2F6NA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the free form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2f6nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f6nA01
3LJWA 5C11A 4P5OB 2XEUA 2DWWA 1JM4B 4MEQA 5DFBA 2MD7B 2C2LA 3KV6A 5JG6A 3SOUA 4HXKA 4UYHA 2FUUA 3PURA 2CSYA 2MJVB 3RPGC 1JM7A 4XI1A 5D26A 5ENEA 5F63A 5D0CA 2NXBA 4HBVA 5I40A 3MHSA 2KIZA 4GB0A 4UI9B 4ZC9A 1JOCA 4LYWA 3I2DA 3T6RA 5B79A 5FE4A 5A7CA 5D25A 4Z6HA 5DYXA 5CTLA 5HFRA 4QEWA 5G04B 4WZ0A 2EGPA 4QC3A 2E3KA 5D3JA 5DKDA 4W4UA 3K2JA 4A9JA 4B86C 5IGMA 5IIDA 5EV9A 5EWHA 5FE0A 4HXMA 4HXRA 5F5ZA 4Q6FA 5L96A 2H0DB 4GPJA 5CQ5A 4O7FA 5L8UA 5KH9A 3ZPV1 3LQIA 3PUQA 4QSWA 2AN6A 5CQAA 5HRXA 2LGLA 5D3SA 4NR6A 2QIZA 1E4UA 5DBMA 4N4HA 4TZ8A 5C4QA 1BORA 5F1LA 2E6RA 4YADA 3MULA 5A5NA 4J1PA 2DKWA 2L5UA 1WEWA 4O78A 4UYFA 5CFWA 3G0JA 3IU6A 4Q0OA 5FBXA 4UYDA 3KV5A 3M99A 5TDWA 5H1UA 3MQMA 2OUOA 5CPEA 4Q0NA 5ETBA 2F42A 2ECTA 5HCLA 3P1CA 3P1FA 5FH7A 2UZGA 4MR6A 5D3PA 5KO4A 2KREA 2E6SA 4FO9A 5AD3A 5A5OA 5ACYA 3HTKC 4YYGA 4R2YA 3L1ZB 5A5SA 2ECVA 2PNXA 3O33A 4TS8A 2YEKA 4YYJA 3FKMX 5FDZA 5FFWA 5CU8A 5COIA 2JMIA 3D7CA 5CQ4A 2F6NA 4LZ2A 1IYMA 5FFYA 1XWHA 5D3TA 4I7DA 5E9KA 1WENA 2RNYA 1V87A 1WEOA 2KGIA 5FE7A 2CKLB 4AYCA 5D3HA 3N9MA 2GRCA 4YBTA 1X4UA 4O70A 2VPBA 5II2A 5EVAA 4HXOA 5ENFA 3U5PA 5DY7A 5CQ6A 4TT2A 2L5EA 4YK0A 5FE5A 5FE9A 4UIXA 4A9EA 2YREA 4OUFA 4S3OB 4A9NA 2R10A 5E9YA 5FFVA 4A9LA 4C9ZA 4O76A 5F25A 4N4IA 2YQMA 4AKNA 2EA6A 2L85A 1DVPA 4TT6A 4L58A 2I7KA 1G25A 5H85A 5KU3A 2YUCA 5C85A 5IGNA 3ASLA 5G05B 4LK9A 5LJ1A 4YYNA 3O37A 4ZW1A 2XB1A 4UP5A 1WEQA 2YU4A 4IR5A 4MEOA 4QSVA 5HEMA 2R0SA 4CUPA 5ENIA 2MIQA 1RMDA 2KFTA 5AIUA 4NQMA 5HQ7A 5ENHA 4PS5A 2OXQC 3LQHA 4LDFA 2K4DA 4YY6A 5HRWA 4ALGA 5ETDA 5HQ5A 5EGUA 4LJNA 2FUIA 4NR9A 2HYED 5EPSA 5C89A 4HBYA 4FIPA 4FK5A 4MR4A 4LYSA 5A5QA 4YATA 2LGKA 4GNFA 5E9MA 4QEVA 2DVVA 4IC2A 4O7BA 2LXHC 3HCTA 2M85A 5DKAA 4Y03A 1WIMA 4IOOA 2YSMA 4QSRA 4LZRA 4HXPA 4TYLA 4BW1A 2D82A 4N4FA 5CQ7A 1CHCA 5AMEA 4C67A 2Y1MA 5HM0A 4YYMA 5KTUA 3C5KA 3ZYUA 4Z6IA 4PPEA 3V43A 4A4BA 5E0RA 4CUUA 4DONA 5DLZA 1T1HA 5HFQA 4TZ2A 4QNSA 5D3NA 4XY8A 4S3OC 4QUTA 5DYCA 3N9PA 4QSUA 5EI4A 5JI8A 4QEUA 3O70A 4J0SA 2ZETC 4F3IA 5LCWB 5HQ6A 5LUUA 3ZYQA 5DYUA 4HXNA 5I88A 2VPDA 2H60A 5KTWA 2KE1A 2KR4A 2YELA 5TCMA 4NUEA 4OGJA 3LRQA 5EPRA 4WZ3B 3LXJA 2KWNA 3UV5A 4MR3A 2ECJA 3ZVZB 4HBWA 4NR7A 3KQIA 1FP0A 5EWVA 1WFKA 3MUKA 4GNGA 3JVKA 4QF3A 4MEPA 4KV1A 4O75A 1VFYA 2L43A 2YYRA 3SVFA 4NR8A 5E73A 2VP7A 2RI7A 5BT5A 4LLBA 1Z2QA 4N3WA 5F61A 3LQJA 3FL2A 2DVQA 4PY6A 1WESA 5ENCA 2LGVA 3ZPVE 5HENA 5B76A 4YYHA 5JWMA 5E9LA 3UVYA 3IHPA 2DVRA 1WILA 4TT4A 5CUEA 2MA6A 3Q2FA 2PUYA 3HCUA 4QZSA 2RO1A 3ZTGA 5D3RA 3S92A 1WGMA 3UVWA 2RNXA 5DKCA 4ALHA 1MM3A 4UYGA 4WIVA 4R7EA 1HYIA 4YH3A 3HCSA 4C66A 4CA1A 4QSXA 5A5RA 2F6JA 4B7YC 5L99A 5HJCA 3VK6A 2N9GA 5J3XA 3JVJA 4OGIA 4QR4A 4NR5A 2WP2A 2RFJA 3HMHA 3M62A 4IR6A 5I7YA 1MM2A 2YHOA 4UYEA 4ZDTA 3P1EA 4CLBA 4O77A 5H1VA 1VD4A 2VJFB 3EB6A 4Z93A 1E6IA 5ENBA 5FH8A 3SVGA 4E96A 1X4JA 3DQVR 3L11A 2R0YA 5CUBA 4F52B 2OSSA 3N9OA 4TKPB 4YYKA 2H0DA 5KH7A 4O7EA 2LQ6A 4N4GA 3MHHA 5LJ2A 4QF2A 2VPEA 5CUDA 3MXFA 3DPLR 4WZ2A 5KH3A 4ZQLA 5I89A 5A83A 5G0FA 1F62A 3TLPA 4YC9A 2MA5A 1VYXA 2VJEB 5FERA 4TU6A 4MR5A 4O72A 4YY4A 5I1QA 5IGKA 2KWJA 3MB3A 5FH6A 5C13A 3U5NA 2L75A 1HYJA 4NYWA 3NG2A 5KTXA 2G4AA 5CQ3A 4BW3A 2KWKA 3DAIA 3P1DA 4YBMA 5D1MB 4NRAA 4J3IA 1WEVA 4NYXA 4A0CD 2HDPA 2Y1NA 4QSPA 2YYNA 4XUBA 1WUMA 5CUGA 5AD2A 2K17A 2KWOA 5DFDA 3AADA 5TABA 5FE1A 5F62A 5A81A 1WEPA 1WE9A 4A9FA 4BW2A 4WHWA 5D7XA 5II1A 2EODA 4NR4A 1X4IA 5CZGA 2ECGA 5ENGA 2MNYA 4FJCA 4CCGX 1FBVA 4HXSA 2RNWA 4X3GA 5CRZA 1WEMA 2CT2A 3ZNIA 5EPBA 5FE3A 5A5PA 3RCWA 4PKLA 4UITA 5AMFA 4R8PK 5FB1A 2KU3A 2FSAA 4YABA 3SVHA 5I86A 3RTRB 4YYDA 1Z6UA 2K1JA 3GG3A 4IORA 3MB4A 4CFKA 2VJFA 2YW8A 2I8NA 4TQNA 2CKLA 3O34A 4QY4A 4A9IA 2KYUA 5B77A 5BT4A 4LRGA 4WA6A 4O7CA 5EP7A 2BAYA 5CGPA 4MENA 4NRCA 4A9MA 2KTBB 2LRIC 5D1KB 5LKTA 5FB0A 4QSSA 4YAXA 2MNZA 5E3DA 5AITA 5DINA 3P5OA 4UYFB 4YYIA 5LVRA 4IR3A 3N9NA 3HMEA 2L80A 4LKAA 4I7CA 5EWDA 4UP0A 5LKXA 2JMDA 4XYAA 5LJ0A 5I80A 4QC1A 1N72A 5A82A 5E7DA 5ENJA 4KV4A 3JVLA 5I3LA 1WUGA 2R0VA 2D8SA 1EQFA 4NS5A 5CRMA 3U5MA 3GV4A 3I3JA 2E7NA 5F60A 5CUAA 5EICA 4IOQA 4NUDA 3ONIA 3S91A 4Z1SA 5TBNA 3O7AA 2YT5A 2CSZA 2ECNA 4NN2A 5FG4A 4LYIA 4CURA 5CS8A 2VNFA 5EQ1A 4A4CA 5I7XA 4BBQA 5TDRA 2LN0A 4XUAA 1WEUA 2G6QA 1U6GB 3T7LA 2K16A 4AYCB 5H9MA 5E3GA 5C87A 4PCIA 5DKHA 5F1HA 5BT3A 2VPGA 4XY9A 3GL6A 4MVTA 4Z1QA 4A9HA 5F36A 4TU4A 1ZS5A 4O74A 1F68A 2JRJA 2MD8C 2G43A 5CP5A 3M63A 3KNVA 2RSDA 5D24A 2YHNA 5EWCA 5DLXA 4UIWA 5F3AA 3EB5A 1N87A 5H1TA 3L1XA 4X2IA 4PTBA 1LDKC 2MT5A 2L0BA 2YDWA 4WHUA 4CUSA 4ZUXU 4V3LC 5DW1A 5L8TA 4UIYA 4UIZA 5K29A 3N9QA 2WP1A 2G45A 4IC3A 4QUUA 4CFLA 5DYAA 4MSXA 5G4SA 2DATA 1X0JA 2I50A 5IBNA 5EWWA 2YQDA 4FLPA 5C8GA 5G4RA 2DX8A 2Y43A 5E74A 4I7BA 4AP4A 5A85A 3C6WA 3JVMA 5B75A 4GNEA 5FG6A 1JSPB 4BJXA 2YQLA 4QSTA 5TB6A 3U5JA 4LR6A 4L7XA 5HRVA 3DWYA 3SOWA 5I29A 5F2PA 2KGGA 5CY9A 4NRBA 4UIVA 2LSPB 4QBMA 3UVDA 3N9LA 3AQAA 2YW5A 4NQNA 4QR3A 2OO1A 5DW2A 3UV4A 3O36A 2L84A 1LDJB 4J0RA 5E9VA 5HLSA 5FEYA 3RPGB 3SHBA 2RS9B 5CQ8A 5LVQA 2JMJA 2ECWA 1JM7B 5B78A 4LZSA 2LXPC 2IDAA 2DVSA 1ZBDB 5D3LA 4GNDA 4CUTA 3UVXA 4QB3A 4NUCA 2LDRA 2D9EA 3HMFA 4HBXA 2C2VS 3UW9A 4AVXA 4IR4A 4QYLA 5EU1A 4CL9A 2YEMA 4LADB 5EM3A 2YURA 3QZVA 5IGLA 4RVRA 4A9KA 5KHMA 3PHDA 4UIUA 4YH4A 4V3KC 4O7AA 4QR5A 5B8DA 3ZVYA 2QICA 5LKUA 4KCXA 5L98A 1Z60A 2LV9A 4LC2A 2ECIA 4QSQA 4O64A 3NXBA 3U5KA 4HXLA 4PCEA 4NYVA 5HELA 5FG5A 4CUQA 5CQTA 4BW4A 5EK9A 3U5OA 3UV2A 3IU5A 1WEEA 5L97A 5TRBA 2E7OA 3SOXA 4BHWA 3U5LA 5IG6A 2M3HA 5DFCA 5DX4A 4A9OA 4A49A 5CUCA 2QJ0A 4NXJA 5I83A 2LGGA 2M1RA 5FE8A 5E9IA 5FE6A 2MUMA 2YSJA 5EA1A 5J0DA 3O35A 4YBSA 4AUQB 5EYAF 4TTEA 5EISA 3QZTA 4O71A 1K2FA 5D1LB 5C7NA 3QZSA 2M6MA 2VJEA 3Q2EA 2NAAA 3G0LA 5FE2A 5LKZA 4QYDA
chains in the Genus database with same CATH superfamily
3LJWA 5C11A 4P5OB 2XEUA 2DWWA 1JM4B 4MEQA 5DFBA 2MD7B 2C2LA 3KV6A 5JG6A 3SOUA 4HXKA 4UYHA 2FUUA 3PURA 2M13A 2CSYA 2MJVB 3RPGC 1JM7A 4XI1A 5D26A 5ENEA 5F63A 5D0CA 3SUBA 2NXBA 4HBVA 5I40A 3MHSA 2KIZA 4GB0A 4UI9B 4ZC9A 1JOCA 4LYWA 3I2DA 3T6RA 5B79A 5FE4A 5A7CA 5D25A 4Z6HA 5DYXA 5CTLA 5HFRA 4QEWA 5G04B 4QQ4A 4WZ0A 2EGPA 4QC3A 2E3KA 5D3JA 5DKDA 4W4UA 3K2JA 4A9JA 2KKYA 5IGMA 5IIDA 5EV9A 5EWHA 5FE0A 4HXMA 4HXRA 5F5ZA 2CRRA 5L96A 4Q6FA 2H0DB 4GPJA 5CQ5A 4O7FA 5L8UA 5KH9A 3ZPV1 3LQIA 3PUQA 4QSWA 2AN6A 5CQAA 5HRXA 2LGLA 5D3SA 4NR6A 2QIZA 1E4UA 3E2DA 5DBMA 4N4HA 4TZ8A 5C4QA 1BORA 5SVYA 5F1LA 2E6RA 4YADA 3MULA 5A5NA 4J1PA 3KDEC 2DKWA 2L5UA 1PUOA 1WEWA 4O78A 4UYFA 5CFWA 3G0JA 3IU6A 4Q0OA 5FBXA 4UYDA 3KV5A 3M99A 5TDWA 5H1UA 3FJUB 3MQMA 2OUOA 5CPEA 4Q0NA 5ETBA 2F42A 3FAOA 2ECTA 5HCLA 3P1CA 3P1FA 5FH7A 2UZGA 4MR6A 5D3PA 5KO4A 2KREA 2E6SA 4FO9A 5AD3A 5A5OA 5ACYA 3HTKC 4YYGA 4R2YA 3L1ZB 5A5SA 2ECVA 2PNXA 4TS8A 3O33A 2CRWA 2YEKA 4YYJA 3FKMX 5FDZA 5FFWA 5CU8A 5COIA 2JMIA 3D7CA 1MBMA 5CQ4A 2F6NA 4LZ2A 1IYMA 5FFYA 1XWHA 5D3TA 4I7DA 5E9KA 1WENA 3LVQE 2RNYA 1V87A 1WEOA 2KGIA 5FE7A 2CKLB 4AYCA 5D3HA 3N9MA 2GRCA 4YBTA 1X4UA 4O70A 2VPBA 5II2A 5EVAA 4HXOA 5ENFA 3U5PA 5DY7A 5CQ6A 4TT2A 2L5EA 4YK0A 5FE5A 5FE9A 4UIXA 4A9EA 2YREA 4OUFA 4S3OB 2KKXA 4A9NA 2R10A 3D1BA 5E9YA 5FFVA 4A9LA 3DWDA 4C9ZA 3JUEA 4O76A 5F25A 2RR4A 4N4IA 2YQMA 4AKNA 2EA6A 2L85A 1DVPA 4TT6A 4L58A 2I7KA 1G25A 5H85A 5KU3A 2YUCA 5C85A 5IGNA 3ASLA 5G05B 4LK9A 5LJ1A 4YYNA 3O37A 4ZW1A 2XB1A 4UP5A 1WEQA 2YU4A 4IR5A 4MEOA 4QSVA 5HEMA 2R0SA 4CUPA 5ENIA 2MIQA 1RMDA 2KFTA 5AIUA 2DSMA 4NQMA 5HQ7A 5ENHA 4PS5A 2OXQC 3LQHA 3M7KA 4LDFA 2K4DA 4YY6A 5HRWA 4ALGA 5ETDA 5HQ5A 5EGUA 4LJNA 2FUIA 4NR9A 2HYED 5EPSA 5C89A 4HBYA 4FIPA 4FK5A 4MR4A 4LYSA 5A5QA 4YATA 2LGKA 4GNFA 5E9MA 4QEVA 2MKEA 2DVVA 4IC2A 4O7BA 2LXHC 3HCTA 2M85A 5DKAA 4Y03A 4AKIA 1WIMA 4IOOA 2YSMA 4QSRA 4LZRA 4HXPA 4TYLA 4BW1A 2D82A 4N4FA 5CQ7A 1CHCA 5AMEA 4C67A 2Y1MA 5HM0A 4YYMA 5KTUA 3C5KA 3ZYUA 4Z6IA 4PPEA 3V43A 4A4BA 5E0RA 4CUUA 4DONA 5DLZA 1T1HA 5HFQA 2E61A 4TZ2A 4QNSA 5D3NA 4XY8A 4S3OC 4QUTA 5DYCA 3N9PA 3LDYA 4V3KC 4QSUA 5EI4A 5JI8A 4QEUA 3O70A 4J0SA 2ZETC 4F3IA 5LCWB 3O47A 5HQ6A 5LUUA 3ZYQA 5DYUA 4HXNA 5I88A 2VPDA 2H60A 5KTWA 2KE1A 2KR4A 2YELA 5TCMA 4NUEA 4OGJA 3LRQA 5EPRA 4WZ3B 3LXJA 2KWNA 3ERRA 3UV5A 4MR3A 2ECJA 3ZVZB 4HBWA 4NR7A 3KQIA 1FP0A 5EWVA 1WFKA 3MUKA 4GNGA 3JVKA 4QF3A 4MEPA 4KV1A 4O75A 1VFYA 2L43A 2YYRA 4O62A 3SVFA 4NR8A 5E73A 2VP7A 2RI7A 5BT5A 4LLBA 1Z2QA 4N3WA 5F61A 3LQJA 3FL2A 2DVQA 4PY6A 1WESA 2OWAA 5ENCA 2LGVA 3ZPVE 2FD4A 5HENA 5B76A 4YYHA 4OGEA 5JWMA 5E9LA 3UVYA 3IHPA 2DVRA 3MDBC 1WILA 4TT4A 5CUEA 2MA6A 3Q2FA 2PUYA 3HCUA 4QZSA 2RO1A 3ZTGA 5D3RA 3S92A 1WGMA 3UVWA 2RNXA 5DKCA 3FM8C 4ALHA 1MM3A 4UYGA 4WIVA 4R7EA 1HYIA 4YH3A 3HCSA 4C66A 4CA1A 4QSXA 5A5RA 2F6JA 4B7YC 5L99A 5HJCA 3VK6A 2N9GA 5J3XA 3JVJA 4OGIA 4QR4A 4NR5A 2WP2A 2RFJA 3HMHA 3M62A 4IR6A 5I7YA 1MM2A 2YHOA 4UYEA 4ZDTA 3P1EA 4CLBA 4O77A 5H1VA 4Z0RA 1VD4A 2VJFB 3EB6A 4Z93A 1E6IA 5ENBA 5FH8A 3SVGA 4E96A 1X4JA 3DQVR 3L11A 2R0YA 5CUBA 4F52B 2OSSA 3N9OA 4TKPB 4YYKA 2B0OE 2H0DA 5KH7A 4O7EA 2LQ6A 4N4GA 3MHHA 5LJ2A 4QF2A 2VPEA 5CUDA 3MXFA 3DPLR 4WZ2A 5KH3A 4ZQLA 5I89A 5A83A 5G0FA 1F62A 3TLPA 4YC9A 2MA5A 1VYXA 2VJEB 5FERA 3VKHA 4TU6A 4MR5A 4O72A 4YY4A 5I1QA 5IGKA 2KWJA 3MB3A 5FH6A 5C13A 3U5NA 2L75A 1HYJA 4NYWA 3NG2A 4AKGA 5KTXA 2G4AA 5CQ3A 4BW3A 2XOZA 2KWKA 3DAIA 3P1DA 4YBMA 5D1MB 4NRAA 4J3IA 1WEVA 4NYXA 4A0CD 2HDPA 2Y1NA 4QSPA 2YYNA 4XUBA 1WUMA 5CUGA 5AD2A 2K17A 2KWOA 5DFDA 3AADA 5TABA 5FE1A 5F62A 5A81A 1WEPA 1WE9A 4A9FA 4BW2A 4WHWA 5D7XA 5II1A 2EODA 4NR4A 1X4IA 5CZGA 2D8UA 5SVXA 2ECGA 5ENGA 2MNYA 4FJCA 4CCGX 1FBVA 4HXSA 2RNWA 4X3GA 5CRZA 1WEMA 2CT2A 3ZNIA 5EPBA 5FE3A 5A5PA 3RCWA 4PKLA 4UITA 5AMFA 4R8PK 3DDTA 5FB1A 2KU3A 2FSAA 3LVRE 4YABA 3SVHA 5I86A 3RTRB 4YYDA 1DCQA 1Z6UA 2K1JA 3H7HA 3GG3A 4IORA 3MB4A 4CFKA 2VJFA 2YW8A 2I8NA 4TQNA 2CKLA 3O34A 4QY4A 4A9IA 2KYUA 3T9KA 5B77A 5BT4A 4LRGA 4WA6A 4O7CA 5EP7A 2BAYA 3FANA 5CGPA 4MENA 4NRCA 4A9MA 2KTBB 2LRIC 5D1KB 5LKTA 5FB0A 4QSSA 4YAXA 2MNZA 1ZKRA 5E3DA 5AITA 5DINA 3P5OA 4UYFB 4YYIA 5LVRA 4IR3A 3N9NA 4F1PA 3HMEA 2L80A 2XP0A 2YVRA 4LKAA 4I7CA 5K3QA 5EWDA 4UP0A 5LKXA 2JMDA 4XYAA 5LJ0A 5I80A 4QC1A 1N72A 5A82A 5E7DA 5ENJA 4OGCA 4KV4A 3JVLA 5I3LA 1WUGA 2R0VA 2D8SA 1EQFA 4NS5A 5CRMA 3U5MA 3GV4A 3I3JA 2E7NA 5F60A 5CUAA 5EICA 4IOQA 4NUDA 3ONIA 3S91A 4Z1SA 5TBNA 3O7AA 2YT5A 2CSZA 4AKHA 2ECNA 4NN2A 5FG4A 4LYIA 4CURA 2JM3A 5CS8A 2VNFA 5EQ1A 4A4CA 5I7XA 4BBQA 5TDRA 2LN0A 4XUAA 3PLWA 1WEUA 2G6QA 1U6GB 3T7LA 2K16A 4AYCB 5H9MA 5E3GA 5C87A 4PCIA 5DKHA 5F1HA 5BT3A 2VPGA 4XY9A 3GL6A 4MVTA 4Z1QA 4A9HA 5F36A 4TU4A 1ZS5A 4O74A 4B86C 1F68A 2JRJA 2MD8C 2G43A 5CP5A 3M63A 3KNVA 2P57A 2RSDA 5D24A 2YHNA 3FEHA 5EWCA 5DLXA 4UIWA 5F3AA 2LAUA 4Z0OA 2EGMA 3EB5A 1N87A 5H1TA 3L1XA 4X2IA 4PTBA 1LDKC 2MT5A 5SVIB 2L0BA 2YDWA 4WHUA 4CUSA 4ZUXU 4V3LC 2CSVA 5DW1A 2IQJA 5L8TA 4UIYA 2FFWA 4UIZA 5K29A 3N9QA 2WP1A 2EJNA 2G45A 4IC3A 4QUUA 4CFLA 5DYAA 4MSXA 5G4SA 2DATA 1X0JA 2I50A 5IBNA 3VKGA 5EWWA 2YQDA 4FLPA 5C8GA 5G4RA 2DX8A 2Y43A 5E74A 4I7BA 4AP4A 5A85A 3C6WA 3JVMA 5B75A 4GNEA 5FG6A 1JSPB 4BJXA 2YQLA 2JUNA 3Q1DA 4QSTA 2L7PA 4H9DA 5TB6A 3U5JA 4LR6A 2DJAA 4L7XA 5HRVA 3DWYA 3SOWA 5I29A 5F2PA 2KGGA 5CY9A 4NRBA 4UIVA 2LSPB 4QBMA 3UVDA 3N9LA 3AQAA 2YW5A 4NQNA 4QR3A 2OO1A 5DW2A 3UV4A 3O36A 2L84A 1LDJB 4J0RA 5E9VA 5HLSA 5FEYA 3RPGB 3SHBA 2RS9B 5CQ8A 5LVQA 2JMJA 2ECWA 1JM7B 5B78A 4LZSA 2LXPC 2IDAA 2DVSA 1ZBDB 3D1DA 5D3LA 4GNDA 4CUTA 3UVXA 4QB3A 4NUCA 2LDRA 2D9EA 3HMFA 4HBXA 2C2VS 3UW9A 4AVXA 4IR4A 4QYLA 5EU1A 4CL9A 2YEMA 4LADB 5EM3A 2YURA 3QZVA 5IGLA 4RVRA 4A9KA 5KHMA 3LJUX 4UIUA 4YH4A 2EXUA 4O7AA 4QR5A 3PHDA 5B8DA 3ZVYA 5SVIA 2QICA 5LKUA 4KCXA 5L98A 1Z60A 2LV9A 4LC2A 2ECIA 4QSQA 2CONA 4O64A 3NXBA 3U5KA 4HXLA 4PCEA 4NYVA 5HELA 5FG5A 4CUQA 5CQTA 4AI6A 4BW4A 5EK9A 3U5OA 3UV2A 3IU5A 1WEEA 5L97A 5TRBA 2E7OA 3SOXA 4BHWA 3U5LA 2XOCA 5IG6A 2M3HA 5DFCA 5DX4A 4A9OA 2XOYA 4A49A 5CUCA 2QJ0A 4NXJA 5I83A 2LGGA 2M1RA 5FE8A 5E9IA 5FE6A 2MUMA 2YSJA 5EA1A 5J0DA 3O35A 4YBSA 4AUQB 5EYAF 4TTEA 5EISA 3QZTA 4O71A 1K2FA 5D1LB 5C7NA 3QZSA 2M6MA 2VJEA 3Q2EA 2NAAA 3G0LA 5FE2A 5LKZA 4QYDA
chains in the Genus database with same CATH topology
3LJWA 5C11A 4P5OB 2XEUA 2DWWA 1JM4B 4MEQA 5DFBA 2MD7B 2C2LA 3KV6A 5JG6A 3SOUA 4HXKA 4UYHA 2FUUA 3PURA 2CSYA 2MJVB 3RPGC 1JM7A 4XI1A 5D26A 5ENEA 5F63A 5D0CA 2NXBA 4HBVA 5I40A 3MHSA 2KIZA 4GB0A 4UI9B 4ZC9A 1JOCA 4LYWA 3I2DA 3T6RA 5B79A 5FE4A 5A7CA 5D25A 4Z6HA 5DYXA 5CTLA 5HFRA 4QEWA 5G04B 4WZ0A 2EGPA 4QC3A 2E3KA 5D3JA 5DKDA 4W4UA 3K2JA 4A9JA 4B86C 5IGMA 5IIDA 5EV9A 5EWHA 5FE0A 4HXMA 4HXRA 5F5ZA 4Q6FA 5L96A 2H0DB 4GPJA 5CQ5A 4O7FA 5L8UA 5KH9A 3ZPV1 3LQIA 3PUQA 4QSWA 2AN6A 5CQAA 5HRXA 2LGLA 5D3SA 4NR6A 2QIZA 1E4UA 5DBMA 4N4HA 4TZ8A 5C4QA 1BORA 5F1LA 2E6RA 4YADA 3MULA 5A5NA 4J1PA 2DKWA 2L5UA 1WEWA 4O78A 4UYFA 5CFWA 3G0JA 3IU6A 4Q0OA 5FBXA 4UYDA 3KV5A 3M99A 5TDWA 5H1UA 3MQMA 2OUOA 5CPEA 4Q0NA 5ETBA 2F42A 2ECTA 5HCLA 3P1CA 3P1FA 5FH7A 2UZGA 4MR6A 5D3PA 5KO4A 2KREA 2E6SA 4FO9A 5AD3A 5A5OA 5ACYA 3HTKC 4YYGA 4R2YA 3L1ZB 5A5SA 2ECVA 2PNXA 3O33A 4TS8A 2YEKA 4YYJA 3FKMX 5FDZA 5FFWA 5CU8A 5COIA 2JMIA 3D7CA 5CQ4A 2F6NA 4LZ2A 1IYMA 5FFYA 1XWHA 5D3TA 4I7DA 5E9KA 1WENA 2RNYA 1V87A 1WEOA 2KGIA 5FE7A 2CKLB 4AYCA 5D3HA 3N9MA 2GRCA 4YBTA 1X4UA 4O70A 2VPBA 5II2A 5EVAA 4HXOA 5ENFA 3U5PA 5DY7A 5CQ6A 4TT2A 2L5EA 4YK0A 5FE5A 5FE9A 4UIXA 4A9EA 2YREA 4OUFA 4S3OB 4A9NA 2R10A 5E9YA 5FFVA 4A9LA 4C9ZA 4O76A 5F25A 4N4IA 2YQMA 4AKNA 2EA6A 2L85A 1DVPA 4TT6A 4L58A 2I7KA 1G25A 5H85A 5KU3A 2YUCA 5C85A 5IGNA 3ASLA 5G05B 4LK9A 5LJ1A 4YYNA 3O37A 4ZW1A 2XB1A 4UP5A 1WEQA 2YU4A 4IR5A 4MEOA 4QSVA 5HEMA 2R0SA 4CUPA 5ENIA 2MIQA 1RMDA 2KFTA 5AIUA 4NQMA 5HQ7A 5ENHA 4PS5A 2OXQC 3LQHA 4LDFA 2K4DA 4YY6A 5HRWA 4ALGA 5ETDA 5HQ5A 5EGUA 4LJNA 2FUIA 4NR9A 2HYED 5EPSA 5C89A 4HBYA 4FIPA 4FK5A 4MR4A 4LYSA 5A5QA 4YATA 2LGKA 4GNFA 5E9MA 4QEVA 2DVVA 4IC2A 4O7BA 2LXHC 3HCTA 2M85A 5DKAA 4Y03A 1WIMA 4IOOA 2YSMA 4QSRA 4LZRA 4HXPA 4TYLA 4BW1A 2D82A 4N4FA 5CQ7A 1CHCA 5AMEA 4C67A 2Y1MA 5HM0A 4YYMA 5KTUA 3C5KA 3ZYUA 4Z6IA 4PPEA 3V43A 4A4BA 5E0RA 4CUUA 4DONA 5DLZA 1T1HA 5HFQA 4TZ2A 4QNSA 5D3NA 4XY8A 4S3OC 4QUTA 5DYCA 3N9PA 4QSUA 5EI4A 5JI8A 4QEUA 3O70A 4J0SA 2ZETC 4F3IA 5LCWB 5HQ6A 5LUUA 3ZYQA 5DYUA 4HXNA 5I88A 2VPDA 2H60A 5KTWA 2KE1A 2KR4A 2YELA 5TCMA 4NUEA 4OGJA 3LRQA 5EPRA 4WZ3B 3LXJA 2KWNA 3UV5A 4MR3A 2ECJA 3ZVZB 4HBWA 4NR7A 3KQIA 1FP0A 5EWVA 1WFKA 3MUKA 4GNGA 3JVKA 4QF3A 4MEPA 4KV1A 4O75A 1VFYA 2L43A 2YYRA 3SVFA 4NR8A 5E73A 2VP7A 2RI7A 5BT5A 4LLBA 1Z2QA 4N3WA 5F61A 3LQJA 3FL2A 2DVQA 4PY6A 1WESA 5ENCA 2LGVA 3ZPVE 5HENA 5B76A 4YYHA 5JWMA 5E9LA 3UVYA 3IHPA 2DVRA 1WILA 4TT4A 5CUEA 2MA6A 3Q2FA 2PUYA 3HCUA 4QZSA 2RO1A 3ZTGA 5D3RA 3S92A 1WGMA 3UVWA 2RNXA 5DKCA 4ALHA 1MM3A 4UYGA 4WIVA 4R7EA 1HYIA 4YH3A 3HCSA 4C66A 4CA1A 4QSXA 5A5RA 2F6JA 4B7YC 5L99A 5HJCA 3VK6A 2N9GA 5J3XA 3JVJA 4OGIA 4QR4A 4NR5A 2WP2A 2RFJA 3HMHA 3M62A 4IR6A 5I7YA 1MM2A 2YHOA 4UYEA 4ZDTA 3P1EA 4CLBA 4O77A 5H1VA 1VD4A 2VJFB 3EB6A 4Z93A 1E6IA 5ENBA 5FH8A 3SVGA 4E96A 1X4JA 3DQVR 3L11A 2R0YA 5CUBA 4F52B 2OSSA 3N9OA 4TKPB 4YYKA 2H0DA 5KH7A 4O7EA 2LQ6A 4N4GA 3MHHA 5LJ2A 4QF2A 2VPEA 5CUDA 3MXFA 3DPLR 4WZ2A 5KH3A 4ZQLA 5I89A 5A83A 5G0FA 1F62A 3TLPA 4YC9A 2MA5A 1VYXA 2VJEB 5FERA 4TU6A 4MR5A 4O72A 4YY4A 5I1QA 5IGKA 2KWJA 3MB3A 5FH6A 5C13A 3U5NA 2L75A 1HYJA 4NYWA 3NG2A 5KTXA 2G4AA 5CQ3A 4BW3A 2KWKA 3DAIA 3P1DA 4YBMA 5D1MB 4NRAA 4J3IA 1WEVA 4NYXA 4A0CD 2HDPA 2Y1NA 4QSPA 2YYNA 4XUBA 1WUMA 5CUGA 5AD2A 2K17A 2KWOA 5DFDA 3AADA 5TABA 5FE1A 5F62A 5A81A 1WEPA 1WE9A 4A9FA 4BW2A 4WHWA 5D7XA 5II1A 2EODA 4NR4A 1X4IA 5CZGA 2ECGA 5ENGA 2MNYA 4FJCA 4CCGX 1FBVA 4HXSA 2RNWA 4X3GA 5CRZA 1WEMA 2CT2A 3ZNIA 5EPBA 5FE3A 5A5PA 3RCWA 4PKLA 4UITA 5AMFA 4R8PK 5FB1A 2KU3A 2FSAA 4YABA 3SVHA 5I86A 3RTRB 4YYDA 1Z6UA 2K1JA 3GG3A 4IORA 3MB4A 4CFKA 2VJFA 2YW8A 2I8NA 4TQNA 2CKLA 3O34A 4QY4A 4A9IA 2KYUA 5B77A 5BT4A 4LRGA 4WA6A 4O7CA 5EP7A 2BAYA 5CGPA 4MENA 4NRCA 4A9MA 2KTBB 2LRIC 5D1KB 5LKTA 5FB0A 4QSSA 4YAXA 2MNZA 5E3DA 5AITA 5DINA 3P5OA 4UYFB 4YYIA 5LVRA 4IR3A 3N9NA 3HMEA 2L80A 4LKAA 4I7CA 5EWDA 4UP0A 5LKXA 2JMDA 4XYAA 5LJ0A 5I80A 4QC1A 1N72A 5A82A 5E7DA 5ENJA 4KV4A 3JVLA 5I3LA 1WUGA 2R0VA 2D8SA 1EQFA 4NS5A 5CRMA 3U5MA 3GV4A 3I3JA 2E7NA 5F60A 5CUAA 5EICA 4IOQA 4NUDA 3ONIA 3S91A 4Z1SA 5TBNA 3O7AA 2YT5A 2CSZA 2ECNA 4NN2A 5FG4A 4LYIA 4CURA 5CS8A 2VNFA 5EQ1A 4A4CA 5I7XA 4BBQA 5TDRA 2LN0A 4XUAA 1WEUA 2G6QA 1U6GB 3T7LA 2K16A 4AYCB 5H9MA 5E3GA 5C87A 4PCIA 5DKHA 5F1HA 5BT3A 2VPGA 4XY9A 3GL6A 4MVTA 4Z1QA 4A9HA 5F36A 4TU4A 1ZS5A 4O74A 1F68A 2JRJA 2MD8C 2G43A 5CP5A 3M63A 3KNVA 2RSDA 5D24A 2YHNA 5EWCA 5DLXA 4UIWA 5F3AA 3EB5A 1N87A 5H1TA 3L1XA 4X2IA 4PTBA 1LDKC 2MT5A 2L0BA 2YDWA 4WHUA 4CUSA 4ZUXU 4V3LC 5DW1A 5L8TA 4UIYA 4UIZA 5K29A 3N9QA 2WP1A 2G45A 4IC3A 4QUUA 4CFLA 5DYAA 4MSXA 5G4SA 2DATA 1X0JA 2I50A 5IBNA 5EWWA 2YQDA 4FLPA 5C8GA 5G4RA 2DX8A 2Y43A 5E74A 4I7BA 4AP4A 5A85A 3C6WA 3JVMA 5B75A 4GNEA 5FG6A 1JSPB 4BJXA 2YQLA 4QSTA 5TB6A 3U5JA 4LR6A 4L7XA 5HRVA 3DWYA 3SOWA 5I29A 5F2PA 2KGGA 5CY9A 4NRBA 4UIVA 2LSPB 4QBMA 3UVDA 3N9LA 3AQAA 2YW5A 4NQNA 4QR3A 2OO1A 5DW2A 3UV4A 3O36A 2L84A 1LDJB 4J0RA 5E9VA 5HLSA 5FEYA 3RPGB 3SHBA 2RS9B 5CQ8A 5LVQA 2JMJA 2ECWA 1JM7B 5B78A 4LZSA 2LXPC 2IDAA 2DVSA 1ZBDB 5D3LA 4GNDA 4CUTA 3UVXA 4QB3A 4NUCA 2LDRA 2D9EA 3HMFA 4HBXA 2C2VS 3UW9A 4AVXA 4IR4A 4QYLA 5EU1A 4CL9A 2YEMA 4LADB 5EM3A 2YURA 3QZVA 5IGLA 4RVRA 4A9KA 5KHMA 3PHDA 4UIUA 4YH4A 4V3KC 4O7AA 4QR5A 5B8DA 3ZVYA 2QICA 5LKUA 4KCXA 5L98A 1Z60A 2LV9A 4LC2A 2ECIA 4QSQA 4O64A 3NXBA 3U5KA 4HXLA 4PCEA 4NYVA 5HELA 5FG5A 4CUQA 5CQTA 4BW4A 5EK9A 3U5OA 3UV2A 3IU5A 1WEEA 5L97A 5TRBA 2E7OA 3SOXA 4BHWA 3U5LA 5IG6A 2M3HA 5DFCA 5DX4A 4A9OA 4A49A 5CUCA 2QJ0A 4NXJA 5I83A 2LGGA 2M1RA 5FE8A 5E9IA 5FE6A 2MUMA 2YSJA 5EA1A 5J0DA 3O35A 4YBSA 4AUQB 5EYAF 4TTEA 5EISA 3QZTA 4O71A 1K2FA 5D1LB 5C7NA 3QZSA 2M6MA 2VJEA 3Q2EA 2NAAA 3G0LA 5FE2A 5LKZA 4QYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJW A;  5C11 A;  4P5O B;  2XEU A;  2DWW A;  1JM4 B;  4MEQ A;  5DFB A;  2MD7 B;  2C2L A;  3KV6 A;  5JG6 A;  3SOU A;  4HXK A;  4UYH A;  2FUU A;  3PUR A;  2CSY A;  2MJV B;  3RPG C;  1JM7 A;  4XI1 A;  5D26 A;  5ENE A;  5F63 A;  5D0C A;  2NXB A;  4HBV A;  5I40 A;  3MHS A;  2KIZ A;  4GB0 A;  4UI9 B;  4ZC9 A;  1JOC A;  4LYW A;  3I2D A;  3T6R A;  5B79 A;  5FE4 A;  5A7C A;  5D25 A;  4Z6H A;  5DYX A;  5CTL A;  5HFR A;  4QEW A;  5G04 B;  4WZ0 A;  2EGP A;  4QC3 A;  2E3K A;  5D3J A;  5DKD A;  4W4U A;  3K2J A;  4A9J A;  4B86 C;  5IGM A;  5IID A;  5EV9 A;  5EWH A;  5FE0 A;  4HXM A;  4HXR A;  5F5Z A;  4Q6F A;  5L96 A;  2H0D B;  4GPJ A;  5CQ5 A;  4O7F A;  5L8U A;  5KH9 A;  3ZPV 1;  3LQI A;  3PUQ A;  4QSW A;  2AN6 A;  5CQA A;  5HRX A;  2LGL A;  5D3S A;  4NR6 A;  2QIZ A;  1E4U A;  5DBM A;  4N4H A;  4TZ8 A;  5C4Q A;  1BOR A;  5F1L A;  2E6R A;  4YAD A;  3MUL A;  5A5N A;  4J1P A;  2DKW A;  2L5U A;  1WEW A;  4O78 A;  4UYF A;  5CFW A;  3G0J A;  3IU6 A;  4Q0O A;  5FBX A;  4UYD A;  3KV5 A;  3M99 A;  5TDW A;  5H1U A;  3MQM A;  2OUO A;  5CPE A;  4Q0N A;  5ETB A;  2F42 A;  2ECT A;  5HCL A;  3P1C A;  3P1F A;  5FH7 A;  2UZG A;  4MR6 A;  5D3P A;  5KO4 A;  2KRE A;  2E6S A;  4FO9 A;  5AD3 A;  5A5O A;  5ACY A;  3HTK C;  4YYG A;  4R2Y A;  3L1Z B;  5A5S A;  2ECV A;  2PNX A;  3O33 A;  4TS8 A;  2YEK A;  4YYJ A;  3FKM X;  5FDZ A;  5FFW A;  5CU8 A;  5COI A;  2JMI A;  3D7C A;  5CQ4 A;  2F6N A;  4LZ2 A;  1IYM A;  5FFY A;  1XWH A;  5D3T A;  4I7D A;  5E9K A;  1WEN A;  2RNY A;  1V87 A;  1WEO A;  2KGI A;  5FE7 A;  2CKL B;  4AYC A;  5D3H A;  3N9M A;  2GRC A;  4YBT A;  1X4U A;  4O70 A;  2VPB A;  5II2 A;  5EVA A;  4HXO A;  5ENF A;  3U5P A;  5DY7 A;  5CQ6 A;  4TT2 A;  2L5E A;  4YK0 A;  5FE5 A;  5FE9 A;  4UIX A;  4A9E A;  2YRE A;  4OUF A;  4S3O B;  4A9N A;  2R10 A;  5E9Y A;  5FFV A;  4A9L A;  4C9Z A;  4O76 A;  5F25 A;  4N4I A;  2YQM A;  4AKN A;  2EA6 A;  2L85 A;  1DVP A;  4TT6 A;  4L58 A;  2I7K A;  1G25 A;  5H85 A;  5KU3 A;  2YUC A;  5C85 A;  5IGN A;  3ASL A;  5G05 B;  4LK9 A;  5LJ1 A;  4YYN A;  3O37 A;  4ZW1 A;  2XB1 A;  4UP5 A;  1WEQ A;  2YU4 A;  4IR5 A;  4MEO A;  4QSV A;  5HEM A;  2R0S A;  4CUP A;  5ENI A;  2MIQ A;  1RMD A;  2KFT A;  5AIU A;  4NQM A;  5HQ7 A;  5ENH A;  4PS5 A;  2OXQ C;  3LQH A;  4LDF A;  2K4D A;  4YY6 A;  5HRW A;  4ALG A;  5ETD A;  5HQ5 A;  5EGU A;  4LJN A;  2FUI A;  4NR9 A;  2HYE D;  5EPS A;  5C89 A;  4HBY A;  4FIP A;  4FK5 A;  4MR4 A;  4LYS A;  5A5Q A;  4YAT A;  2LGK A;  4GNF A;  5E9M A;  4QEV A;  2DVV A;  4IC2 A;  4O7B A;  2LXH C;  3HCT A;  2M85 A;  5DKA A;  4Y03 A;  1WIM A;  4IOO A;  2YSM A;  4QSR A;  4LZR A;  4HXP A;  4TYL A;  4BW1 A;  2D82 A;  4N4F A;  5CQ7 A;  1CHC A;  5AME A;  4C67 A;  2Y1M A;  5HM0 A;  4YYM A;  5KTU A;  3C5K A;  3ZYU A;  4Z6I A;  4PPE A;  3V43 A;  4A4B A;  5E0R A;  4CUU A;  4DON A;  5DLZ A;  1T1H A;  5HFQ A;  4TZ2 A;  4QNS A;  5D3N A;  4XY8 A;  4S3O C;  4QUT A;  5DYC A;  3N9P A;  4QSU A;  5EI4 A;  5JI8 A;  4QEU A;  3O70 A;  4J0S A;  2ZET C;  4F3I A;  5LCW B;  5HQ6 A;  5LUU A;  3ZYQ A;  5DYU A;  4HXN A;  5I88 A;  2VPD A;  2H60 A;  5KTW A;  2KE1 A;  2KR4 A;  2YEL A;  5TCM A;  4NUE A;  4OGJ A;  3LRQ A;  5EPR A;  4WZ3 B;  3LXJ A;  2KWN A;  3UV5 A;  4MR3 A;  2ECJ A;  3ZVZ B;  4HBW A;  4NR7 A;  3KQI A;  1FP0 A;  5EWV A;  1WFK A;  3MUK A;  4GNG A;  3JVK A;  4QF3 A;  4MEP A;  4KV1 A;  4O75 A;  1VFY A;  2L43 A;  2YYR A;  3SVF A;  4NR8 A;  5E73 A;  2VP7 A;  2RI7 A;  5BT5 A;  4LLB A;  1Z2Q A;  4N3W A;  5F61 A;  3LQJ A;  3FL2 A;  2DVQ A;  4PY6 A;  1WES A;  5ENC A;  2LGV A;  3ZPV E;  5HEN A;  5B76 A;  4YYH A;  5JWM A;  5E9L A;  3UVY A;  3IHP A;  2DVR A;  1WIL A;  4TT4 A;  5CUE A;  2MA6 A;  3Q2F A;  2PUY A;  3HCU A;  4QZS A;  2RO1 A;  3ZTG A;  5D3R A;  3S92 A;  1WGM A;  3UVW A;  2RNX A;  5DKC A;  4ALH A;  1MM3 A;  4UYG A;  4WIV A;  4R7E A;  1HYI A;  4YH3 A;  3HCS A;  4C66 A;  4CA1 A;  4QSX A;  5A5R A;  2F6J A;  4B7Y C;  5L99 A;  5HJC A;  3VK6 A;  2N9G A;  5J3X A;  3JVJ A;  4OGI A;  4QR4 A;  4NR5 A;  2WP2 A;  2RFJ A;  3HMH A;  3M62 A;  4IR6 A;  5I7Y A;  1MM2 A;  2YHO A;  4UYE A;  4ZDT A;  3P1E A;  4CLB A;  4O77 A;  5H1V A;  1VD4 A;  2VJF B;  3EB6 A;  4Z93 A;  1E6I A;  5ENB A;  5FH8 A;  3SVG A;  4E96 A;  1X4J A;  3DQV R;  3L11 A;  2R0Y A;  5CUB A;  4F52 B;  2OSS A;  3N9O A;  4TKP B;  4YYK A;  2H0D A;  5KH7 A;  4O7E A;  2LQ6 A;  4N4G A;  3MHH A;  5LJ2 A;  4QF2 A;  2VPE A;  5CUD A;  3MXF A;  3DPL R;  4WZ2 A;  5KH3 A;  4ZQL A;  5I89 A;  5A83 A;  5G0F A;  1F62 A;  3TLP A;  4YC9 A;  2MA5 A;  1VYX A;  2VJE B;  5FER A;  4TU6 A;  4MR5 A;  4O72 A;  4YY4 A;  5I1Q A;  5IGK A;  2KWJ A;  3MB3 A;  5FH6 A;  5C13 A;  3U5N A;  2L75 A;  1HYJ A;  4NYW A;  3NG2 A;  5KTX A;  2G4A A;  5CQ3 A;  4BW3 A;  2KWK A;  3DAI A;  3P1D A;  4YBM A;  5D1M B;  4NRA A;  4J3I A;  1WEV A;  4NYX A;  4A0C D;  2HDP A;  2Y1N A;  4QSP A;  2YYN A;  4XUB A;  1WUM A;  5CUG A;  5AD2 A;  2K17 A;  2KWO A;  5DFD A;  3AAD A;  5TAB A;  5FE1 A;  5F62 A;  5A81 A;  1WEP A;  1WE9 A;  4A9F A;  4BW2 A;  4WHW A;  5D7X A;  5II1 A;  2EOD A;  4NR4 A;  1X4I A;  5CZG A;  2ECG A;  5ENG A;  2MNY A;  4FJC A;  4CCG X;  1FBV A;  4HXS A;  2RNW A;  4X3G A;  5CRZ A;  1WEM A;  2CT2 A;  3ZNI A;  5EPB A;  5FE3 A;  5A5P A;  3RCW A;  4PKL A;  4UIT A;  5AMF A;  4R8P K;  5FB1 A;  2KU3 A;  2FSA A;  4YAB A;  3SVH A;  5I86 A;  3RTR B;  4YYD A;  1Z6U A;  2K1J A;  3GG3 A;  4IOR A;  3MB4 A;  4CFK A;  2VJF A;  2YW8 A;  2I8N A;  4TQN A;  2CKL A;  3O34 A;  4QY4 A;  4A9I A;  2KYU A;  5B77 A;  5BT4 A;  4LRG A;  4WA6 A;  4O7C A;  5EP7 A;  2BAY A;  5CGP A;  4MEN A;  4NRC A;  4A9M A;  2KTB B;  2LRI C;  5D1K B;  5LKT A;  5FB0 A;  4QSS A;  4YAX A;  2MNZ A;  5E3D A;  5AIT A;  5DIN A;  3P5O A;  4UYF B;  4YYI A;  5LVR A;  4IR3 A;  3N9N A;  3HME A;  2L80 A;  4LKA A;  4I7C A;  5EWD A;  4UP0 A;  5LKX A;  2JMD A;  4XYA A;  5LJ0 A;  5I80 A;  4QC1 A;  1N72 A;  5A82 A;  5E7D A;  5ENJ A;  4KV4 A;  3JVL A;  5I3L A;  1WUG A;  2R0V A;  2D8S A;  1EQF A;  4NS5 A;  5CRM A;  3U5M A;  3GV4 A;  3I3J A;  2E7N A;  5F60 A;  5CUA A;  5EIC A;  4IOQ A;  4NUD A;  3ONI A;  3S91 A;  4Z1S A;  5TBN A;  3O7A A;  2YT5 A;  2CSZ A;  2ECN A;  4NN2 A;  5FG4 A;  4LYI A;  4CUR A;  5CS8 A;  2VNF A;  5EQ1 A;  4A4C A;  5I7X A;  4BBQ A;  5TDR A;  2LN0 A;  4XUA A;  1WEU A;  2G6Q A;  1U6G B;  3T7L A;  2K16 A;  4AYC B;  5H9M A;  5E3G A;  5C87 A;  4PCI A;  5DKH A;  5F1H A;  5BT3 A;  2VPG A;  4XY9 A;  3GL6 A;  4MVT A;  4Z1Q A;  4A9H A;  5F36 A;  4TU4 A;  1ZS5 A;  4O74 A;  1F68 A;  2JRJ A;  2MD8 C;  2G43 A;  5CP5 A;  3M63 A;  3KNV A;  2RSD A;  5D24 A;  2YHN A;  5EWC A;  5DLX A;  4UIW A;  5F3A A;  3EB5 A;  1N87 A;  5H1T A;  3L1X A;  4X2I A;  4PTB A;  1LDK C;  2MT5 A;  2L0B A;  2YDW A;  4WHU A;  4CUS A;  4ZUX U;  4V3L C;  5DW1 A;  5L8T A;  4UIY A;  4UIZ A;  5K29 A;  3N9Q A;  2WP1 A;  2G45 A;  4IC3 A;  4QUU A;  4CFL A;  5DYA A;  4MSX A;  5G4S A;  2DAT A;  1X0J A;  2I50 A;  5IBN A;  5EWW A;  2YQD A;  4FLP A;  5C8G A;  5G4R A;  2DX8 A;  2Y43 A;  5E74 A;  4I7B A;  4AP4 A;  5A85 A;  3C6W A;  3JVM A;  5B75 A;  4GNE A;  5FG6 A;  1JSP B;  4BJX A;  2YQL A;  4QST A;  5TB6 A;  3U5J A;  4LR6 A;  4L7X A;  5HRV A;  3DWY A;  3SOW A;  5I29 A;  5F2P A;  2KGG A;  5CY9 A;  4NRB A;  4UIV A;  2LSP B;  4QBM A;  3UVD A;  3N9L A;  3AQA A;  2YW5 A;  4NQN A;  4QR3 A;  2OO1 A;  5DW2 A;  3UV4 A;  3O36 A;  2L84 A;  1LDJ B;  4J0R A;  5E9V A;  5HLS A;  5FEY A;  3RPG B;  3SHB A;  2RS9 B;  5CQ8 A;  5LVQ A;  2JMJ A;  2ECW A;  1JM7 B;  5B78 A;  4LZS A;  2LXP C;  2IDA A;  2DVS A;  1ZBD B;  5D3L A;  4GND A;  4CUT A;  3UVX A;  4QB3 A;  4NUC A;  2LDR A;  2D9E A;  3HMF A;  4HBX A;  2C2V S;  3UW9 A;  4AVX A;  4IR4 A;  4QYL A;  5EU1 A;  4CL9 A;  2YEM A;  4LAD B;  5EM3 A;  2YUR A;  3QZV A;  5IGL A;  4RVR A;  4A9K A;  5KHM A;  3PHD A;  4UIU A;  4YH4 A;  4V3K C;  4O7A A;  4QR5 A;  5B8D A;  3ZVY A;  2QIC A;  5LKU A;  4KCX A;  5L98 A;  1Z60 A;  2LV9 A;  4LC2 A;  2ECI A;  4QSQ A;  4O64 A;  3NXB A;  3U5K A;  4HXL A;  4PCE A;  4NYV A;  5HEL A;  5FG5 A;  4CUQ A;  5CQT A;  4BW4 A;  5EK9 A;  3U5O A;  3UV2 A;  3IU5 A;  1WEE A;  5L97 A;  5TRB A;  2E7O A;  3SOX A;  4BHW A;  3U5L A;  5IG6 A;  2M3H A;  5DFC A;  5DX4 A;  4A9O A;  4A49 A;  5CUC A;  2QJ0 A;  4NXJ A;  5I83 A;  2LGG A;  2M1R A;  5FE8 A;  5E9I A;  5FE6 A;  2MUM A;  2YSJ A;  5EA1 A;  5J0D A;  3O35 A;  4YBS A;  4AUQ B;  5EYA F;  4TTE A;  5EIS A;  3QZT A;  4O71 A;  1K2F A;  5D1L B;  5C7N A;  3QZS A;  2M6M A;  2VJE A;  3Q2E A;  2NAA A;  3G0L A;  5FE2 A;  5LKZ A;  4QYD A; 
#chains in the Genus database with same CATH topology
 3LJW A;  5C11 A;  4P5O B;  2XEU A;  2DWW A;  1JM4 B;  4MEQ A;  5DFB A;  2MD7 B;  2C2L A;  3KV6 A;  5JG6 A;  3SOU A;  4HXK A;  4UYH A;  2FUU A;  3PUR A;  2M13 A;  2CSY A;  2MJV B;  3RPG C;  1JM7 A;  4XI1 A;  5D26 A;  5ENE A;  5F63 A;  5D0C A;  3SUB A;  2NXB A;  4HBV A;  5I40 A;  3MHS A;  2KIZ A;  4GB0 A;  4UI9 B;  4ZC9 A;  1JOC A;  4LYW A;  3I2D A;  3T6R A;  5B79 A;  5FE4 A;  5A7C A;  5D25 A;  4Z6H A;  5DYX A;  5CTL A;  5HFR A;  4QEW A;  5G04 B;  4QQ4 A;  4WZ0 A;  2EGP A;  4QC3 A;  2E3K A;  5D3J A;  5DKD A;  4W4U A;  3K2J A;  4A9J A;  2KKY A;  5IGM A;  5IID A;  5EV9 A;  5EWH A;  5FE0 A;  4HXM A;  4HXR A;  5F5Z A;  2CRR A;  5L96 A;  4Q6F A;  2H0D B;  4GPJ A;  5CQ5 A;  4O7F A;  5L8U A;  5KH9 A;  3ZPV 1;  3LQI A;  3PUQ A;  4QSW A;  2AN6 A;  5CQA A;  5HRX A;  2LGL A;  5D3S A;  4NR6 A;  2QIZ A;  1E4U A;  3E2D A;  5DBM A;  4N4H A;  4TZ8 A;  5C4Q A;  1BOR A;  5SVY A;  5F1L A;  2E6R A;  4YAD A;  3MUL A;  5A5N A;  4J1P A;  3KDE C;  2DKW A;  2L5U A;  1PUO A;  1WEW A;  4O78 A;  4UYF A;  5CFW A;  3G0J A;  3IU6 A;  4Q0O A;  5FBX A;  4UYD A;  3KV5 A;  3M99 A;  5TDW A;  5H1U A;  3FJU B;  3MQM A;  2OUO A;  5CPE A;  4Q0N A;  5ETB A;  2F42 A;  3FAO A;  2ECT A;  5HCL A;  3P1C A;  3P1F A;  5FH7 A;  2UZG A;  4MR6 A;  5D3P A;  5KO4 A;  2KRE A;  2E6S A;  4FO9 A;  5AD3 A;  5A5O A;  5ACY A;  3HTK C;  4YYG A;  4R2Y A;  3L1Z B;  5A5S A;  2ECV A;  2PNX A;  4TS8 A;  3O33 A;  2CRW A;  2YEK A;  4YYJ A;  3FKM X;  5FDZ A;  5FFW A;  5CU8 A;  5COI A;  2JMI A;  3D7C A;  1MBM A;  5CQ4 A;  2F6N A;  4LZ2 A;  1IYM A;  5FFY A;  1XWH A;  5D3T A;  4I7D A;  5E9K A;  1WEN A;  3LVQ E;  2RNY A;  1V87 A;  1WEO A;  2KGI A;  5FE7 A;  2CKL B;  4AYC A;  5D3H A;  3N9M A;  2GRC A;  4YBT A;  1X4U A;  4O70 A;  2VPB A;  5II2 A;  5EVA A;  4HXO A;  5ENF A;  3U5P A;  5DY7 A;  5CQ6 A;  4TT2 A;  2L5E A;  4YK0 A;  5FE5 A;  5FE9 A;  4UIX A;  4A9E A;  2YRE A;  4OUF A;  4S3O B;  2KKX A;  4A9N A;  2R10 A;  3D1B A;  5E9Y A;  5FFV A;  4A9L A;  3DWD A;  4C9Z A;  3JUE A;  4O76 A;  5F25 A;  2RR4 A;  4N4I A;  2YQM A;  4AKN A;  2EA6 A;  2L85 A;  1DVP A;  4TT6 A;  4L58 A;  2I7K A;  1G25 A;  5H85 A;  5KU3 A;  2YUC A;  5C85 A;  5IGN A;  3ASL A;  5G05 B;  4LK9 A;  5LJ1 A;  4YYN A;  3O37 A;  4ZW1 A;  2XB1 A;  4UP5 A;  1WEQ A;  2YU4 A;  4IR5 A;  4MEO A;  4QSV A;  5HEM A;  2R0S A;  4CUP A;  5ENI A;  2MIQ A;  1RMD A;  2KFT A;  5AIU A;  2DSM A;  4NQM A;  5HQ7 A;  5ENH A;  4PS5 A;  2OXQ C;  3LQH A;  3M7K A;  4LDF A;  2K4D A;  4YY6 A;  5HRW A;  4ALG A;  5ETD A;  5HQ5 A;  5EGU A;  4LJN A;  2FUI A;  4NR9 A;  2HYE D;  5EPS A;  5C89 A;  4HBY A;  4FIP A;  4FK5 A;  4MR4 A;  4LYS A;  5A5Q A;  4YAT A;  2LGK A;  4GNF A;  5E9M A;  4QEV A;  2MKE A;  2DVV A;  4IC2 A;  4O7B A;  2LXH C;  3HCT A;  2M85 A;  5DKA A;  4Y03 A;  4AKI A;  1WIM A;  4IOO A;  2YSM A;  4QSR A;  4LZR A;  4HXP A;  4TYL A;  4BW1 A;  2D82 A;  4N4F A;  5CQ7 A;  1CHC A;  5AME A;  4C67 A;  2Y1M A;  5HM0 A;  4YYM A;  5KTU A;  3C5K A;  3ZYU A;  4Z6I A;  4PPE A;  3V43 A;  4A4B A;  5E0R A;  4CUU A;  4DON A;  5DLZ A;  1T1H A;  5HFQ A;  2E61 A;  4TZ2 A;  4QNS A;  5D3N A;  4XY8 A;  4S3O C;  4QUT A;  5DYC A;  3N9P A;  3LDY A;  4V3K C;  4QSU A;  5EI4 A;  5JI8 A;  4QEU A;  3O70 A;  4J0S A;  2ZET C;  4F3I A;  5LCW B;  3O47 A;  5HQ6 A;  5LUU A;  3ZYQ A;  5DYU A;  4HXN A;  5I88 A;  2VPD A;  2H60 A;  5KTW A;  2KE1 A;  2KR4 A;  2YEL A;  5TCM A;  4NUE A;  4OGJ A;  3LRQ A;  5EPR A;  4WZ3 B;  3LXJ A;  2KWN A;  3ERR A;  3UV5 A;  4MR3 A;  2ECJ A;  3ZVZ B;  4HBW A;  4NR7 A;  3KQI A;  1FP0 A;  5EWV A;  1WFK A;  3MUK A;  4GNG A;  3JVK A;  4QF3 A;  4MEP A;  4KV1 A;  4O75 A;  1VFY A;  2L43 A;  2YYR A;  4O62 A;  3SVF A;  4NR8 A;  5E73 A;  2VP7 A;  2RI7 A;  5BT5 A;  4LLB A;  1Z2Q A;  4N3W A;  5F61 A;  3LQJ A;  3FL2 A;  2DVQ A;  4PY6 A;  1WES A;  2OWA A;  5ENC A;  2LGV A;  3ZPV E;  2FD4 A;  5HEN A;  5B76 A;  4YYH A;  4OGE A;  5JWM A;  5E9L A;  3UVY A;  3IHP A;  2DVR A;  3MDB C;  1WIL A;  4TT4 A;  5CUE A;  2MA6 A;  3Q2F A;  2PUY A;  3HCU A;  4QZS A;  2RO1 A;  3ZTG A;  5D3R A;  3S92 A;  1WGM A;  3UVW A;  2RNX A;  5DKC A;  3FM8 C;  4ALH A;  1MM3 A;  4UYG A;  4WIV A;  4R7E A;  1HYI A;  4YH3 A;  3HCS A;  4C66 A;  4CA1 A;  4QSX A;  5A5R A;  2F6J A;  4B7Y C;  5L99 A;  5HJC A;  3VK6 A;  2N9G A;  5J3X A;  3JVJ A;  4OGI A;  4QR4 A;  4NR5 A;  2WP2 A;  2RFJ A;  3HMH A;  3M62 A;  4IR6 A;  5I7Y A;  1MM2 A;  2YHO A;  4UYE A;  4ZDT A;  3P1E A;  4CLB A;  4O77 A;  5H1V A;  4Z0R A;  1VD4 A;  2VJF B;  3EB6 A;  4Z93 A;  1E6I A;  5ENB A;  5FH8 A;  3SVG A;  4E96 A;  1X4J A;  3DQV R;  3L11 A;  2R0Y A;  5CUB A;  4F52 B;  2OSS A;  3N9O A;  4TKP B;  4YYK A;  2B0O E;  2H0D A;  5KH7 A;  4O7E A;  2LQ6 A;  4N4G A;  3MHH A;  5LJ2 A;  4QF2 A;  2VPE A;  5CUD A;  3MXF A;  3DPL R;  4WZ2 A;  5KH3 A;  4ZQL A;  5I89 A;  5A83 A;  5G0F A;  1F62 A;  3TLP A;  4YC9 A;  2MA5 A;  1VYX A;  2VJE B;  5FER A;  3VKH A;  4TU6 A;  4MR5 A;  4O72 A;  4YY4 A;  5I1Q A;  5IGK A;  2KWJ A;  3MB3 A;  5FH6 A;  5C13 A;  3U5N A;  2L75 A;  1HYJ A;  4NYW A;  3NG2 A;  4AKG A;  5KTX A;  2G4A A;  5CQ3 A;  4BW3 A;  2XOZ A;  2KWK A;  3DAI A;  3P1D A;  4YBM A;  5D1M B;  4NRA A;  4J3I A;  1WEV A;  4NYX A;  4A0C D;  2HDP A;  2Y1N A;  4QSP A;  2YYN A;  4XUB A;  1WUM A;  5CUG A;  5AD2 A;  2K17 A;  2KWO A;  5DFD A;  3AAD A;  5TAB A;  5FE1 A;  5F62 A;  5A81 A;  1WEP A;  1WE9 A;  4A9F A;  4BW2 A;  4WHW A;  5D7X A;  5II1 A;  2EOD A;  4NR4 A;  1X4I A;  5CZG A;  2D8U A;  5SVX A;  2ECG A;  5ENG A;  2MNY A;  4FJC A;  4CCG X;  1FBV A;  4HXS A;  2RNW A;  4X3G A;  5CRZ A;  1WEM A;  2CT2 A;  3ZNI A;  5EPB A;  5FE3 A;  5A5P A;  3RCW A;  4PKL A;  4UIT A;  5AMF A;  4R8P K;  3DDT A;  5FB1 A;  2KU3 A;  2FSA A;  3LVR E;  4YAB A;  3SVH A;  5I86 A;  3RTR B;  4YYD A;  1DCQ A;  1Z6U A;  2K1J A;  3H7H A;  3GG3 A;  4IOR A;  3MB4 A;  4CFK A;  2VJF A;  2YW8 A;  2I8N A;  4TQN A;  2CKL A;  3O34 A;  4QY4 A;  4A9I A;  2KYU A;  3T9K A;  5B77 A;  5BT4 A;  4LRG A;  4WA6 A;  4O7C A;  5EP7 A;  2BAY A;  3FAN A;  5CGP A;  4MEN A;  4NRC A;  4A9M A;  2KTB B;  2LRI C;  5D1K B;  5LKT A;  5FB0 A;  4QSS A;  4YAX A;  2MNZ A;  1ZKR A;  5E3D A;  5AIT A;  5DIN A;  3P5O A;  4UYF B;  4YYI A;  5LVR A;  4IR3 A;  3N9N A;  4F1P A;  3HME A;  2L80 A;  2XP0 A;  2YVR A;  4LKA A;  4I7C A;  5K3Q A;  5EWD A;  4UP0 A;  5LKX A;  2JMD A;  4XYA A;  5LJ0 A;  5I80 A;  4QC1 A;  1N72 A;  5A82 A;  5E7D A;  5ENJ A;  4OGC A;  4KV4 A;  3JVL A;  5I3L A;  1WUG A;  2R0V A;  2D8S A;  1EQF A;  4NS5 A;  5CRM A;  3U5M A;  3GV4 A;  3I3J A;  2E7N A;  5F60 A;  5CUA A;  5EIC A;  4IOQ A;  4NUD A;  3ONI A;  3S91 A;  4Z1S A;  5TBN A;  3O7A A;  2YT5 A;  2CSZ A;  4AKH A;  2ECN A;  4NN2 A;  5FG4 A;  4LYI A;  4CUR A;  2JM3 A;  5CS8 A;  2VNF A;  5EQ1 A;  4A4C A;  5I7X A;  4BBQ A;  5TDR A;  2LN0 A;  4XUA A;  3PLW A;  1WEU A;  2G6Q A;  1U6G B;  3T7L A;  2K16 A;  4AYC B;  5H9M A;  5E3G A;  5C87 A;  4PCI A;  5DKH A;  5F1H A;  5BT3 A;  2VPG A;  4XY9 A;  3GL6 A;  4MVT A;  4Z1Q A;  4A9H A;  5F36 A;  4TU4 A;  1ZS5 A;  4O74 A;  4B86 C;  1F68 A;  2JRJ A;  2MD8 C;  2G43 A;  5CP5 A;  3M63 A;  3KNV A;  2P57 A;  2RSD A;  5D24 A;  2YHN A;  3FEH A;  5EWC A;  5DLX A;  4UIW A;  5F3A A;  2LAU A;  4Z0O A;  2EGM A;  3EB5 A;  1N87 A;  5H1T A;  3L1X A;  4X2I A;  4PTB A;  1LDK C;  2MT5 A;  5SVI B;  2L0B A;  2YDW A;  4WHU A;  4CUS A;  4ZUX U;  4V3L C;  2CSV A;  5DW1 A;  2IQJ A;  5L8T A;  4UIY A;  2FFW A;  4UIZ A;  5K29 A;  3N9Q A;  2WP1 A;  2EJN A;  2G45 A;  4IC3 A;  4QUU A;  4CFL A;  5DYA A;  4MSX A;  5G4S A;  2DAT A;  1X0J A;  2I50 A;  5IBN A;  3VKG A;  5EWW A;  2YQD A;  4FLP A;  5C8G A;  5G4R A;  2DX8 A;  2Y43 A;  5E74 A;  4I7B A;  4AP4 A;  5A85 A;  3C6W A;  3JVM A;  5B75 A;  4GNE A;  5FG6 A;  1JSP B;  4BJX A;  2YQL A;  2JUN A;  3Q1D A;  4QST A;  2L7P A;  4H9D A;  5TB6 A;  3U5J A;  4LR6 A;  2DJA A;  4L7X A;  5HRV A;  3DWY A;  3SOW A;  5I29 A;  5F2P A;  2KGG A;  5CY9 A;  4NRB A;  4UIV A;  2LSP B;  4QBM A;  3UVD A;  3N9L A;  3AQA A;  2YW5 A;  4NQN A;  4QR3 A;  2OO1 A;  5DW2 A;  3UV4 A;  3O36 A;  2L84 A;  1LDJ B;  4J0R A;  5E9V A;  5HLS A;  5FEY A;  3RPG B;  3SHB A;  2RS9 B;  5CQ8 A;  5LVQ A;  2JMJ A;  2ECW A;  1JM7 B;  5B78 A;  4LZS A;  2LXP C;  2IDA A;  2DVS A;  1ZBD B;  3D1D A;  5D3L A;  4GND A;  4CUT A;  3UVX A;  4QB3 A;  4NUC A;  2LDR A;  2D9E A;  3HMF A;  4HBX A;  2C2V S;  3UW9 A;  4AVX A;  4IR4 A;  4QYL A;  5EU1 A;  4CL9 A;  2YEM A;  4LAD B;  5EM3 A;  2YUR A;  3QZV A;  5IGL A;  4RVR A;  4A9K A;  5KHM A;  3LJU X;  4UIU A;  4YH4 A;  2EXU A;  4O7A A;  4QR5 A;  3PHD A;  5B8D A;  3ZVY A;  5SVI A;  2QIC A;  5LKU A;  4KCX A;  5L98 A;  1Z60 A;  2LV9 A;  4LC2 A;  2ECI A;  4QSQ A;  2CON A;  4O64 A;  3NXB A;  3U5K A;  4HXL A;  4PCE A;  4NYV A;  5HEL A;  5FG5 A;  4CUQ A;  5CQT A;  4AI6 A;  4BW4 A;  5EK9 A;  3U5O A;  3UV2 A;  3IU5 A;  1WEE A;  5L97 A;  5TRB A;  2E7O A;  3SOX A;  4BHW A;  3U5L A;  2XOC A;  5IG6 A;  2M3H A;  5DFC A;  5DX4 A;  4A9O A;  2XOY A;  4A49 A;  5CUC A;  2QJ0 A;  4NXJ A;  5I83 A;  2LGG A;  2M1R A;  5FE8 A;  5E9I A;  5FE6 A;  2MUM A;  2YSJ A;  5EA1 A;  5J0D A;  3O35 A;  4YBS A;  4AUQ B;  5EYA F;  4TTE A;  5EIS A;  3QZT A;  4O71 A;  1K2F A;  5D1L B;  5C7N A;  3QZS A;  2M6M A;  2VJE A;  3Q2E A;  2NAA A;  3G0L A;  5FE2 A;  5LKZ A;  4QYD A; 
#chains in the Genus database with same CATH homology
 3LJW A;  5C11 A;  4P5O B;  2XEU A;  2DWW A;  1JM4 B;  4MEQ A;  5DFB A;  2MD7 B;  2C2L A;  3KV6 A;  5JG6 A;  3SOU A;  4HXK A;  4UYH A;  2FUU A;  3PUR A;  2CSY A;  2MJV B;  3RPG C;  1JM7 A;  4XI1 A;  5D26 A;  5ENE A;  5F63 A;  5D0C A;  2NXB A;  4HBV A;  5I40 A;  3MHS A;  2KIZ A;  4GB0 A;  4UI9 B;  4ZC9 A;  1JOC A;  4LYW A;  3I2D A;  3T6R A;  5B79 A;  5FE4 A;  5A7C A;  5D25 A;  4Z6H A;  5DYX A;  5CTL A;  5HFR A;  4QEW A;  5G04 B;  4WZ0 A;  2EGP A;  4QC3 A;  2E3K A;  5D3J A;  5DKD A;  4W4U A;  3K2J A;  4A9J A;  4B86 C;  5IGM A;  5IID A;  5EV9 A;  5EWH A;  5FE0 A;  4HXM A;  4HXR A;  5F5Z A;  4Q6F A;  5L96 A;  2H0D B;  4GPJ A;  5CQ5 A;  4O7F A;  5L8U A;  5KH9 A;  3ZPV 1;  3LQI A;  3PUQ A;  4QSW A;  2AN6 A;  5CQA A;  5HRX A;  2LGL A;  5D3S A;  4NR6 A;  2QIZ A;  1E4U A;  5DBM A;  4N4H A;  4TZ8 A;  5C4Q A;  1BOR A;  5F1L A;  2E6R A;  4YAD A;  3MUL A;  5A5N A;  4J1P A;  2DKW A;  2L5U A;  1WEW A;  4O78 A;  4UYF A;  5CFW A;  3G0J A;  3IU6 A;  4Q0O A;  5FBX A;  4UYD A;  3KV5 A;  3M99 A;  5TDW A;  5H1U A;  3MQM A;  2OUO A;  5CPE A;  4Q0N A;  5ETB A;  2F42 A;  2ECT A;  5HCL A;  3P1C A;  3P1F A;  5FH7 A;  2UZG A;  4MR6 A;  5D3P A;  5KO4 A;  2KRE A;  2E6S A;  4FO9 A;  5AD3 A;  5A5O A;  5ACY A;  3HTK C;  4YYG A;  4R2Y A;  3L1Z B;  5A5S A;  2ECV A;  2PNX A;  3O33 A;  4TS8 A;  2YEK A;  4YYJ A;  3FKM X;  5FDZ A;  5FFW A;  5CU8 A;  5COI A;  2JMI A;  3D7C A;  5CQ4 A;  2F6N A;  4LZ2 A;  1IYM A;  5FFY A;  1XWH A;  5D3T A;  4I7D A;  5E9K A;  1WEN A;  2RNY A;  1V87 A;  1WEO A;  2KGI A;  5FE7 A;  2CKL B;  4AYC A;  5D3H A;  3N9M A;  2GRC A;  4YBT A;  1X4U A;  4O70 A;  2VPB A;  5II2 A;  5EVA A;  4HXO A;  5ENF A;  3U5P A;  5DY7 A;  5CQ6 A;  4TT2 A;  2L5E A;  4YK0 A;  5FE5 A;  5FE9 A;  4UIX A;  4A9E A;  2YRE A;  4OUF A;  4S3O B;  4A9N A;  2R10 A;  5E9Y A;  5FFV A;  4A9L A;  4C9Z A;  4O76 A;  5F25 A;  4N4I A;  2YQM A;  4AKN A;  2EA6 A;  2L85 A;  1DVP A;  4TT6 A;  4L58 A;  2I7K A;  1G25 A;  5H85 A;  5KU3 A;  2YUC A;  5C85 A;  5IGN A;  3ASL A;  5G05 B;  4LK9 A;  5LJ1 A;  4YYN A;  3O37 A;  4ZW1 A;  2XB1 A;  4UP5 A;  1WEQ A;  2YU4 A;  4IR5 A;  4MEO A;  4QSV A;  5HEM A;  2R0S A;  4CUP A;  5ENI A;  2MIQ A;  1RMD A;  2KFT A;  5AIU A;  4NQM A;  5HQ7 A;  5ENH A;  4PS5 A;  2OXQ C;  3LQH A;  4LDF A;  2K4D A;  4YY6 A;  5HRW A;  4ALG A;  5ETD A;  5HQ5 A;  5EGU A;  4LJN A;  2FUI A;  4NR9 A;  2HYE D;  5EPS A;  5C89 A;  4HBY A;  4FIP A;  4FK5 A;  4MR4 A;  4LYS A;  5A5Q A;  4YAT A;  2LGK A;  4GNF A;  5E9M A;  4QEV A;  2DVV A;  4IC2 A;  4O7B A;  2LXH C;  3HCT A;  2M85 A;  5DKA A;  4Y03 A;  1WIM A;  4IOO A;  2YSM A;  4QSR A;  4LZR A;  4HXP A;  4TYL A;  4BW1 A;  2D82 A;  4N4F A;  5CQ7 A;  1CHC A;  5AME A;  4C67 A;  2Y1M A;  5HM0 A;  4YYM A;  5KTU A;  3C5K A;  3ZYU A;  4Z6I A;  4PPE A;  3V43 A;  4A4B A;  5E0R A;  4CUU A;  4DON A;  5DLZ A;  1T1H A;  5HFQ A;  4TZ2 A;  4QNS A;  5D3N A;  4XY8 A;  4S3O C;  4QUT A;  5DYC A;  3N9P A;  4QSU A;  5EI4 A;  5JI8 A;  4QEU A;  3O70 A;  4J0S A;  2ZET C;  4F3I A;  5LCW B;  5HQ6 A;  5LUU A;  3ZYQ A;  5DYU A;  4HXN A;  5I88 A;  2VPD A;  2H60 A;  5KTW A;  2KE1 A;  2KR4 A;  2YEL A;  5TCM A;  4NUE A;  4OGJ A;  3LRQ A;  5EPR A;  4WZ3 B;  3LXJ A;  2KWN A;  3UV5 A;  4MR3 A;  2ECJ A;  3ZVZ B;  4HBW A;  4NR7 A;  3KQI A;  1FP0 A;  5EWV A;  1WFK A;  3MUK A;  4GNG A;  3JVK A;  4QF3 A;  4MEP A;  4KV1 A;  4O75 A;  1VFY A;  2L43 A;  2YYR A;  3SVF A;  4NR8 A;  5E73 A;  2VP7 A;  2RI7 A;  5BT5 A;  4LLB A;  1Z2Q A;  4N3W A;  5F61 A;  3LQJ A;  3FL2 A;  2DVQ A;  4PY6 A;  1WES A;  5ENC A;  2LGV A;  3ZPV E;  5HEN A;  5B76 A;  4YYH A;  5JWM A;  5E9L A;  3UVY A;  3IHP A;  2DVR A;  1WIL A;  4TT4 A;  5CUE A;  2MA6 A;  3Q2F A;  2PUY A;  3HCU A;  4QZS A;  2RO1 A;  3ZTG A;  5D3R A;  3S92 A;  1WGM A;  3UVW A;  2RNX A;  5DKC A;  4ALH A;  1MM3 A;  4UYG A;  4WIV A;  4R7E A;  1HYI A;  4YH3 A;  3HCS A;  4C66 A;  4CA1 A;  4QSX A;  5A5R A;  2F6J A;  4B7Y C;  5L99 A;  5HJC A;  3VK6 A;  2N9G A;  5J3X A;  3JVJ A;  4OGI A;  4QR4 A;  4NR5 A;  2WP2 A;  2RFJ A;  3HMH A;  3M62 A;  4IR6 A;  5I7Y A;  1MM2 A;  2YHO A;  4UYE A;  4ZDT A;  3P1E A;  4CLB A;  4O77 A;  5H1V A;  1VD4 A;  2VJF B;  3EB6 A;  4Z93 A;  1E6I A;  5ENB A;  5FH8 A;  3SVG A;  4E96 A;  1X4J A;  3DQV R;  3L11 A;  2R0Y A;  5CUB A;  4F52 B;  2OSS A;  3N9O A;  4TKP B;  4YYK A;  2H0D A;  5KH7 A;  4O7E A;  2LQ6 A;  4N4G A;  3MHH A;  5LJ2 A;  4QF2 A;  2VPE A;  5CUD A;  3MXF A;  3DPL R;  4WZ2 A;  5KH3 A;  4ZQL A;  5I89 A;  5A83 A;  5G0F A;  1F62 A;  3TLP A;  4YC9 A;  2MA5 A;  1VYX A;  2VJE B;  5FER A;  4TU6 A;  4MR5 A;  4O72 A;  4YY4 A;  5I1Q A;  5IGK A;  2KWJ A;  3MB3 A;  5FH6 A;  5C13 A;  3U5N A;  2L75 A;  1HYJ A;  4NYW A;  3NG2 A;  5KTX A;  2G4A A;  5CQ3 A;  4BW3 A;  2KWK A;  3DAI A;  3P1D A;  4YBM A;  5D1M B;  4NRA A;  4J3I A;  1WEV A;  4NYX A;  4A0C D;  2HDP A;  2Y1N A;  4QSP A;  2YYN A;  4XUB A;  1WUM A;  5CUG A;  5AD2 A;  2K17 A;  2KWO A;  5DFD A;  3AAD A;  5TAB A;  5FE1 A;  5F62 A;  5A81 A;  1WEP A;  1WE9 A;  4A9F A;  4BW2 A;  4WHW A;  5D7X A;  5II1 A;  2EOD A;  4NR4 A;  1X4I A;  5CZG A;  2ECG A;  5ENG A;  2MNY A;  4FJC A;  4CCG X;  1FBV A;  4HXS A;  2RNW A;  4X3G A;  5CRZ A;  1WEM A;  2CT2 A;  3ZNI A;  5EPB A;  5FE3 A;  5A5P A;  3RCW A;  4PKL A;  4UIT A;  5AMF A;  4R8P K;  5FB1 A;  2KU3 A;  2FSA A;  4YAB A;  3SVH A;  5I86 A;  3RTR B;  4YYD A;  1Z6U A;  2K1J A;  3GG3 A;  4IOR A;  3MB4 A;  4CFK A;  2VJF A;  2YW8 A;  2I8N A;  4TQN A;  2CKL A;  3O34 A;  4QY4 A;  4A9I A;  2KYU A;  5B77 A;  5BT4 A;  4LRG A;  4WA6 A;  4O7C A;  5EP7 A;  2BAY A;  5CGP A;  4MEN A;  4NRC A;  4A9M A;  2KTB B;  2LRI C;  5D1K B;  5LKT A;  5FB0 A;  4QSS A;  4YAX A;  2MNZ A;  5E3D A;  5AIT A;  5DIN A;  3P5O A;  4UYF B;  4YYI A;  5LVR A;  4IR3 A;  3N9N A;  3HME A;  2L80 A;  4LKA A;  4I7C A;  5EWD A;  4UP0 A;  5LKX A;  2JMD A;  4XYA A;  5LJ0 A;  5I80 A;  4QC1 A;  1N72 A;  5A82 A;  5E7D A;  5ENJ A;  4KV4 A;  3JVL A;  5I3L A;  1WUG A;  2R0V A;  2D8S A;  1EQF A;  4NS5 A;  5CRM A;  3U5M A;  3GV4 A;  3I3J A;  2E7N A;  5F60 A;  5CUA A;  5EIC A;  4IOQ A;  4NUD A;  3ONI A;  3S91 A;  4Z1S A;  5TBN A;  3O7A A;  2YT5 A;  2CSZ A;  2ECN A;  4NN2 A;  5FG4 A;  4LYI A;  4CUR A;  5CS8 A;  2VNF A;  5EQ1 A;  4A4C A;  5I7X A;  4BBQ A;  5TDR A;  2LN0 A;  4XUA A;  1WEU A;  2G6Q A;  1U6G B;  3T7L A;  2K16 A;  4AYC B;  5H9M A;  5E3G A;  5C87 A;  4PCI A;  5DKH A;  5F1H A;  5BT3 A;  2VPG A;  4XY9 A;  3GL6 A;  4MVT A;  4Z1Q A;  4A9H A;  5F36 A;  4TU4 A;  1ZS5 A;  4O74 A;  1F68 A;  2JRJ A;  2MD8 C;  2G43 A;  5CP5 A;  3M63 A;  3KNV A;  2RSD A;  5D24 A;  2YHN A;  5EWC A;  5DLX A;  4UIW A;  5F3A A;  3EB5 A;  1N87 A;  5H1T A;  3L1X A;  4X2I A;  4PTB A;  1LDK C;  2MT5 A;  2L0B A;  2YDW A;  4WHU A;  4CUS A;  4ZUX U;  4V3L C;  5DW1 A;  5L8T A;  4UIY A;  4UIZ A;  5K29 A;  3N9Q A;  2WP1 A;  2G45 A;  4IC3 A;  4QUU A;  4CFL A;  5DYA A;  4MSX A;  5G4S A;  2DAT A;  1X0J A;  2I50 A;  5IBN A;  5EWW A;  2YQD A;  4FLP A;  5C8G A;  5G4R A;  2DX8 A;  2Y43 A;  5E74 A;  4I7B A;  4AP4 A;  5A85 A;  3C6W A;  3JVM A;  5B75 A;  4GNE A;  5FG6 A;  1JSP B;  4BJX A;  2YQL A;  4QST A;  5TB6 A;  3U5J A;  4LR6 A;  4L7X A;  5HRV A;  3DWY A;  3SOW A;  5I29 A;  5F2P A;  2KGG A;  5CY9 A;  4NRB A;  4UIV A;  2LSP B;  4QBM A;  3UVD A;  3N9L A;  3AQA A;  2YW5 A;  4NQN A;  4QR3 A;  2OO1 A;  5DW2 A;  3UV4 A;  3O36 A;  2L84 A;  1LDJ B;  4J0R A;  5E9V A;  5HLS A;  5FEY A;  3RPG B;  3SHB A;  2RS9 B;  5CQ8 A;  5LVQ A;  2JMJ A;  2ECW A;  1JM7 B;  5B78 A;  4LZS A;  2LXP C;  2IDA A;  2DVS A;  1ZBD B;  5D3L A;  4GND A;  4CUT A;  3UVX A;  4QB3 A;  4NUC A;  2LDR A;  2D9E A;  3HMF A;  4HBX A;  2C2V S;  3UW9 A;  4AVX A;  4IR4 A;  4QYL A;  5EU1 A;  4CL9 A;  2YEM A;  4LAD B;  5EM3 A;  2YUR A;  3QZV A;  5IGL A;  4RVR A;  4A9K A;  5KHM A;  3PHD A;  4UIU A;  4YH4 A;  4V3K C;  4O7A A;  4QR5 A;  5B8D A;  3ZVY A;  2QIC A;  5LKU A;  4KCX A;  5L98 A;  1Z60 A;  2LV9 A;  4LC2 A;  2ECI A;  4QSQ A;  4O64 A;  3NXB A;  3U5K A;  4HXL A;  4PCE A;  4NYV A;  5HEL A;  5FG5 A;  4CUQ A;  5CQT A;  4BW4 A;  5EK9 A;  3U5O A;  3UV2 A;  3IU5 A;  1WEE A;  5L97 A;  5TRB A;  2E7O A;  3SOX A;  4BHW A;  3U5L A;  5IG6 A;  2M3H A;  5DFC A;  5DX4 A;  4A9O A;  4A49 A;  5CUC A;  2QJ0 A;  4NXJ A;  5I83 A;  2LGG A;  2M1R A;  5FE8 A;  5E9I A;  5FE6 A;  2MUM A;  2YSJ A;  5EA1 A;  5J0D A;  3O35 A;  4YBS A;  4AUQ B;  5EYA F;  4TTE A;  5EIS A;  3QZT A;  4O71 A;  1K2F A;  5D1L B;  5C7N A;  3QZS A;  2M6M A;  2VJE A;  3Q2E A;  2NAA A;  3G0L A;  5FE2 A;  5LKZ A;  4QYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...