4NRAA 5D3TA 4I7DA 4AYCB 3I3JA 4TQNA 2MNYA 4MVTA 5FE8A 4FK5A 4AUQB 5F5ZA 2K17A 4A9NA 5CGPA 2LGKA 2YT5A 3SVGA 5C13A 1JM7A 4O7AA 4CCGX 3D1DA 1XWHA 4PPEA 3ASLA 4WZ3B 1IYMA 5D1MB 1WUGA 4TT6A 2ECWA 5C7NA 4NYVA 4ZDTA 2KWKA 2JUNA 3P1DA 4UYFB 5C87A 5COIA 2R10A 4NR4A 5CTLA 5KH3A 3IHPA 5E9YA 1WGMA 2KYUA 4YYMA 3I2DA 4I7CA 2RNYA 5B77A 2Y1NA 4A9FA 2ECNA 2NXBA 4N4HA 4FLPA 5FFYA 5D26A 4YYHA 2PNXA 5F62A 2YYRA 5SVXA 4MR3A 3DDTA 3SOWA 3V43A 2YDWA 4QSQA 5LVQA 5DYCA 3P1EA 5FDZA 3ZNIA 4QC3A 5ENEA 4DONA 5HQ7A 4YH4A 3MQMA 2DKWA 2JRJA 5A5OA 5B76A 4ZW1A 5L8UA 4WA6A 3ZPVE 3O36A 4C9ZA 5A5NA 3S92A 1RMDA 4HXLA 3JVJA 4HXKA 3P5OA 3SVHA 5ENGA 2EJNA 4UIUA 4CFKA 2QIZA 4QSRA 4IC2A 2N9GA 2YHNA 2IDAA 2KKYA 4F1PA 5FERA 4IC3A 4YADA 5DKCA 4NUEA 1ZKRA 4UIZA 4PKLA 4NR5A 3P1CA 4KV1A 3U5KA 4CUTA 5CQAA 4Y03A 4MENA 5EGUA 2OWAA 1V87A 1F68A 4QR4A 3LRQA 3LJUX 4IR6A 4QR5A 4UITA 5ACYA 5CQ4A 3G0LA 5FB1A 3HMHA 2E7NA 5HEMA 3N9QA 4WHWA 2KFTA 5CPEA 4BJXA 2YYNA 2B0OE 2PUYA 2RS9B 3GG3A 2VJEA 2YSJA 5E9VA 3HMFA 4I7BA 5DKHA 5G0FA 5CS8A 3O34A 2R0VA 5LJ1A 3S91A 3N9NA 5FG4A 4MSXA 4NYWA 4ZC9A 5BT4A 5HQ6A 5A5PA 5FE6A 5A81A 2L7PA 3ZTGA 5EK9A 4R8PK 2E6SA 4CA1A 1LDJB 3FKMX 3JVLA 5AMEA 4QNSA 4TTEA 2DVVA 5EPRA 3IU5A 5CZGA 5I1QA 4GPJA 4FO9A 2E7OA 5D25A 5DW2A 5BT3A 2WP1A 5D0CA 5D3SA 1WILA 4O64A 2FSAA 5D3JA 4A0CD 5ENFA 5ENCA 5E9MA 4O7CA 4CURA 5C85A 3MHHA 2CKLA 5I88A 3Q2FA 5G4RA 3UV4A 5D1KB 5HLSA 4CUSA 1HYJA 5A5RA 2D9EA 2RNWA 5C89A 3VKHA 2H0DB 4HXPA 5L96A 2YUCA 5B75A 5TBNA 4WIVA 5I86A 2LDRA 3RCWA 2KTBB 5KU3A 1JM4B 2KWOA 2P57A 4MR5A 4Q6FA 4AKNA 5L98A 4PTBA 2L43A 4QEUA 3GV4A 5HENA 5HCLA 3ZVYA 4NRCA 4J1PA 5E9IA 5DX4A 5DFBA 5JG6A 2MIQA 1Z60A 4A9MA 5EU1A 4QQ4A 4O7BA 4YY6A 1LDKC 5FB0A 3M7KA 4OGJA 2QJ0A 2YVRA 3HCTA 5CUGA 5FE3A 5SVYA 4N3WA 2HYED 3PLWA 5EPBA 5LKUA 2M85A 5FE9A 3UW9A 3LVQE 4Z1SA 3N9OA 4LR6A 5CRZA 4AKHA 3U5JA 3VKGA 2OSSA 3FANA 5I83A 5LKXA 2VJFB 2L5UA 4GNFA 2VNFA 5I40A 2L75A 3VK6A 3ZPV1 5EWHA 5DFDA 5ETBA 5DYAA 5E0RA 4QUTA 4A9OA 2M1RA 4BHWA 2DJAA 5EYAF 5FE5A 2KWJA 4ZUXU 4NR8A 4R2YA 5IGLA 2CKLB 5I29A 4AVXA 4A9HA 4NRBA 4LYIA 5F1LA 1WEEA 3O7AA 2MA5A 3FL2A 5IIDA 4YC9A 5CRMA 4PCIA 5J0DA 5F1HA 5II1A 2CRWA 1JSPB 4Z93A 2DVRA 2M6MA 3KQIA 4NS5A 3RPGC 5IBNA 5D3RA 4GNDA 2BAYA 5FFVA 2DWWA 5BT5A 1F62A 2RR4A 4ALHA 5FFWA 5DLXA 4PY6A 4HXSA 2D82A 2VPBA 2HDPA 1X4UA 3MULA 4UIVA 4N4FA 2FFWA 2MUMA 5EICA 4YYNA 3E2DA 3M62A 5DINA 5L97A 5H1VA 4B7YC 4IORA 4YBSA 1WEWA 2VPEA 5E9KA 5IGNA 4S3OC 5EM3A 4BBQA 4BW1A 5DYUA 5EA1A 5HFQA 2G4AA 3L1XA 5F63A 5CUCA 2C2VS 3QZVA 2RSDA 2YELA 4J0SA 2F6NA 2LGGA 2YW5A 4QY4A 5KTUA 4TU4A 4CUUA 2Y43A 5DKAA 4YAXA 3RPGB 5EV9A 1BORA 4GNEA 4YH3A 2RNXA 4LDFA 1DVPA 3D7CA 5SVIB 4AKIA 4UYDA 4LRGA 4A9JA 5IGMA 2D8SA 2XOYA 2YW8A 2LV9A 1MBMA 4Q0NA 1N72A 3MB4A 1X0JA 5II2A 4BW4A 3O47A 4ZQLA 2G6QA 1JOCA 5TDWA 4TKPB 2YREA 4S3OB 3T9KA 2DATA 4YYKA 4LYWA 4V3KC 4Z0OA 3T6RA 1VD4A 3HCUA 5EWDA 2LXPC 5E3GA 2YHOA 1JM7B 5FBXA 5G05B 2L5EA 5E74A 1WEQA 3M63A 2E61A 4LZRA 2QICA 5CP5A 4QSTA 4NQMA 4MR4A 5E73A 5FE2A 5G04B 4O72A 4ALGA 2FUUA 1WESA 4YBTA 5ENBA 1WEMA 5KH9A 3LQJA 3O35A 1HYIA 3MHSA 4KV4A 2R0SA 4TT4A 2KU3A 5D1LB 1X4IA 1Z6UA 4J0RA 2KREA 2MNZA 2EODA 4A4BA 4QBMA 4R7EA 5EVAA 4QEVA 4TZ8A 5CQ5A 5TCMA 4F3IA 2ECIA 3DWYA 3UV2A 3KV5A 2EGMA 3U5OA 4QSSA 2KGGA 2VPDA 1MM3A 5DY7A 4MEQA 4X3GA 5J3XA 1FP0A 2L84A 2ECVA 5EP7A 3UVXA 5CQ8A 3KDEC 4NR7A 4TYLA 5AMFA 4HXNA 5DBMA 5FE0A 2LGVA 5EWCA 5TDRA 4CUPA 3RTRB 4QSWA 2CSYA 5B79A 5D3PA 3SUBA 2ZETC 3UVYA 2VPGA 2IQJA 2XOZA 3UV5A 4UP5A 5C11A 1WEUA 2CSZA 4UIYA 3SOXA 4QYDA 2WP2A 1ZBDB 2DVQA 3HTKC 3AQAA 3LJWA 2L0BA 2MKEA 4P5OB 4AKGA 1ZS5A 3QZSA 4AYCA 4NN2A 2KGIA 2VJEB 5A82A 3MUKA 4QC1A 1MM2A 4YATA 2F42A 5I7XA 3UVWA 5D3LA 4YK0A 5A5QA 5D3NA 5EWVA 4QZSA 2KR4A 4O77A 3KNVA 3DQVR 1G25A 4QEWA 4C67A 5JI8A 4PS5A 1E4UA 4UYFA 1WEVA 4MEOA 3DWDA 4QSPA 3MXFA 5ENJA 4OUFA 2ECJA 2I50A 4CUQA 4BW2A 2YQLA 4FIPA 3ERRA 3N9LA 4OGIA 5H1UA 5K3QA 5I7YA 2CSVA 4YYIA 2GRCA 4B86C 4FJCA 2YQMA 3ZYQA 3O37A 2LSPB 3LXJA 2YSMA 4QF2A 4YY4A 5LJ0A 1Z2QA 3LQHA 5FG5A 2CRRA 4MR6A 4IOQA 5CU8A 2Y1MA 5HFRA 4CL9A 5FH7A 2E3KA 3M99A 4IR4A 3LVRE 3HCSA 5LKZA 3P1FA 5EISA 5EQ1A 4HXOA 5HM0A 2AN6A 3MDBC 5FE7A 3PUQA 2MD8C 5KTXA 2L85A 4NUDA 3LQIA 4Z1QA 4A9LA 4TU6A 2OXQC 4YYGA 3N9PA 5H1TA 2M13A 3KV6A 4BW3A 4O74A 4A9IA 4TS8A 5CUDA 4HBVA 5A85A 4RVRA 5KO4A 2L80A 1EQFA 4O70A 5C8GA 3EB5A 1E6IA 3O70A 5KHMA 2ECTA 2CONA 5E3DA 5LKTA 4XI1A 2MJVB 2JMJA 4UIXA 3FM8C 5F2PA 3DAIA 4LLBA 5FEYA 3U5LA 5I80A 2KWNA 1FBVA 2EXUA 5HRWA 3T7LA 5ENHA 3L11A 5K29A 4W4UA 4IR3A 2LRIC 4O76A 5D3HA 2DX8A 2FD4A 3ONIA 3LDYA 4HBWA 4YYDA 4AI6A 3PHDA 4IR5A 4N4IA 2RO1A 1T1HA 4N4GA 5IGKA 4O62A 1WEOA 5FE1A 3IU6A 2R0YA 2F6JA 4UYEA 5IG6A 3TLPA 1VYXA 4UIWA 4XUBA 2G45A 4HBXA 4HXMA 4O78A 4OGCA 3C5KA 4A9KA 5LJ2A 4LK9A 4CFLA 4YYJA 2K1JA 2G43A 3U5PA 2LN0A 2XEUA 4LKAA 5TABA 4X2IA 1VFYA 4Z0RA 5EPSA 5LVRA 5LCWB 3K2JA 2JM3A 5L99A 4CLBA 1U6GB 5FE4A 4UI9B 5ENIA 5FH8A 2JMDA 4NQNA 4C66A 3G0JA 3D1BA 2OO1A 2EGPA 5F25A 5C4QA 4XUAA 2K16A 4L7XA 2H0DA 4O7FA 5DLZA 5DW1A 1CHCA 3SHBA 4UP0A 4XY9A 5HJCA 5I3LA 3JUEA 2K4DA 3NG2A 5AD3A 3SVFA 2I7KA 5JWMA 5CY9A 4QB3A 4QSVA 5L8TA 2KIZA 2UZGA 4NYXA 4Z6IA 2YEKA 4HXRA 5DKDA 2YURA 4E96A 1WENA 2EA6A 3HMEA 5F36A 3PURA 3U5MA 4Z6HA 3ZVZB 5A7CA 4F52B 5TRBA 4O7EA 2DVSA 5EWWA 5CUBA 4O75A 5E9LA 5F3AA 2M3HA 2XB1A 5ETDA 4A49A 5LUUA 1WIMA 5B8DA 5D24A 5DYXA 5CQ3A 3DPLR 1WEPA 2YQDA 5KH7A 4OGEA 4QF3A 3NXBA 4J3IA 4UYGA 5KTWA 1DCQA 1X4JA 2VJFA 4LYSA 5FH6A 3SOUA 2C2LA 5TB6A 1WE9A 4XYAA 2CT2A 2D8UA 3JVKA 5B78A 2LAUA 5G4SA 4L58A 4MEPA 4WZ0A 5CFWA 4TZ2A 2NAAA 3FAOA 5AIUA 5H9MA 4O71A 4LZSA 2RI7A 2MD7B 5AITA 1PUOA 2XP0A 4QUUA 5CQ7A 4GB0A 2LQ6A 5CUAA 4H9DA 5CQTA 5D7XA 4WZ2A 5CUEA 4LADB 4NR6A 1WUMA 2VP7A 3UVDA 4HBYA 4V3LC 2YEMA 2RFJA 3U5NA 4NXJA 5A83A 5A5SA 2YU4A 4Q0OA 4QR3A 4A4CA 5HRVA 2JMIA 4PCEA 2XOCA 5HQ5A 5HELA 2MT5A 3L1ZB 4KCXA 5AD2A 5F61A 4A9EA 2KKXA 2LGLA 2DSMA 4YBMA 1N87A 4NUCA 4NR9A 5CQ6A 3FJUB 2KE1A 5I89A 3JVMA 4IOOA 2H60A 4QYLA 2ECGA 3GL6A 4LC2A 2E6RA 5E7DA 5HRXA 3EB6A 4TT2A 1K2FA 4QSXA 3ZYUA 3Q2EA 3H7HA 3O33A 5FG6A 3MB3A 3QZTA 4WHUA 4AP4A 2FUIA 3FEHA 3N9MA 5EI4A 3C6WA 5SVIA 2LXHC 4XY8A 5H85A 2OUOA 3AADA 2I8NA 5DFCA 5F60A 4UYHA 1WFKA 3Q1DA 2MA6A 4YABA 4GNGA 4QSUA 4LZ2A 4LJNA
chains in the Genus database with same CATH topology
4NRAA 5D3TA 4I7DA 4AYCB 3I3JA 4TQNA 2MNYA 4MVTA 5FE8A 4FK5A 4AUQB 5F5ZA 2K17A 4A9NA 5CGPA 2LGKA 2YT5A 3SVGA 5C13A 1JM7A 4O7AA 4CCGX 1XWHA 4PPEA 3ASLA 4WZ3B 1IYMA 5D1MB 1WUGA 4TT6A 2ECWA 5C7NA 4NYVA 4ZDTA 2KWKA 3P1DA 4UYFB 5C87A 5COIA 2R10A 4NR4A 5CTLA 5KH3A 3IHPA 5E9YA 1WGMA 2KYUA 4YYMA 3I2DA 4I7CA 2RNYA 5B77A 2Y1NA 4A9FA 2ECNA 2NXBA 4N4HA 4FLPA 5FFYA 5D26A 4YYHA 2PNXA 5F62A 2YYRA 3V43A 4MR3A 3SOWA 2YDWA 4QSQA 5LVQA 5DYCA 3P1EA 5FDZA 3ZNIA 4QC3A 5ENEA 4DONA 5HQ7A 4YH4A 3MQMA 2DKWA 2JRJA 5A5OA 5B76A 4ZW1A 5L8UA 4WA6A 3ZPVE 3O36A 4C9ZA 5A5NA 3S92A 1RMDA 4HXLA 3JVJA 4HXKA 3P5OA 3SVHA 5ENGA 4CFKA 4UIUA 4IC2A 2QIZA 4QSRA 5FERA 2N9GA 2YHNA 2IDAA 4IC3A 4YADA 5DKCA 4NUEA 4UIZA 4PKLA 4NR5A 3P1CA 4KV1A 3U5KA 4CUTA 5CQAA 4Y03A 4MENA 5EGUA 3LRQA 1V87A 1F68A 4QR4A 4IR6A 4QR5A 4UITA 5ACYA 5CQ4A 3G0LA 5FB1A 3HMHA 2E7NA 5HEMA 3N9QA 4WHWA 2KFTA 5CPEA 4BJXA 2YYNA 2PUYA 2RS9B 3GG3A 2VJEA 2YSJA 5E9VA 3HMFA 4I7BA 5DKHA 5G0FA 5CS8A 3O34A 2R0VA 5LJ1A 3S91A 3N9NA 5FG4A 4MSXA 4NYWA 4ZC9A 5BT4A 5HQ6A 5A5PA 5FE6A 5A81A 3ZTGA 5EK9A 4R8PK 2E6SA 4CA1A 1LDJB 3FKMX 3JVLA 5AMEA 4QNSA 4TTEA 2DVVA 5EPRA 3IU5A 5CZGA 5I1QA 4GPJA 4FO9A 2E7OA 5D25A 5DW2A 5BT3A 2WP1A 5D0CA 5D3SA 1WILA 4O64A 2FSAA 5D3JA 4A0CD 5ENFA 5ENCA 5E9MA 4O7CA 4CURA 5C85A 3MHHA 2CKLA 5I88A 3Q2FA 5G4RA 3UV4A 5D1KB 5HLSA 4CUSA 1HYJA 5A5RA 2D9EA 2RNWA 5C89A 5TBNA 2H0DB 4HXPA 5L96A 2YUCA 5B75A 4WIVA 5I86A 2LDRA 3RCWA 2KTBB 5KU3A 1JM4B 2KWOA 4MR5A 4Q6FA 4AKNA 5L98A 4PTBA 2L43A 4QEUA 3GV4A 5HENA 5HCLA 3ZVYA 4NRCA 4J1PA 5E9IA 5DX4A 5DFBA 5JG6A 2MIQA 1Z60A 4A9MA 5EU1A 4O7BA 4YY6A 1LDKC 5FB0A 4OGJA 2QJ0A 3HCTA 5CUGA 5FE3A 4N3WA 2HYED 5EPBA 5LKUA 2M85A 5FE9A 3UW9A 4Z1SA 3N9OA 4LR6A 5CRZA 3U5JA 2OSSA 5I83A 5LKXA 2VJFB 2L5UA 4GNFA 2VNFA 5I40A 2L75A 3VK6A 3ZPV1 5EWHA 5DFDA 5ETBA 5DYAA 5E0RA 4QUTA 4A9OA 2M1RA 4BHWA 5EYAF 5FE5A 2KWJA 4ZUXU 4NR8A 4R2YA 5IGLA 2CKLB 5I29A 4AVXA 4A9HA 4NRBA 4LYIA 5F1LA 1WEEA 3O7AA 2MA5A 3FL2A 5IIDA 4YC9A 5CRMA 4PCIA 5J0DA 5F1HA 5II1A 1JSPB 4Z93A 2DVRA 2M6MA 3KQIA 4NS5A 3RPGC 5IBNA 5D3RA 4GNDA 2BAYA 5FFVA 2DWWA 5BT5A 1F62A 4ALHA 5FFWA 5DLXA 4PY6A 4HXSA 2D82A 2VPBA 2HDPA 1X4UA 3MULA 4UIVA 4N4FA 2MUMA 3M62A 5EICA 4YYNA 5DINA 5L97A 5H1VA 4B7YC 4IORA 4YBSA 1WEWA 2VPEA 5E9KA 5IGNA 4S3OC 5EM3A 4BBQA 4BW1A 5DYUA 5EA1A 5HFQA 2G4AA 3L1XA 5F63A 5CUCA 2C2VS 3QZVA 2RSDA 2YELA 4J0SA 2F6NA 2LGGA 2YW5A 4QY4A 5KTUA 4TU4A 4CUUA 2Y43A 5DKAA 4YAXA 3RPGB 5EV9A 1BORA 4GNEA 4YH3A 2RNXA 4LDFA 1DVPA 3D7CA 2D8SA 4UYDA 4LRGA 4A9JA 5IGMA 2YW8A 2LV9A 4Q0NA 1N72A 3MB4A 1X0JA 5II2A 4BW4A 4ZQLA 2G6QA 1JOCA 5TDWA 4TKPB 2YREA 4S3OB 2DATA 4YYKA 4LYWA 4V3KC 3T6RA 1VD4A 3HCUA 5EWDA 2LXPC 5E3GA 2YHOA 1JM7B 5FBXA 5G05B 2L5EA 5E74A 1WEQA 3M63A 4LZRA 2QICA 5CP5A 4QSTA 4NQMA 4MR4A 5E73A 5FE2A 5G04B 4O72A 4ALGA 2FUUA 1WESA 4YBTA 5ENBA 1WEMA 5KH9A 3LQJA 3O35A 1HYIA 3MHSA 4KV4A 2R0SA 4TT4A 2KU3A 5D1LB 1X4IA 1Z6UA 4J0RA 2KREA 2MNZA 2EODA 4A4BA 4QBMA 4R7EA 5EVAA 4QEVA 4TZ8A 5CQ5A 5TCMA 4F3IA 2ECIA 3DWYA 3UV2A 3KV5A 3U5OA 4QSSA 2KGGA 2VPDA 1MM3A 5DY7A 4MEQA 4X3GA 5J3XA 1FP0A 2L84A 2ECVA 5EP7A 3UVXA 5CQ8A 4NR7A 4TYLA 5AMFA 4HXNA 5DBMA 5FE0A 2LGVA 5EWCA 5TDRA 4CUPA 3RTRB 4QSWA 2CSYA 5B79A 5D3PA 2ZETC 3UVYA 2VPGA 4UP5A 3UV5A 5C11A 1WEUA 2CSZA 4UIYA 3SOXA 4QYDA 2WP2A 1ZBDB 2DVQA 3HTKC 3AQAA 3LJWA 2L0BA 4P5OB 1ZS5A 3QZSA 4AYCA 4NN2A 2KGIA 2VJEB 5A82A 3MUKA 4QC1A 1MM2A 4YATA 2F42A 5I7XA 3UVWA 5D3LA 4YK0A 5A5QA 5D3NA 5EWVA 4QZSA 2KR4A 4O77A 3KNVA 3DQVR 1G25A 4QEWA 4C67A 5JI8A 4PS5A 1E4UA 4UYFA 1WEVA 4MEOA 4QSPA 3MXFA 5ENJA 4OUFA 2ECJA 2I50A 4CUQA 4BW2A 2YQLA 4FIPA 3N9LA 4OGIA 5H1UA 5I7YA 4YYIA 2GRCA 4B86C 4FJCA 2YQMA 3ZYQA 3O37A 2LSPB 3LXJA 2YSMA 4QF2A 4YY4A 5LJ0A 1Z2QA 3LQHA 5FG5A 4MR6A 4IOQA 5CU8A 2Y1MA 5HFRA 4CL9A 5FH7A 2E3KA 3M99A 4IR4A 3HCSA 5LKZA 3P1FA 5EISA 5EQ1A 4HXOA 5HM0A 2AN6A 5FE7A 3PUQA 2MD8C 5KTXA 2L85A 4NUDA 3LQIA 4Z1QA 4A9LA 4TU6A 2OXQC 4YYGA 3N9PA 5H1TA 3KV6A 4BW3A 4O74A 4A9IA 4TS8A 5CUDA 4HBVA 5A85A 4RVRA 5KO4A 2L80A 1EQFA 4O70A 5C8GA 3EB5A 1E6IA 3O70A 5KHMA 2ECTA 5E3DA 5LKTA 4XI1A 2MJVB 2JMJA 4UIXA 5F2PA 3DAIA 4LLBA 5FEYA 3U5LA 5I80A 2KWNA 1FBVA 5HRWA 3T7LA 5ENHA 3L11A 5K29A 4W4UA 4IR3A 2LRIC 4O76A 5D3HA 2DX8A 3ONIA 4HBWA 4YYDA 3PHDA 4IR5A 4N4IA 2RO1A 1T1HA 4N4GA 5IGKA 1WEOA 5FE1A 3IU6A 2R0YA 2F6JA 4UYEA 5IG6A 3TLPA 1VYXA 4UIWA 4XUBA 2G45A 4HBXA 4HXMA 4O78A 3C5KA 4A9KA 5LJ2A 4LK9A 4CFLA 4YYJA 2K1JA 2G43A 3U5PA 2LN0A 2XEUA 4LKAA 5TABA 4X2IA 1VFYA 5LCWB 5EPSA 5LVRA 3K2JA 5L99A 4CLBA 1U6GB 5FE4A 4UI9B 5ENIA 5FH8A 2JMDA 4NQNA 4C66A 3G0JA 2OO1A 2EGPA 5F25A 5C4QA 4XUAA 2K16A 4L7XA 2H0DA 4O7FA 5DLZA 5DW1A 1CHCA 3SHBA 4UP0A 4XY9A 5HJCA 5I3LA 2K4DA 3NG2A 5AD3A 3SVFA 2I7KA 5JWMA 5CY9A 4QB3A 4QSVA 5L8TA 2KIZA 2UZGA 4NYXA 4Z6IA 2YEKA 4HXRA 5DKDA 2YURA 4E96A 1WENA 2EA6A 3HMEA 5F36A 3PURA 3U5MA 4Z6HA 3ZVZB 5A7CA 4F52B 5TRBA 4O7EA 2DVSA 5EWWA 5CUBA 4O75A 5E9LA 5F3AA 2M3HA 2XB1A 5ETDA 4A49A 5LUUA 1WIMA 5B8DA 5D24A 5DYXA 5CQ3A 3DPLR 1WEPA 2YQDA 5KH7A 4QF3A 3NXBA 4J3IA 4UYGA 5KTWA 1X4JA 2VJFA 4LYSA 5FH6A 3SOUA 2C2LA 5TB6A 1WE9A 4XYAA 2CT2A 5B78A 3JVKA 5G4SA 4L58A 4MEPA 4WZ0A 5CFWA 4TZ2A 2NAAA 5AIUA 5H9MA 4O71A 4LZSA 2RI7A 2MD7B 5AITA 4QUUA 5CQ7A 4GB0A 2LQ6A 5CUAA 5CQTA 5D7XA 4WZ2A 5CUEA 4LADB 4NR6A 1WUMA 2VP7A 3UVDA 4HBYA 4V3LC 2YEMA 2RFJA 3U5NA 4NXJA 5A83A 5A5SA 2YU4A 4Q0OA 4QR3A 4A4CA 5HRVA 2JMIA 4PCEA 3L1ZB 5HQ5A 5HELA 2MT5A 4KCXA 5AD2A 5F61A 4A9EA 2LGLA 4YBMA 1N87A 4NUCA 4NR9A 5CQ6A 2KE1A 5I89A 3JVMA 4IOOA 2H60A 4QYLA 2ECGA 3GL6A 4LC2A 2E6RA 5E7DA 5HRXA 3EB6A 4TT2A 1K2FA 4QSXA 3ZYUA 3Q2EA 3O33A 5FG6A 3MB3A 3QZTA 4WHUA 4AP4A 2FUIA 3N9MA 5EI4A 3C6WA 2LXHC 4XY8A 5H85A 2OUOA 3AADA 2I8NA 5DFCA 5F60A 4UYHA 1WFKA 2MA6A 4YABA 4GNGA 4QSUA 4LZ2A 4LJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRA A;  5D3T A;  4I7D A;  4AYC B;  3I3J A;  4TQN A;  2MNY A;  4MVT A;  5FE8 A;  4FK5 A;  4AUQ B;  5F5Z A;  2K17 A;  4A9N A;  5CGP A;  2LGK A;  2YT5 A;  3SVG A;  5C13 A;  1JM7 A;  4O7A A;  4CCG X;  1XWH A;  4PPE A;  3ASL A;  4WZ3 B;  1IYM A;  5D1M B;  1WUG A;  4TT6 A;  2ECW A;  5C7N A;  4NYV A;  4ZDT A;  2KWK A;  3P1D A;  4UYF B;  5C87 A;  5COI A;  2R10 A;  4NR4 A;  5CTL A;  5KH3 A;  3IHP A;  5E9Y A;  1WGM A;  2KYU A;  4YYM A;  3I2D A;  4I7C A;  2RNY A;  5B77 A;  2Y1N A;  4A9F A;  2ECN A;  2NXB A;  4N4H A;  4FLP A;  5FFY A;  5D26 A;  4YYH A;  2PNX A;  5F62 A;  2YYR A;  3V43 A;  4MR3 A;  3SOW A;  2YDW A;  4QSQ A;  5LVQ A;  5DYC A;  3P1E A;  5FDZ A;  3ZNI A;  4QC3 A;  5ENE A;  4DON A;  5HQ7 A;  4YH4 A;  3MQM A;  2DKW A;  2JRJ A;  5A5O A;  5B76 A;  4ZW1 A;  5L8U A;  4WA6 A;  3ZPV E;  3O36 A;  4C9Z A;  5A5N A;  3S92 A;  1RMD A;  4HXL A;  3JVJ A;  4HXK A;  3P5O A;  3SVH A;  5ENG A;  4CFK A;  4UIU A;  4IC2 A;  2QIZ A;  4QSR A;  5FER A;  2N9G A;  2YHN A;  2IDA A;  4IC3 A;  4YAD A;  5DKC A;  4NUE A;  4UIZ A;  4PKL A;  4NR5 A;  3P1C A;  4KV1 A;  3U5K A;  4CUT A;  5CQA A;  4Y03 A;  4MEN A;  5EGU A;  3LRQ A;  1V87 A;  1F68 A;  4QR4 A;  4IR6 A;  4QR5 A;  4UIT A;  5ACY A;  5CQ4 A;  3G0L A;  5FB1 A;  3HMH A;  2E7N A;  5HEM A;  3N9Q A;  4WHW A;  2KFT A;  5CPE A;  4BJX A;  2YYN A;  2PUY A;  2RS9 B;  3GG3 A;  2VJE A;  2YSJ A;  5E9V A;  3HMF A;  4I7B A;  5DKH A;  5G0F A;  5CS8 A;  3O34 A;  2R0V A;  5LJ1 A;  3S91 A;  3N9N A;  5FG4 A;  4MSX A;  4NYW A;  4ZC9 A;  5BT4 A;  5HQ6 A;  5A5P A;  5FE6 A;  5A81 A;  3ZTG A;  5EK9 A;  4R8P K;  2E6S A;  4CA1 A;  1LDJ B;  3FKM X;  3JVL A;  5AME A;  4QNS A;  4TTE A;  2DVV A;  5EPR A;  3IU5 A;  5CZG A;  5I1Q A;  4GPJ A;  4FO9 A;  2E7O A;  5D25 A;  5DW2 A;  5BT3 A;  2WP1 A;  5D0C A;  5D3S A;  1WIL A;  4O64 A;  2FSA A;  5D3J A;  4A0C D;  5ENF A;  5ENC A;  5E9M A;  4O7C A;  4CUR A;  5C85 A;  3MHH A;  2CKL A;  5I88 A;  3Q2F A;  5G4R A;  3UV4 A;  5D1K B;  5HLS A;  4CUS A;  1HYJ A;  5A5R A;  2D9E A;  2RNW A;  5C89 A;  5TBN A;  2H0D B;  4HXP A;  5L96 A;  2YUC A;  5B75 A;  4WIV A;  5I86 A;  2LDR A;  3RCW A;  2KTB B;  5KU3 A;  1JM4 B;  2KWO A;  4MR5 A;  4Q6F A;  4AKN A;  5L98 A;  4PTB A;  2L43 A;  4QEU A;  3GV4 A;  5HEN A;  5HCL A;  3ZVY A;  4NRC A;  4J1P A;  5E9I A;  5DX4 A;  5DFB A;  5JG6 A;  2MIQ A;  1Z60 A;  4A9M A;  5EU1 A;  4O7B A;  4YY6 A;  1LDK C;  5FB0 A;  4OGJ A;  2QJ0 A;  3HCT A;  5CUG A;  5FE3 A;  4N3W A;  2HYE D;  5EPB A;  5LKU A;  2M85 A;  5FE9 A;  3UW9 A;  4Z1S A;  3N9O A;  4LR6 A;  5CRZ A;  3U5J A;  2OSS A;  5I83 A;  5LKX A;  2VJF B;  2L5U A;  4GNF A;  2VNF A;  5I40 A;  2L75 A;  3VK6 A;  3ZPV 1;  5EWH A;  5DFD A;  5ETB A;  5DYA A;  5E0R A;  4QUT A;  4A9O A;  2M1R A;  4BHW A;  5EYA F;  5FE5 A;  2KWJ A;  4ZUX U;  4NR8 A;  4R2Y A;  5IGL A;  2CKL B;  5I29 A;  4AVX A;  4A9H A;  4NRB A;  4LYI A;  5F1L A;  1WEE A;  3O7A A;  2MA5 A;  3FL2 A;  5IID A;  4YC9 A;  5CRM A;  4PCI A;  5J0D A;  5F1H A;  5II1 A;  1JSP B;  4Z93 A;  2DVR A;  2M6M A;  3KQI A;  4NS5 A;  3RPG C;  5IBN A;  5D3R A;  4GND A;  2BAY A;  5FFV A;  2DWW A;  5BT5 A;  1F62 A;  4ALH A;  5FFW A;  5DLX A;  4PY6 A;  4HXS A;  2D82 A;  2VPB A;  2HDP A;  1X4U A;  3MUL A;  4UIV A;  4N4F A;  2MUM A;  3M62 A;  5EIC A;  4YYN A;  5DIN A;  5L97 A;  5H1V A;  4B7Y C;  4IOR A;  4YBS A;  1WEW A;  2VPE A;  5E9K A;  5IGN A;  4S3O C;  5EM3 A;  4BBQ A;  4BW1 A;  5DYU A;  5EA1 A;  5HFQ A;  2G4A A;  3L1X A;  5F63 A;  5CUC A;  2C2V S;  3QZV A;  2RSD A;  2YEL A;  4J0S A;  2F6N A;  2LGG A;  2YW5 A;  4QY4 A;  5KTU A;  4TU4 A;  4CUU A;  2Y43 A;  5DKA A;  4YAX A;  3RPG B;  5EV9 A;  1BOR A;  4GNE A;  4YH3 A;  2RNX A;  4LDF A;  1DVP A;  3D7C A;  2D8S A;  4UYD A;  4LRG A;  4A9J A;  5IGM A;  2YW8 A;  2LV9 A;  4Q0N A;  1N72 A;  3MB4 A;  1X0J A;  5II2 A;  4BW4 A;  4ZQL A;  2G6Q A;  1JOC A;  5TDW A;  4TKP B;  2YRE A;  4S3O B;  2DAT A;  4YYK A;  4LYW A;  4V3K C;  3T6R A;  1VD4 A;  3HCU A;  5EWD A;  2LXP C;  5E3G A;  2YHO A;  1JM7 B;  5FBX A;  5G05 B;  2L5E A;  5E74 A;  1WEQ A;  3M63 A;  4LZR A;  2QIC A;  5CP5 A;  4QST A;  4NQM A;  4MR4 A;  5E73 A;  5FE2 A;  5G04 B;  4O72 A;  4ALG A;  2FUU A;  1WES A;  4YBT A;  5ENB A;  1WEM A;  5KH9 A;  3LQJ A;  3O35 A;  1HYI A;  3MHS A;  4KV4 A;  2R0S A;  4TT4 A;  2KU3 A;  5D1L B;  1X4I A;  1Z6U A;  4J0R A;  2KRE A;  2MNZ A;  2EOD A;  4A4B A;  4QBM A;  4R7E A;  5EVA A;  4QEV A;  4TZ8 A;  5CQ5 A;  5TCM A;  4F3I A;  2ECI A;  3DWY A;  3UV2 A;  3KV5 A;  3U5O A;  4QSS A;  2KGG A;  2VPD A;  1MM3 A;  5DY7 A;  4MEQ A;  4X3G A;  5J3X A;  1FP0 A;  2L84 A;  2ECV A;  5EP7 A;  3UVX A;  5CQ8 A;  4NR7 A;  4TYL A;  5AMF A;  4HXN A;  5DBM A;  5FE0 A;  2LGV A;  5EWC A;  5TDR A;  4CUP A;  3RTR B;  4QSW A;  2CSY A;  5B79 A;  5D3P A;  2ZET C;  3UVY A;  2VPG A;  4UP5 A;  3UV5 A;  5C11 A;  1WEU A;  2CSZ A;  4UIY A;  3SOX A;  4QYD A;  2WP2 A;  1ZBD B;  2DVQ A;  3HTK C;  3AQA A;  3LJW A;  2L0B A;  4P5O B;  1ZS5 A;  3QZS A;  4AYC A;  4NN2 A;  2KGI A;  2VJE B;  5A82 A;  3MUK A;  4QC1 A;  1MM2 A;  4YAT A;  2F42 A;  5I7X A;  3UVW A;  5D3L A;  4YK0 A;  5A5Q A;  5D3N A;  5EWV A;  4QZS A;  2KR4 A;  4O77 A;  3KNV A;  3DQV R;  1G25 A;  4QEW A;  4C67 A;  5JI8 A;  4PS5 A;  1E4U A;  4UYF A;  1WEV A;  4MEO A;  4QSP A;  3MXF A;  5ENJ A;  4OUF A;  2ECJ A;  2I50 A;  4CUQ A;  4BW2 A;  2YQL A;  4FIP A;  3N9L A;  4OGI A;  5H1U A;  5I7Y A;  4YYI A;  2GRC A;  4B86 C;  4FJC A;  2YQM A;  3ZYQ A;  3O37 A;  2LSP B;  3LXJ A;  2YSM A;  4QF2 A;  4YY4 A;  5LJ0 A;  1Z2Q A;  3LQH A;  5FG5 A;  4MR6 A;  4IOQ A;  5CU8 A;  2Y1M A;  5HFR A;  4CL9 A;  5FH7 A;  2E3K A;  3M99 A;  4IR4 A;  3HCS A;  5LKZ A;  3P1F A;  5EIS A;  5EQ1 A;  4HXO A;  5HM0 A;  2AN6 A;  5FE7 A;  3PUQ A;  2MD8 C;  5KTX A;  2L85 A;  4NUD A;  3LQI A;  4Z1Q A;  4A9L A;  4TU6 A;  2OXQ C;  4YYG A;  3N9P A;  5H1T A;  3KV6 A;  4BW3 A;  4O74 A;  4A9I A;  4TS8 A;  5CUD A;  4HBV A;  5A85 A;  4RVR A;  5KO4 A;  2L80 A;  1EQF A;  4O70 A;  5C8G A;  3EB5 A;  1E6I A;  3O70 A;  5KHM A;  2ECT A;  5E3D A;  5LKT A;  4XI1 A;  2MJV B;  2JMJ A;  4UIX A;  5F2P A;  3DAI A;  4LLB A;  5FEY A;  3U5L A;  5I80 A;  2KWN A;  1FBV A;  5HRW A;  3T7L A;  5ENH A;  3L11 A;  5K29 A;  4W4U A;  4IR3 A;  2LRI C;  4O76 A;  5D3H A;  2DX8 A;  3ONI A;  4HBW A;  4YYD A;  3PHD A;  4IR5 A;  4N4I A;  2RO1 A;  1T1H A;  4N4G A;  5IGK A;  1WEO A;  5FE1 A;  3IU6 A;  2R0Y A;  2F6J A;  4UYE A;  5IG6 A;  3TLP A;  1VYX A;  4UIW A;  4XUB A;  2G45 A;  4HBX A;  4HXM A;  4O78 A;  3C5K A;  4A9K A;  5LJ2 A;  4LK9 A;  4CFL A;  4YYJ A;  2K1J A;  2G43 A;  3U5P A;  2LN0 A;  2XEU A;  4LKA A;  5TAB A;  4X2I A;  1VFY A;  5LCW B;  5EPS A;  5LVR A;  3K2J A;  5L99 A;  4CLB A;  1U6G B;  5FE4 A;  4UI9 B;  5ENI A;  5FH8 A;  2JMD A;  4NQN A;  4C66 A;  3G0J A;  2OO1 A;  2EGP A;  5F25 A;  5C4Q A;  4XUA A;  2K16 A;  4L7X A;  2H0D A;  4O7F A;  5DLZ A;  5DW1 A;  1CHC A;  3SHB A;  4UP0 A;  4XY9 A;  5HJC A;  5I3L A;  2K4D A;  3NG2 A;  5AD3 A;  3SVF A;  2I7K A;  5JWM A;  5CY9 A;  4QB3 A;  4QSV A;  5L8T A;  2KIZ A;  2UZG A;  4NYX A;  4Z6I A;  2YEK A;  4HXR A;  5DKD A;  2YUR A;  4E96 A;  1WEN A;  2EA6 A;  3HME A;  5F36 A;  3PUR A;  3U5M A;  4Z6H A;  3ZVZ B;  5A7C A;  4F52 B;  5TRB A;  4O7E A;  2DVS A;  5EWW A;  5CUB A;  4O75 A;  5E9L A;  5F3A A;  2M3H A;  2XB1 A;  5ETD A;  4A49 A;  5LUU A;  1WIM A;  5B8D A;  5D24 A;  5DYX A;  5CQ3 A;  3DPL R;  1WEP A;  2YQD A;  5KH7 A;  4QF3 A;  3NXB A;  4J3I A;  4UYG A;  5KTW A;  1X4J A;  2VJF A;  4LYS A;  5FH6 A;  3SOU A;  2C2L A;  5TB6 A;  1WE9 A;  4XYA A;  2CT2 A;  5B78 A;  3JVK A;  5G4S A;  4L58 A;  4MEP A;  4WZ0 A;  5CFW A;  4TZ2 A;  2NAA A;  5AIU A;  5H9M A;  4O71 A;  4LZS A;  2RI7 A;  2MD7 B;  5AIT A;  4QUU A;  5CQ7 A;  4GB0 A;  2LQ6 A;  5CUA A;  5CQT A;  5D7X A;  4WZ2 A;  5CUE A;  4LAD B;  4NR6 A;  1WUM A;  2VP7 A;  3UVD A;  4HBY A;  4V3L C;  2YEM A;  2RFJ A;  3U5N A;  4NXJ A;  5A83 A;  5A5S A;  2YU4 A;  4Q0O A;  4QR3 A;  4A4C A;  5HRV A;  2JMI A;  4PCE A;  3L1Z B;  5HQ5 A;  5HEL A;  2MT5 A;  4KCX A;  5AD2 A;  5F61 A;  4A9E A;  2LGL A;  4YBM A;  1N87 A;  4NUC A;  4NR9 A;  5CQ6 A;  2KE1 A;  5I89 A;  3JVM A;  4IOO A;  2H60 A;  4QYL A;  2ECG A;  3GL6 A;  4LC2 A;  2E6R A;  5E7D A;  5HRX A;  3EB6 A;  4TT2 A;  1K2F A;  4QSX A;  3ZYU A;  3Q2E A;  3O33 A;  5FG6 A;  3MB3 A;  3QZT A;  4WHU A;  4AP4 A;  2FUI A;  3N9M A;  5EI4 A;  3C6W A;  2LXH C;  4XY8 A;  5H85 A;  2OUO A;  3AAD A;  2I8N A;  5DFC A;  5F60 A;  4UYH A;  1WFK A;  2MA6 A;  4YAB A;  4GNG A;  4QSU A;  4LZ2 A;  4LJN A; 
#chains in the Genus database with same CATH topology
 4NRA A;  5D3T A;  4I7D A;  4AYC B;  3I3J A;  4TQN A;  2MNY A;  4MVT A;  5FE8 A;  4FK5 A;  4AUQ B;  5F5Z A;  2K17 A;  4A9N A;  5CGP A;  2LGK A;  2YT5 A;  3SVG A;  5C13 A;  1JM7 A;  4O7A A;  4CCG X;  3D1D A;  1XWH A;  4PPE A;  3ASL A;  4WZ3 B;  1IYM A;  5D1M B;  1WUG A;  4TT6 A;  2ECW A;  5C7N A;  4NYV A;  4ZDT A;  2KWK A;  2JUN A;  3P1D A;  4UYF B;  5C87 A;  5COI A;  2R10 A;  4NR4 A;  5CTL A;  5KH3 A;  3IHP A;  5E9Y A;  1WGM A;  2KYU A;  4YYM A;  3I2D A;  4I7C A;  2RNY A;  5B77 A;  2Y1N A;  4A9F A;  2ECN A;  2NXB A;  4N4H A;  4FLP A;  5FFY A;  5D26 A;  4YYH A;  2PNX A;  5F62 A;  2YYR A;  5SVX A;  4MR3 A;  3DDT A;  3SOW A;  3V43 A;  2YDW A;  4QSQ A;  5LVQ A;  5DYC A;  3P1E A;  5FDZ A;  3ZNI A;  4QC3 A;  5ENE A;  4DON A;  5HQ7 A;  4YH4 A;  3MQM A;  2DKW A;  2JRJ A;  5A5O A;  5B76 A;  4ZW1 A;  5L8U A;  4WA6 A;  3ZPV E;  3O36 A;  4C9Z A;  5A5N A;  3S92 A;  1RMD A;  4HXL A;  3JVJ A;  4HXK A;  3P5O A;  3SVH A;  5ENG A;  2EJN A;  4UIU A;  4CFK A;  2QIZ A;  4QSR A;  4IC2 A;  2N9G A;  2YHN A;  2IDA A;  2KKY A;  4F1P A;  5FER A;  4IC3 A;  4YAD A;  5DKC A;  4NUE A;  1ZKR A;  4UIZ A;  4PKL A;  4NR5 A;  3P1C A;  4KV1 A;  3U5K A;  4CUT A;  5CQA A;  4Y03 A;  4MEN A;  5EGU A;  2OWA A;  1V87 A;  1F68 A;  4QR4 A;  3LRQ A;  3LJU X;  4IR6 A;  4QR5 A;  4UIT A;  5ACY A;  5CQ4 A;  3G0L A;  5FB1 A;  3HMH A;  2E7N A;  5HEM A;  3N9Q A;  4WHW A;  2KFT A;  5CPE A;  4BJX A;  2YYN A;  2B0O E;  2PUY A;  2RS9 B;  3GG3 A;  2VJE A;  2YSJ A;  5E9V A;  3HMF A;  4I7B A;  5DKH A;  5G0F A;  5CS8 A;  3O34 A;  2R0V A;  5LJ1 A;  3S91 A;  3N9N A;  5FG4 A;  4MSX A;  4NYW A;  4ZC9 A;  5BT4 A;  5HQ6 A;  5A5P A;  5FE6 A;  5A81 A;  2L7P A;  3ZTG A;  5EK9 A;  4R8P K;  2E6S A;  4CA1 A;  1LDJ B;  3FKM X;  3JVL A;  5AME A;  4QNS A;  4TTE A;  2DVV A;  5EPR A;  3IU5 A;  5CZG A;  5I1Q A;  4GPJ A;  4FO9 A;  2E7O A;  5D25 A;  5DW2 A;  5BT3 A;  2WP1 A;  5D0C A;  5D3S A;  1WIL A;  4O64 A;  2FSA A;  5D3J A;  4A0C D;  5ENF A;  5ENC A;  5E9M A;  4O7C A;  4CUR A;  5C85 A;  3MHH A;  2CKL A;  5I88 A;  3Q2F A;  5G4R A;  3UV4 A;  5D1K B;  5HLS A;  4CUS A;  1HYJ A;  5A5R A;  2D9E A;  2RNW A;  5C89 A;  3VKH A;  2H0D B;  4HXP A;  5L96 A;  2YUC A;  5B75 A;  5TBN A;  4WIV A;  5I86 A;  2LDR A;  3RCW A;  2KTB B;  5KU3 A;  1JM4 B;  2KWO A;  2P57 A;  4MR5 A;  4Q6F A;  4AKN A;  5L98 A;  4PTB A;  2L43 A;  4QEU A;  3GV4 A;  5HEN A;  5HCL A;  3ZVY A;  4NRC A;  4J1P A;  5E9I A;  5DX4 A;  5DFB A;  5JG6 A;  2MIQ A;  1Z60 A;  4A9M A;  5EU1 A;  4QQ4 A;  4O7B A;  4YY6 A;  1LDK C;  5FB0 A;  3M7K A;  4OGJ A;  2QJ0 A;  2YVR A;  3HCT A;  5CUG A;  5FE3 A;  5SVY A;  4N3W A;  2HYE D;  3PLW A;  5EPB A;  5LKU A;  2M85 A;  5FE9 A;  3UW9 A;  3LVQ E;  4Z1S A;  3N9O A;  4LR6 A;  5CRZ A;  4AKH A;  3U5J A;  3VKG A;  2OSS A;  3FAN A;  5I83 A;  5LKX A;  2VJF B;  2L5U A;  4GNF A;  2VNF A;  5I40 A;  2L75 A;  3VK6 A;  3ZPV 1;  5EWH A;  5DFD A;  5ETB A;  5DYA A;  5E0R A;  4QUT A;  4A9O A;  2M1R A;  4BHW A;  2DJA A;  5EYA F;  5FE5 A;  2KWJ A;  4ZUX U;  4NR8 A;  4R2Y A;  5IGL A;  2CKL B;  5I29 A;  4AVX A;  4A9H A;  4NRB A;  4LYI A;  5F1L A;  1WEE A;  3O7A A;  2MA5 A;  3FL2 A;  5IID A;  4YC9 A;  5CRM A;  4PCI A;  5J0D A;  5F1H A;  5II1 A;  2CRW A;  1JSP B;  4Z93 A;  2DVR A;  2M6M A;  3KQI A;  4NS5 A;  3RPG C;  5IBN A;  5D3R A;  4GND A;  2BAY A;  5FFV A;  2DWW A;  5BT5 A;  1F62 A;  2RR4 A;  4ALH A;  5FFW A;  5DLX A;  4PY6 A;  4HXS A;  2D82 A;  2VPB A;  2HDP A;  1X4U A;  3MUL A;  4UIV A;  4N4F A;  2FFW A;  2MUM A;  5EIC A;  4YYN A;  3E2D A;  3M62 A;  5DIN A;  5L97 A;  5H1V A;  4B7Y C;  4IOR A;  4YBS A;  1WEW A;  2VPE A;  5E9K A;  5IGN A;  4S3O C;  5EM3 A;  4BBQ A;  4BW1 A;  5DYU A;  5EA1 A;  5HFQ A;  2G4A A;  3L1X A;  5F63 A;  5CUC A;  2C2V S;  3QZV A;  2RSD A;  2YEL A;  4J0S A;  2F6N A;  2LGG A;  2YW5 A;  4QY4 A;  5KTU A;  4TU4 A;  4CUU A;  2Y43 A;  5DKA A;  4YAX A;  3RPG B;  5EV9 A;  1BOR A;  4GNE A;  4YH3 A;  2RNX A;  4LDF A;  1DVP A;  3D7C A;  5SVI B;  4AKI A;  4UYD A;  4LRG A;  4A9J A;  5IGM A;  2D8S A;  2XOY A;  2YW8 A;  2LV9 A;  1MBM A;  4Q0N A;  1N72 A;  3MB4 A;  1X0J A;  5II2 A;  4BW4 A;  3O47 A;  4ZQL A;  2G6Q A;  1JOC A;  5TDW A;  4TKP B;  2YRE A;  4S3O B;  3T9K A;  2DAT A;  4YYK A;  4LYW A;  4V3K C;  4Z0O A;  3T6R A;  1VD4 A;  3HCU A;  5EWD A;  2LXP C;  5E3G A;  2YHO A;  1JM7 B;  5FBX A;  5G05 B;  2L5E A;  5E74 A;  1WEQ A;  3M63 A;  2E61 A;  4LZR A;  2QIC A;  5CP5 A;  4QST A;  4NQM A;  4MR4 A;  5E73 A;  5FE2 A;  5G04 B;  4O72 A;  4ALG A;  2FUU A;  1WES A;  4YBT A;  5ENB A;  1WEM A;  5KH9 A;  3LQJ A;  3O35 A;  1HYI A;  3MHS A;  4KV4 A;  2R0S A;  4TT4 A;  2KU3 A;  5D1L B;  1X4I A;  1Z6U A;  4J0R A;  2KRE A;  2MNZ A;  2EOD A;  4A4B A;  4QBM A;  4R7E A;  5EVA A;  4QEV A;  4TZ8 A;  5CQ5 A;  5TCM A;  4F3I A;  2ECI A;  3DWY A;  3UV2 A;  3KV5 A;  2EGM A;  3U5O A;  4QSS A;  2KGG A;  2VPD A;  1MM3 A;  5DY7 A;  4MEQ A;  4X3G A;  5J3X A;  1FP0 A;  2L84 A;  2ECV A;  5EP7 A;  3UVX A;  5CQ8 A;  3KDE C;  4NR7 A;  4TYL A;  5AMF A;  4HXN A;  5DBM A;  5FE0 A;  2LGV A;  5EWC A;  5TDR A;  4CUP A;  3RTR B;  4QSW A;  2CSY A;  5B79 A;  5D3P A;  3SUB A;  2ZET C;  3UVY A;  2VPG A;  2IQJ A;  2XOZ A;  3UV5 A;  4UP5 A;  5C11 A;  1WEU A;  2CSZ A;  4UIY A;  3SOX A;  4QYD A;  2WP2 A;  1ZBD B;  2DVQ A;  3HTK C;  3AQA A;  3LJW A;  2L0B A;  2MKE A;  4P5O B;  4AKG A;  1ZS5 A;  3QZS A;  4AYC A;  4NN2 A;  2KGI A;  2VJE B;  5A82 A;  3MUK A;  4QC1 A;  1MM2 A;  4YAT A;  2F42 A;  5I7X A;  3UVW A;  5D3L A;  4YK0 A;  5A5Q A;  5D3N A;  5EWV A;  4QZS A;  2KR4 A;  4O77 A;  3KNV A;  3DQV R;  1G25 A;  4QEW A;  4C67 A;  5JI8 A;  4PS5 A;  1E4U A;  4UYF A;  1WEV A;  4MEO A;  3DWD A;  4QSP A;  3MXF A;  5ENJ A;  4OUF A;  2ECJ A;  2I50 A;  4CUQ A;  4BW2 A;  2YQL A;  4FIP A;  3ERR A;  3N9L A;  4OGI A;  5H1U A;  5K3Q A;  5I7Y A;  2CSV A;  4YYI A;  2GRC A;  4B86 C;  4FJC A;  2YQM A;  3ZYQ A;  3O37 A;  2LSP B;  3LXJ A;  2YSM A;  4QF2 A;  4YY4 A;  5LJ0 A;  1Z2Q A;  3LQH A;  5FG5 A;  2CRR A;  4MR6 A;  4IOQ A;  5CU8 A;  2Y1M A;  5HFR A;  4CL9 A;  5FH7 A;  2E3K A;  3M99 A;  4IR4 A;  3LVR E;  3HCS A;  5LKZ A;  3P1F A;  5EIS A;  5EQ1 A;  4HXO A;  5HM0 A;  2AN6 A;  3MDB C;  5FE7 A;  3PUQ A;  2MD8 C;  5KTX A;  2L85 A;  4NUD A;  3LQI A;  4Z1Q A;  4A9L A;  4TU6 A;  2OXQ C;  4YYG A;  3N9P A;  5H1T A;  2M13 A;  3KV6 A;  4BW3 A;  4O74 A;  4A9I A;  4TS8 A;  5CUD A;  4HBV A;  5A85 A;  4RVR A;  5KO4 A;  2L80 A;  1EQF A;  4O70 A;  5C8G A;  3EB5 A;  1E6I A;  3O70 A;  5KHM A;  2ECT A;  2CON A;  5E3D A;  5LKT A;  4XI1 A;  2MJV B;  2JMJ A;  4UIX A;  3FM8 C;  5F2P A;  3DAI A;  4LLB A;  5FEY A;  3U5L A;  5I80 A;  2KWN A;  1FBV A;  2EXU A;  5HRW A;  3T7L A;  5ENH A;  3L11 A;  5K29 A;  4W4U A;  4IR3 A;  2LRI C;  4O76 A;  5D3H A;  2DX8 A;  2FD4 A;  3ONI A;  3LDY A;  4HBW A;  4YYD A;  4AI6 A;  3PHD A;  4IR5 A;  4N4I A;  2RO1 A;  1T1H A;  4N4G A;  5IGK A;  4O62 A;  1WEO A;  5FE1 A;  3IU6 A;  2R0Y A;  2F6J A;  4UYE A;  5IG6 A;  3TLP A;  1VYX A;  4UIW A;  4XUB A;  2G45 A;  4HBX A;  4HXM A;  4O78 A;  4OGC A;  3C5K A;  4A9K A;  5LJ2 A;  4LK9 A;  4CFL A;  4YYJ A;  2K1J A;  2G43 A;  3U5P A;  2LN0 A;  2XEU A;  4LKA A;  5TAB A;  4X2I A;  1VFY A;  4Z0R A;  5EPS A;  5LVR A;  5LCW B;  3K2J A;  2JM3 A;  5L99 A;  4CLB A;  1U6G B;  5FE4 A;  4UI9 B;  5ENI A;  5FH8 A;  2JMD A;  4NQN A;  4C66 A;  3G0J A;  3D1B A;  2OO1 A;  2EGP A;  5F25 A;  5C4Q A;  4XUA A;  2K16 A;  4L7X A;  2H0D A;  4O7F A;  5DLZ A;  5DW1 A;  1CHC A;  3SHB A;  4UP0 A;  4XY9 A;  5HJC A;  5I3L A;  3JUE A;  2K4D A;  3NG2 A;  5AD3 A;  3SVF A;  2I7K A;  5JWM A;  5CY9 A;  4QB3 A;  4QSV A;  5L8T A;  2KIZ A;  2UZG A;  4NYX A;  4Z6I A;  2YEK A;  4HXR A;  5DKD A;  2YUR A;  4E96 A;  1WEN A;  2EA6 A;  3HME A;  5F36 A;  3PUR A;  3U5M A;  4Z6H A;  3ZVZ B;  5A7C A;  4F52 B;  5TRB A;  4O7E A;  2DVS A;  5EWW A;  5CUB A;  4O75 A;  5E9L A;  5F3A A;  2M3H A;  2XB1 A;  5ETD A;  4A49 A;  5LUU A;  1WIM A;  5B8D A;  5D24 A;  5DYX A;  5CQ3 A;  3DPL R;  1WEP A;  2YQD A;  5KH7 A;  4OGE A;  4QF3 A;  3NXB A;  4J3I A;  4UYG A;  5KTW A;  1DCQ A;  1X4J A;  2VJF A;  4LYS A;  5FH6 A;  3SOU A;  2C2L A;  5TB6 A;  1WE9 A;  4XYA A;  2CT2 A;  2D8U A;  3JVK A;  5B78 A;  2LAU A;  5G4S A;  4L58 A;  4MEP A;  4WZ0 A;  5CFW A;  4TZ2 A;  2NAA A;  3FAO A;  5AIU A;  5H9M A;  4O71 A;  4LZS A;  2RI7 A;  2MD7 B;  5AIT A;  1PUO A;  2XP0 A;  4QUU A;  5CQ7 A;  4GB0 A;  2LQ6 A;  5CUA A;  4H9D A;  5CQT A;  5D7X A;  4WZ2 A;  5CUE A;  4LAD B;  4NR6 A;  1WUM A;  2VP7 A;  3UVD A;  4HBY A;  4V3L C;  2YEM A;  2RFJ A;  3U5N A;  4NXJ A;  5A83 A;  5A5S A;  2YU4 A;  4Q0O A;  4QR3 A;  4A4C A;  5HRV A;  2JMI A;  4PCE A;  2XOC A;  5HQ5 A;  5HEL A;  2MT5 A;  3L1Z B;  4KCX A;  5AD2 A;  5F61 A;  4A9E A;  2KKX A;  2LGL A;  2DSM A;  4YBM A;  1N87 A;  4NUC A;  4NR9 A;  5CQ6 A;  3FJU B;  2KE1 A;  5I89 A;  3JVM A;  4IOO A;  2H60 A;  4QYL A;  2ECG A;  3GL6 A;  4LC2 A;  2E6R A;  5E7D A;  5HRX A;  3EB6 A;  4TT2 A;  1K2F A;  4QSX A;  3ZYU A;  3Q2E A;  3H7H A;  3O33 A;  5FG6 A;  3MB3 A;  3QZT A;  4WHU A;  4AP4 A;  2FUI A;  3FEH A;  3N9M A;  5EI4 A;  3C6W A;  5SVI A;  2LXH C;  4XY8 A;  5H85 A;  2OUO A;  3AAD A;  2I8N A;  5DFC A;  5F60 A;  4UYH A;  1WFK A;  3Q1D A;  2MA6 A;  4YAB A;  4GNG A;  4QSU A;  4LZ2 A;  4LJN A; 
#chains in the Genus database with same CATH homology
 4NRA A;  5D3T A;  4I7D A;  4AYC B;  3I3J A;  4TQN A;  2MNY A;  4MVT A;  5FE8 A;  4FK5 A;  4AUQ B;  5F5Z A;  2K17 A;  4A9N A;  5CGP A;  2LGK A;  2YT5 A;  3SVG A;  5C13 A;  1JM7 A;  4O7A A;  4CCG X;  1XWH A;  4PPE A;  3ASL A;  4WZ3 B;  1IYM A;  5D1M B;  1WUG A;  4TT6 A;  2ECW A;  5C7N A;  4NYV A;  4ZDT A;  2KWK A;  3P1D A;  4UYF B;  5C87 A;  5COI A;  2R10 A;  4NR4 A;  5CTL A;  5KH3 A;  3IHP A;  5E9Y A;  1WGM A;  2KYU A;  4YYM A;  3I2D A;  4I7C A;  2RNY A;  5B77 A;  2Y1N A;  4A9F A;  2ECN A;  2NXB A;  4N4H A;  4FLP A;  5FFY A;  5D26 A;  4YYH A;  2PNX A;  5F62 A;  2YYR A;  3V43 A;  4MR3 A;  3SOW A;  2YDW A;  4QSQ A;  5LVQ A;  5DYC A;  3P1E A;  5FDZ A;  3ZNI A;  4QC3 A;  5ENE A;  4DON A;  5HQ7 A;  4YH4 A;  3MQM A;  2DKW A;  2JRJ A;  5A5O A;  5B76 A;  4ZW1 A;  5L8U A;  4WA6 A;  3ZPV E;  3O36 A;  4C9Z A;  5A5N A;  3S92 A;  1RMD A;  4HXL A;  3JVJ A;  4HXK A;  3P5O A;  3SVH A;  5ENG A;  4CFK A;  4UIU A;  4IC2 A;  2QIZ A;  4QSR A;  5FER A;  2N9G A;  2YHN A;  2IDA A;  4IC3 A;  4YAD A;  5DKC A;  4NUE A;  4UIZ A;  4PKL A;  4NR5 A;  3P1C A;  4KV1 A;  3U5K A;  4CUT A;  5CQA A;  4Y03 A;  4MEN A;  5EGU A;  3LRQ A;  1V87 A;  1F68 A;  4QR4 A;  4IR6 A;  4QR5 A;  4UIT A;  5ACY A;  5CQ4 A;  3G0L A;  5FB1 A;  3HMH A;  2E7N A;  5HEM A;  3N9Q A;  4WHW A;  2KFT A;  5CPE A;  4BJX A;  2YYN A;  2PUY A;  2RS9 B;  3GG3 A;  2VJE A;  2YSJ A;  5E9V A;  3HMF A;  4I7B A;  5DKH A;  5G0F A;  5CS8 A;  3O34 A;  2R0V A;  5LJ1 A;  3S91 A;  3N9N A;  5FG4 A;  4MSX A;  4NYW A;  4ZC9 A;  5BT4 A;  5HQ6 A;  5A5P A;  5FE6 A;  5A81 A;  3ZTG A;  5EK9 A;  4R8P K;  2E6S A;  4CA1 A;  1LDJ B;  3FKM X;  3JVL A;  5AME A;  4QNS A;  4TTE A;  2DVV A;  5EPR A;  3IU5 A;  5CZG A;  5I1Q A;  4GPJ A;  4FO9 A;  2E7O A;  5D25 A;  5DW2 A;  5BT3 A;  2WP1 A;  5D0C A;  5D3S A;  1WIL A;  4O64 A;  2FSA A;  5D3J A;  4A0C D;  5ENF A;  5ENC A;  5E9M A;  4O7C A;  4CUR A;  5C85 A;  3MHH A;  2CKL A;  5I88 A;  3Q2F A;  5G4R A;  3UV4 A;  5D1K B;  5HLS A;  4CUS A;  1HYJ A;  5A5R A;  2D9E A;  2RNW A;  5C89 A;  5TBN A;  2H0D B;  4HXP A;  5L96 A;  2YUC A;  5B75 A;  4WIV A;  5I86 A;  2LDR A;  3RCW A;  2KTB B;  5KU3 A;  1JM4 B;  2KWO A;  4MR5 A;  4Q6F A;  4AKN A;  5L98 A;  4PTB A;  2L43 A;  4QEU A;  3GV4 A;  5HEN A;  5HCL A;  3ZVY A;  4NRC A;  4J1P A;  5E9I A;  5DX4 A;  5DFB A;  5JG6 A;  2MIQ A;  1Z60 A;  4A9M A;  5EU1 A;  4O7B A;  4YY6 A;  1LDK C;  5FB0 A;  4OGJ A;  2QJ0 A;  3HCT A;  5CUG A;  5FE3 A;  4N3W A;  2HYE D;  5EPB A;  5LKU A;  2M85 A;  5FE9 A;  3UW9 A;  4Z1S A;  3N9O A;  4LR6 A;  5CRZ A;  3U5J A;  2OSS A;  5I83 A;  5LKX A;  2VJF B;  2L5U A;  4GNF A;  2VNF A;  5I40 A;  2L75 A;  3VK6 A;  3ZPV 1;  5EWH A;  5DFD A;  5ETB A;  5DYA A;  5E0R A;  4QUT A;  4A9O A;  2M1R A;  4BHW A;  5EYA F;  5FE5 A;  2KWJ A;  4ZUX U;  4NR8 A;  4R2Y A;  5IGL A;  2CKL B;  5I29 A;  4AVX A;  4A9H A;  4NRB A;  4LYI A;  5F1L A;  1WEE A;  3O7A A;  2MA5 A;  3FL2 A;  5IID A;  4YC9 A;  5CRM A;  4PCI A;  5J0D A;  5F1H A;  5II1 A;  1JSP B;  4Z93 A;  2DVR A;  2M6M A;  3KQI A;  4NS5 A;  3RPG C;  5IBN A;  5D3R A;  4GND A;  2BAY A;  5FFV A;  2DWW A;  5BT5 A;  1F62 A;  4ALH A;  5FFW A;  5DLX A;  4PY6 A;  4HXS A;  2D82 A;  2VPB A;  2HDP A;  1X4U A;  3MUL A;  4UIV A;  4N4F A;  2MUM A;  3M62 A;  5EIC A;  4YYN A;  5DIN A;  5L97 A;  5H1V A;  4B7Y C;  4IOR A;  4YBS A;  1WEW A;  2VPE A;  5E9K A;  5IGN A;  4S3O C;  5EM3 A;  4BBQ A;  4BW1 A;  5DYU A;  5EA1 A;  5HFQ A;  2G4A A;  3L1X A;  5F63 A;  5CUC A;  2C2V S;  3QZV A;  2RSD A;  2YEL A;  4J0S A;  2F6N A;  2LGG A;  2YW5 A;  4QY4 A;  5KTU A;  4TU4 A;  4CUU A;  2Y43 A;  5DKA A;  4YAX A;  3RPG B;  5EV9 A;  1BOR A;  4GNE A;  4YH3 A;  2RNX A;  4LDF A;  1DVP A;  3D7C A;  2D8S A;  4UYD A;  4LRG A;  4A9J A;  5IGM A;  2YW8 A;  2LV9 A;  4Q0N A;  1N72 A;  3MB4 A;  1X0J A;  5II2 A;  4BW4 A;  4ZQL A;  2G6Q A;  1JOC A;  5TDW A;  4TKP B;  2YRE A;  4S3O B;  2DAT A;  4YYK A;  4LYW A;  4V3K C;  3T6R A;  1VD4 A;  3HCU A;  5EWD A;  2LXP C;  5E3G A;  2YHO A;  1JM7 B;  5FBX A;  5G05 B;  2L5E A;  5E74 A;  1WEQ A;  3M63 A;  4LZR A;  2QIC A;  5CP5 A;  4QST A;  4NQM A;  4MR4 A;  5E73 A;  5FE2 A;  5G04 B;  4O72 A;  4ALG A;  2FUU A;  1WES A;  4YBT A;  5ENB A;  1WEM A;  5KH9 A;  3LQJ A;  3O35 A;  1HYI A;  3MHS A;  4KV4 A;  2R0S A;  4TT4 A;  2KU3 A;  5D1L B;  1X4I A;  1Z6U A;  4J0R A;  2KRE A;  2MNZ A;  2EOD A;  4A4B A;  4QBM A;  4R7E A;  5EVA A;  4QEV A;  4TZ8 A;  5CQ5 A;  5TCM A;  4F3I A;  2ECI A;  3DWY A;  3UV2 A;  3KV5 A;  3U5O A;  4QSS A;  2KGG A;  2VPD A;  1MM3 A;  5DY7 A;  4MEQ A;  4X3G A;  5J3X A;  1FP0 A;  2L84 A;  2ECV A;  5EP7 A;  3UVX A;  5CQ8 A;  4NR7 A;  4TYL A;  5AMF A;  4HXN A;  5DBM A;  5FE0 A;  2LGV A;  5EWC A;  5TDR A;  4CUP A;  3RTR B;  4QSW A;  2CSY A;  5B79 A;  5D3P A;  2ZET C;  3UVY A;  2VPG A;  4UP5 A;  3UV5 A;  5C11 A;  1WEU A;  2CSZ A;  4UIY A;  3SOX A;  4QYD A;  2WP2 A;  1ZBD B;  2DVQ A;  3HTK C;  3AQA A;  3LJW A;  2L0B A;  4P5O B;  1ZS5 A;  3QZS A;  4AYC A;  4NN2 A;  2KGI A;  2VJE B;  5A82 A;  3MUK A;  4QC1 A;  1MM2 A;  4YAT A;  2F42 A;  5I7X A;  3UVW A;  5D3L A;  4YK0 A;  5A5Q A;  5D3N A;  5EWV A;  4QZS A;  2KR4 A;  4O77 A;  3KNV A;  3DQV R;  1G25 A;  4QEW A;  4C67 A;  5JI8 A;  4PS5 A;  1E4U A;  4UYF A;  1WEV A;  4MEO A;  4QSP A;  3MXF A;  5ENJ A;  4OUF A;  2ECJ A;  2I50 A;  4CUQ A;  4BW2 A;  2YQL A;  4FIP A;  3N9L A;  4OGI A;  5H1U A;  5I7Y A;  4YYI A;  2GRC A;  4B86 C;  4FJC A;  2YQM A;  3ZYQ A;  3O37 A;  2LSP B;  3LXJ A;  2YSM A;  4QF2 A;  4YY4 A;  5LJ0 A;  1Z2Q A;  3LQH A;  5FG5 A;  4MR6 A;  4IOQ A;  5CU8 A;  2Y1M A;  5HFR A;  4CL9 A;  5FH7 A;  2E3K A;  3M99 A;  4IR4 A;  3HCS A;  5LKZ A;  3P1F A;  5EIS A;  5EQ1 A;  4HXO A;  5HM0 A;  2AN6 A;  5FE7 A;  3PUQ A;  2MD8 C;  5KTX A;  2L85 A;  4NUD A;  3LQI A;  4Z1Q A;  4A9L A;  4TU6 A;  2OXQ C;  4YYG A;  3N9P A;  5H1T A;  3KV6 A;  4BW3 A;  4O74 A;  4A9I A;  4TS8 A;  5CUD A;  4HBV A;  5A85 A;  4RVR A;  5KO4 A;  2L80 A;  1EQF A;  4O70 A;  5C8G A;  3EB5 A;  1E6I A;  3O70 A;  5KHM A;  2ECT A;  5E3D A;  5LKT A;  4XI1 A;  2MJV B;  2JMJ A;  4UIX A;  5F2P A;  3DAI A;  4LLB A;  5FEY A;  3U5L A;  5I80 A;  2KWN A;  1FBV A;  5HRW A;  3T7L A;  5ENH A;  3L11 A;  5K29 A;  4W4U A;  4IR3 A;  2LRI C;  4O76 A;  5D3H A;  2DX8 A;  3ONI A;  4HBW A;  4YYD A;  3PHD A;  4IR5 A;  4N4I A;  2RO1 A;  1T1H A;  4N4G A;  5IGK A;  1WEO A;  5FE1 A;  3IU6 A;  2R0Y A;  2F6J A;  4UYE A;  5IG6 A;  3TLP A;  1VYX A;  4UIW A;  4XUB A;  2G45 A;  4HBX A;  4HXM A;  4O78 A;  3C5K A;  4A9K A;  5LJ2 A;  4LK9 A;  4CFL A;  4YYJ A;  2K1J A;  2G43 A;  3U5P A;  2LN0 A;  2XEU A;  4LKA A;  5TAB A;  4X2I A;  1VFY A;  5LCW B;  5EPS A;  5LVR A;  3K2J A;  5L99 A;  4CLB A;  1U6G B;  5FE4 A;  4UI9 B;  5ENI A;  5FH8 A;  2JMD A;  4NQN A;  4C66 A;  3G0J A;  2OO1 A;  2EGP A;  5F25 A;  5C4Q A;  4XUA A;  2K16 A;  4L7X A;  2H0D A;  4O7F A;  5DLZ A;  5DW1 A;  1CHC A;  3SHB A;  4UP0 A;  4XY9 A;  5HJC A;  5I3L A;  2K4D A;  3NG2 A;  5AD3 A;  3SVF A;  2I7K A;  5JWM A;  5CY9 A;  4QB3 A;  4QSV A;  5L8T A;  2KIZ A;  2UZG A;  4NYX A;  4Z6I A;  2YEK A;  4HXR A;  5DKD A;  2YUR A;  4E96 A;  1WEN A;  2EA6 A;  3HME A;  5F36 A;  3PUR A;  3U5M A;  4Z6H A;  3ZVZ B;  5A7C A;  4F52 B;  5TRB A;  4O7E A;  2DVS A;  5EWW A;  5CUB A;  4O75 A;  5E9L A;  5F3A A;  2M3H A;  2XB1 A;  5ETD A;  4A49 A;  5LUU A;  1WIM A;  5B8D A;  5D24 A;  5DYX A;  5CQ3 A;  3DPL R;  1WEP A;  2YQD A;  5KH7 A;  4QF3 A;  3NXB A;  4J3I A;  4UYG A;  5KTW A;  1X4J A;  2VJF A;  4LYS A;  5FH6 A;  3SOU A;  2C2L A;  5TB6 A;  1WE9 A;  4XYA A;  2CT2 A;  5B78 A;  3JVK A;  5G4S A;  4L58 A;  4MEP A;  4WZ0 A;  5CFW A;  4TZ2 A;  2NAA A;  5AIU A;  5H9M A;  4O71 A;  4LZS A;  2RI7 A;  2MD7 B;  5AIT A;  4QUU A;  5CQ7 A;  4GB0 A;  2LQ6 A;  5CUA A;  5CQT A;  5D7X A;  4WZ2 A;  5CUE A;  4LAD B;  4NR6 A;  1WUM A;  2VP7 A;  3UVD A;  4HBY A;  4V3L C;  2YEM A;  2RFJ A;  3U5N A;  4NXJ A;  5A83 A;  5A5S A;  2YU4 A;  4Q0O A;  4QR3 A;  4A4C A;  5HRV A;  2JMI A;  4PCE A;  3L1Z B;  5HQ5 A;  5HEL A;  2MT5 A;  4KCX A;  5AD2 A;  5F61 A;  4A9E A;  2LGL A;  4YBM A;  1N87 A;  4NUC A;  4NR9 A;  5CQ6 A;  2KE1 A;  5I89 A;  3JVM A;  4IOO A;  2H60 A;  4QYL A;  2ECG A;  3GL6 A;  4LC2 A;  2E6R A;  5E7D A;  5HRX A;  3EB6 A;  4TT2 A;  1K2F A;  4QSX A;  3ZYU A;  3Q2E A;  3O33 A;  5FG6 A;  3MB3 A;  3QZT A;  4WHU A;  4AP4 A;  2FUI A;  3N9M A;  5EI4 A;  3C6W A;  2LXH C;  4XY8 A;  5H85 A;  2OUO A;  3AAD A;  2I8N A;  5DFC A;  5F60 A;  4UYH A;  1WFK A;  2MA6 A;  4YAB A;  4GNG A;  4QSU A;  4LZ2 A;  4LJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...