3RPGB

Bmi1/ring1b-ubch5c complex structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
b'RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rpgB00
2LDRA 3M62A 3LQJA 2KREA 1LDJB 2CSYA 3ZPVE 2ECGA 5TDWA 2KR4A 4AYCB 2LQ6A 4QF2A 5G04B 2KWOA 2HDPA 2YHOA 1WESA 4LJNA 5B75A 2H0DA 2KGIA 5D1KB 3SOXA 3L11A 4A49A 1WIMA 2G43A 2VPGA 4YBMA 2YQLA 2MT5A 1HYIA 5B76A 4LLBA 4FO9A 3N9NA 5KH7A 2VJEB 4ZDTA 3O33A 1G25A 2EA6A 2KIZA 4NN2A 1V87A 2OXQC 5D1MB 2ZETC 4TKPB 4P5OB 3L1ZB 2L80A 1E4UA 3EB6A 2VPDA 2VP7A 1WEVA 3N9LA 3C5KA 1N87A 4L7XA 1FP0A 1HYJA 2VPEA 2F42A 3EB5A 5TRBA 3ZNIA 1X4UA 2CT2A 4N4FA 4A4BA 2MA5A 1MM3A 4A4CA 2FUIA 5H1VA 2PNXA 1Z6UA 5B79A 4IC3A 3HTKC 2VJFA 4GNGA 2K17A 1IYMA 4AVXA 3LQIA 2MIQA 3SOWA 1XWHA 1JM7B 4B7YC 2K16A 2M1RA 3MHSA 4YATA 2M3HA 4O64A 4ZUXU 2MD8C 5JG6A 3MHHA 3U5PA 4MVTA 2Y1NA 4N3WA 5J3XA 3M99A 2L43A 3ZYQA 2RI7A 2YREA 3U5MA 2YHNA 5B77A 4BHWA 1WEQA 4MSXA 2LN0A 4W4UA 1K2FA 1CHCA 1WEPA 4UP0A 3N9QA 2CKLA 2YSMA 2LGLA 2UZGA 2Y1MA 3O34A 3M63A 4I7BA 2EODA 5B8DA 5G0FA 5TDRA 2LXPC 2EGPA 1LDKC 2E6RA 3LRQA 1WFKA 5LKZA 4CCGX 5H1TA 2FUUA 2YSJA 5LKTA 4LADB 5C11A 3HCSA 4AYCA 2C2VS 3IHPA 3V43A 2CSZA 5TBNA 2KWKA 3O37A 3O35A 2M6MA 5KH3A 2H0DB 2ECNA 2IDAA 2D8SA 2JMJA 3ZVYA 5FEYA 2ECIA 4AP4A 2YURA 1VFYA 4FJCA 2RSDA 3L1XA 3VK6A 4B86C 2QICA 4BBQA 2C2LA 4UI9B 4FK5A 3ZTGA 3O70A 2G6QA 2YU4A 3N9MA 3RPGC 2LRIC 1X4JA 3PUQA 4X3GA 2MNYA 1WILA 2YT5A 3GL6A 4PPEA 1WEMA 4I7DA 5DINA 5AIUA 3N9PA 4I7CA 1Z60A 2AN6A 2KWJA 3SOUA 2KGGA 3HCUA 1Z2QA 2VJFB 1JM7A 3ASLA 2JRJA 2LGVA 2YQMA 2L0BA 5KH9A 5G05B 4Q6FA 5DKAA 2MA6A 1WEOA 2BAYA 4FIPA 3U5OA 3FL2A 3O7AA 3GV4A 5TABA 3KQIA 2FSAA 2KYUA 5H1UA 4YABA 2ECTA 3O36A 5LKXA 3T6RA 2LGKA 2YYRA 2DX8A 4V3KC 2CKLB 4WZ3B 4YAXA 1VD4A 1BORA 4S3OC 1ZBDB 2NAAA 3N9OA 3I2DA 2ECWA 3ZVZB 3QZVA 2F6JA 4GB0A 2MD7B 2YW8A 4LK9A 5FB1A 4R8PK 2QIZA 5LCWB 4ZQLA 3PHDA 5B78A 2VJEA 3NG2A 5LKUA 4R2YA 2I50A 4WZ0A 1U6GB 2F6NA 2M85A 2LXHC 5I3LA 1T1HA 3RPGB 5FB0A 2ECVA 3U5NA 2KE1A 4YC9A 4CA1A 3KNVA 4QF3A 3T7LA 2QJ0A 2HYED 1WGMA 2XEUA 5D1LB 4A0CD 3DQVR 4V3LC 2L5UA 2Y43A 2PUYA 2K4DA 5FERA 5EYAF 4C9ZA 4YBSA 3PURA 4GNFA 1WE9A 4WZ2A 2XB1A 2KFTA 2MUMA 4XI1A 4R7EA 2ECJA 1X4IA 2G45A 2YUCA 2K1JA 4L58A 1JOCA 2JMDA 4IC2A 1FBVA 4WA6A 1RMDA 4GNDA 4LKAA 2E6SA 1VYXA 3LQHA 3ZPV1 4GNEA 3KV5A 4UP5A 4F52B 1MM2A 3RTRB 5C13A 2LGGA 1WEUA 2L75A 1F62A 2VPBA 3HCTA 2KU3A 4AUQB 3C6WA 2LV9A 4PTBA 3SHBA 1WEWA 2MNZA 4YADA 3KV6A 3DPLR 4YBTA 2VNFA 1DVPA 2KWNA 1WENA 2JMIA 4S3OB 5AITA 1WEEA 5H9MA
chains in the Genus database with same CATH superfamily
2LDRA 3M62A 3LQJA 2KREA 1LDJB 2CSYA 3ZPVE 2ECGA 5TDWA 2KR4A 4AYCB 2LQ6A 4QF2A 5G04B 2KWOA 2HDPA 2YHOA 3SUBA 1WESA 4LJNA 5B75A 2H0DA 2KGIA 5D1KB 4OGCA 3L11A 3SOXA 4A49A 1WIMA 2G43A 2VPGA 4YBMA 2XOZA 2YQLA 3Q1DA 2MT5A 1HYIA 3LVQE 2CONA 5B76A 4LLBA 4FO9A 3N9NA 5KH7A 2VJEB 4ZDTA 3O33A 1G25A 2EA6A 2KIZA 4NN2A 1V87A 2OXQC 4OGEA 5D1MB 2ZETC 2IQJA 4TKPB 4P5OB 3L1ZB 2L80A 2XP0A 1E4UA 3EB6A 2VPDA 2VP7A 1WEVA 3N9LA 3C5KA 1N87A 4L7XA 1FP0A 1HYJA 2VPEA 2F42A 3EB5A 5TRBA 3ZNIA 1X4UA 2CT2A 4N4FA 4A4BA 2MA5A 1MM3A 4A4CA 2FUIA 5H1VA 2PNXA 3E2DA 1Z6UA 5B79A 4IC3A 2P57A 3HTKC 2VJFA 4GNGA 2K17A 1IYMA 4AVXA 3LQIA 2MIQA 2KKYA 3SOWA 1XWHA 1JM7B 3FM8C 4B7YC 3FAOA 2K16A 2M1RA 3MHSA 4YATA 2M3HA 4O64A 4ZUXU 2MD8C 5JG6A 3MHHA 3U5PA 4MVTA 3H7HA 4F1PA 2Y1NA 4N3WA 3M7KA 3MDBC 5J3XA 3M99A 2L43A 3ZYQA 3LVRE 4O62A 2RI7A 2YREA 3U5MA 2YHNA 5B77A 4BHWA 1WEQA 4MSXA 2LN0A 4W4UA 1K2FA 1CHCA 1WEPA 5SVIA 4UP0A 3N9QA 2CKLA 2YSMA 2LGLA 2UZGA 2Y1MA 3O34A 3M63A 3LDYA 4I7BA 2EODA 5B8DA 5G0FA 5TDRA 2LXPC 2EGPA 1LDKC 2E6RA 3LRQA 1WFKA 5LKZA 4CCGX 5H1TA 2FUUA 2YSJA 5LKTA 4LADB 5C11A 3HCSA 3FANA 4AYCA 2C2VS 3IHPA 3V43A 2CSZA 5TBNA 4H9DA 2KWKA 3O37A 3O35A 2M6MA 5KH3A 2H0DB 2ECNA 2IDAA 2D8SA 2JMJA 2YVRA 3ZVYA 5FEYA 1DCQA 2DSMA 2ECIA 4AP4A 2YURA 1VFYA 4FJCA 2M13A 2RSDA 3L1XA 3VK6A 4B86C 2QICA 4BBQA 2C2LA 4UI9B 4FK5A 3ZTGA 3O70A 2G6QA 2YU4A 3N9MA 3RPGC 3O47A 2LRIC 1X4JA 5SVYA 3PUQA 4X3GA 2MNYA 1WILA 2YT5A 3GL6A 4PPEA 1WEMA 4I7DA 5DINA 5AIUA 3N9PA 2CRRA 4I7CA 1Z60A 2AN6A 2FFWA 2KWJA 3SOUA 2KGGA 2E61A 3HCUA 1Z2QA 2VJFB 2CRWA 3FEHA 1JM7A 3ASLA 2JRJA 2LGVA 2YQMA 2L0BA 5KH9A 5G05B 2EXUA 5SVXA 4Q6FA 5DKAA 2MA6A 1WEOA 2BAYA 4FIPA 3U5OA 3FL2A 3O7AA 3GV4A 5TABA 3KQIA 2FSAA 2KYUA 5H1UA 2XOYA 2EGMA 4YABA 3LJUX 2ECTA 3O36A 5LKXA 2CSVA 3T6RA 2LGKA 5K3QA 2YYRA 2OWAA 2DX8A 4V3KC 1MBMA 2CKLB 4WZ3B 4YAXA 1VD4A 3DWDA 1BORA 4S3OC 2RR4A 1ZBDB 2NAAA 2JM3A 3N9OA 3I2DA 2ECWA 3ZVZB 3QZVA 2F6JA 4GB0A 3JUEA 2MD7B 2YW8A 4LK9A 5FB1A 2KKXA 4R8PK 2MKEA 2DJAA 2QIZA 5LCWB 4ZQLA 2FD4A 3PHDA 5B78A 2VJEA 3NG2A 5LKUA 4R2YA 2I50A 4WZ0A 1U6GB 2F6NA 2M85A 2LXHC 5I3LA 1T1HA 3RPGB 5FB0A 3PLWA 2ECVA 3U5NA 2KE1A 4YC9A 4CA1A 3KNVA 4QF3A 3T7LA 2QJ0A 2HYED 1WGMA 4Z0OA 2L7PA 2XEUA 5D1LB 3T9KA 3DQVR 4A0CD 4V3LC 2L5UA 3KDEC 4QQ4A 2Y43A 2PUYA 2K4DA 2LAUA 5FERA 5EYAF 4C9ZA 4YBSA 4Z0RA 3FJUB 3PURA 4GNFA 1WE9A 4WZ2A 2XB1A 2KFTA 2MUMA 4XI1A 4R7EA 2ECJA 2XOCA 1X4IA 2G45A 2YUCA 2K1JA 4L58A 1JOCA 2JUNA 2JMDA 4IC2A 1FBVA 4WA6A 1RMDA 4GNDA 4LKAA 2E6SA 1VYXA 3LQHA 3ZPV1 4GNEA 3KV5A 4UP5A 4F52B 3DDTA 2B0OE 1MM2A 3RTRB 5C13A 2LGGA 1WEUA 2L75A 1F62A 2VPBA 5SVIB 3HCTA 2KU3A 4AUQB 3C6WA 2LV9A 4PTBA 3SHBA 1WEWA 2MNZA 4YADA 3KV6A 3DPLR 4YBTA 2VNFA 1DVPA 2KWNA 2D8UA 1WENA 2JMIA 4S3OB 5AITA 1WEEA 5H9MA
chains in the Genus database with same CATH topology
2LDRA 3M62A 3LQJA 2KREA 1LDJB 2CSYA 3ZPVE 2ECGA 5TDWA 2KR4A 4AYCB 2LQ6A 4QF2A 5G04B 2KWOA 2HDPA 2YHOA 1WESA 4LJNA 5B75A 2H0DA 2KGIA 5D1KB 3SOXA 3L11A 4A49A 1WIMA 2G43A 2VPGA 4YBMA 2YQLA 2MT5A 1HYIA 5B76A 4LLBA 4FO9A 3N9NA 5KH7A 2VJEB 4ZDTA 3O33A 1G25A 2EA6A 2KIZA 4NN2A 1V87A 2OXQC 5D1MB 2ZETC 4TKPB 4P5OB 3L1ZB 2L80A 1E4UA 3EB6A 2VPDA 2VP7A 1WEVA 3N9LA 3C5KA 1N87A 4L7XA 1FP0A 1HYJA 2VPEA 2F42A 3EB5A 5TRBA 3ZNIA 1X4UA 2CT2A 4N4FA 4A4BA 2MA5A 1MM3A 4A4CA 2FUIA 5H1VA 2PNXA 1Z6UA 5B79A 4IC3A 3HTKC 2VJFA 4GNGA 2K17A 1IYMA 4AVXA 3LQIA 2MIQA 3SOWA 1XWHA 1JM7B 4B7YC 2K16A 2M1RA 3MHSA 4YATA 2M3HA 4O64A 4ZUXU 2MD8C 5JG6A 3MHHA 3U5PA 4MVTA 2Y1NA 4N3WA 5J3XA 3M99A 2L43A 3ZYQA 2RI7A 2YREA 3U5MA 2YHNA 5B77A 4BHWA 1WEQA 4MSXA 2LN0A 4W4UA 1K2FA 1CHCA 1WEPA 4UP0A 3N9QA 2CKLA 2YSMA 2LGLA 2UZGA 2Y1MA 3O34A 3M63A 4I7BA 2EODA 5B8DA 5G0FA 5TDRA 2LXPC 2EGPA 1LDKC 2E6RA 3LRQA 1WFKA 5LKZA 4CCGX 5H1TA 2FUUA 2YSJA 5LKTA 4LADB 5C11A 3HCSA 4AYCA 2C2VS 3IHPA 3V43A 2CSZA 5TBNA 2KWKA 3O37A 3O35A 2M6MA 5KH3A 2H0DB 2ECNA 2IDAA 2D8SA 2JMJA 3ZVYA 5FEYA 2ECIA 4AP4A 2YURA 1VFYA 4FJCA 2RSDA 3L1XA 3VK6A 4B86C 2QICA 4BBQA 2C2LA 4UI9B 4FK5A 3ZTGA 3O70A 2G6QA 2YU4A 3N9MA 3RPGC 2LRIC 1X4JA 3PUQA 4X3GA 2MNYA 1WILA 2YT5A 3GL6A 4PPEA 1WEMA 4I7DA 5DINA 5AIUA 3N9PA 4I7CA 1Z60A 2AN6A 2KWJA 3SOUA 2KGGA 3HCUA 1Z2QA 2VJFB 1JM7A 3ASLA 2JRJA 2LGVA 2YQMA 2L0BA 5KH9A 5G05B 4Q6FA 5DKAA 2MA6A 1WEOA 2BAYA 4FIPA 3U5OA 3FL2A 3O7AA 3GV4A 5TABA 3KQIA 2FSAA 2KYUA 5H1UA 4YABA 2ECTA 3O36A 5LKXA 3T6RA 2LGKA 2YYRA 2DX8A 4V3KC 2CKLB 4WZ3B 4YAXA 1VD4A 1BORA 4S3OC 1ZBDB 2NAAA 3N9OA 3I2DA 2ECWA 3ZVZB 3QZVA 2F6JA 4GB0A 2MD7B 2YW8A 4LK9A 5FB1A 4R8PK 2QIZA 5LCWB 4ZQLA 3PHDA 5B78A 2VJEA 3NG2A 5LKUA 4R2YA 2I50A 4WZ0A 1U6GB 2F6NA 2M85A 2LXHC 5I3LA 1T1HA 3RPGB 5FB0A 2ECVA 3U5NA 2KE1A 4YC9A 4CA1A 3KNVA 4QF3A 3T7LA 2QJ0A 2HYED 1WGMA 2XEUA 5D1LB 4A0CD 3DQVR 4V3LC 2L5UA 2Y43A 2PUYA 2K4DA 5FERA 5EYAF 4C9ZA 4YBSA 3PURA 4GNFA 1WE9A 4WZ2A 2XB1A 2KFTA 2MUMA 4XI1A 4R7EA 2ECJA 1X4IA 2G45A 2YUCA 2K1JA 4L58A 1JOCA 2JMDA 4IC2A 1FBVA 4WA6A 1RMDA 4GNDA 4LKAA 2E6SA 1VYXA 3LQHA 3ZPV1 4GNEA 3KV5A 4UP5A 4F52B 1MM2A 3RTRB 5C13A 2LGGA 1WEUA 2L75A 1F62A 2VPBA 3HCTA 2KU3A 4AUQB 3C6WA 2LV9A 4PTBA 3SHBA 1WEWA 2MNZA 4YADA 3KV6A 3DPLR 4YBTA 2VNFA 1DVPA 2KWNA 1WENA 2JMIA 4S3OB 5AITA 1WEEA 5H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LDR A;  3M62 A;  3LQJ A;  2KRE A;  1LDJ B;  2CSY A;  3ZPV E;  2ECG A;  5TDW A;  2KR4 A;  4AYC B;  2LQ6 A;  4QF2 A;  5G04 B;  2KWO A;  2HDP A;  2YHO A;  1WES A;  4LJN A;  5B75 A;  2H0D A;  2KGI A;  5D1K B;  3SOX A;  3L11 A;  4A49 A;  1WIM A;  2G43 A;  2VPG A;  4YBM A;  2YQL A;  2MT5 A;  1HYI A;  5B76 A;  4LLB A;  4FO9 A;  3N9N A;  5KH7 A;  2VJE B;  4ZDT A;  3O33 A;  1G25 A;  2EA6 A;  2KIZ A;  4NN2 A;  1V87 A;  2OXQ C;  5D1M B;  2ZET C;  4TKP B;  4P5O B;  3L1Z B;  2L80 A;  1E4U A;  3EB6 A;  2VPD A;  2VP7 A;  1WEV A;  3N9L A;  3C5K A;  1N87 A;  4L7X A;  1FP0 A;  1HYJ A;  2VPE A;  2F42 A;  3EB5 A;  5TRB A;  3ZNI A;  1X4U A;  2CT2 A;  4N4F A;  4A4B A;  2MA5 A;  1MM3 A;  4A4C A;  2FUI A;  5H1V A;  2PNX A;  1Z6U A;  5B79 A;  4IC3 A;  3HTK C;  2VJF A;  4GNG A;  2K17 A;  1IYM A;  4AVX A;  3LQI A;  2MIQ A;  3SOW A;  1XWH A;  1JM7 B;  4B7Y C;  2K16 A;  2M1R A;  3MHS A;  4YAT A;  2M3H A;  4O64 A;  4ZUX U;  2MD8 C;  5JG6 A;  3MHH A;  3U5P A;  4MVT A;  2Y1N A;  4N3W A;  5J3X A;  3M99 A;  2L43 A;  3ZYQ A;  2RI7 A;  2YRE A;  3U5M A;  2YHN A;  5B77 A;  4BHW A;  1WEQ A;  4MSX A;  2LN0 A;  4W4U A;  1K2F A;  1CHC A;  1WEP A;  4UP0 A;  3N9Q A;  2CKL A;  2YSM A;  2LGL A;  2UZG A;  2Y1M A;  3O34 A;  3M63 A;  4I7B A;  2EOD A;  5B8D A;  5G0F A;  5TDR A;  2LXP C;  2EGP A;  1LDK C;  2E6R A;  3LRQ A;  1WFK A;  5LKZ A;  4CCG X;  5H1T A;  2FUU A;  2YSJ A;  5LKT A;  4LAD B;  5C11 A;  3HCS A;  4AYC A;  2C2V S;  3IHP A;  3V43 A;  2CSZ A;  5TBN A;  2KWK A;  3O37 A;  3O35 A;  2M6M A;  5KH3 A;  2H0D B;  2ECN A;  2IDA A;  2D8S A;  2JMJ A;  3ZVY A;  5FEY A;  2ECI A;  4AP4 A;  2YUR A;  1VFY A;  4FJC A;  2RSD A;  3L1X A;  3VK6 A;  4B86 C;  2QIC A;  4BBQ A;  2C2L A;  4UI9 B;  4FK5 A;  3ZTG A;  3O70 A;  2G6Q A;  2YU4 A;  3N9M A;  3RPG C;  2LRI C;  1X4J A;  3PUQ A;  4X3G A;  2MNY A;  1WIL A;  2YT5 A;  3GL6 A;  4PPE A;  1WEM A;  4I7D A;  5DIN A;  5AIU A;  3N9P A;  4I7C A;  1Z60 A;  2AN6 A;  2KWJ A;  3SOU A;  2KGG A;  3HCU A;  1Z2Q A;  2VJF B;  1JM7 A;  3ASL A;  2JRJ A;  2LGV A;  2YQM A;  2L0B A;  5KH9 A;  5G05 B;  4Q6F A;  5DKA A;  2MA6 A;  1WEO A;  2BAY A;  4FIP A;  3U5O A;  3FL2 A;  3O7A A;  3GV4 A;  5TAB A;  3KQI A;  2FSA A;  2KYU A;  5H1U A;  4YAB A;  2ECT A;  3O36 A;  5LKX A;  3T6R A;  2LGK A;  2YYR A;  2DX8 A;  4V3K C;  2CKL B;  4WZ3 B;  4YAX A;  1VD4 A;  1BOR A;  4S3O C;  1ZBD B;  2NAA A;  3N9O A;  3I2D A;  2ECW A;  3ZVZ B;  3QZV A;  2F6J A;  4GB0 A;  2MD7 B;  2YW8 A;  4LK9 A;  5FB1 A;  4R8P K;  2QIZ A;  5LCW B;  4ZQL A;  3PHD A;  5B78 A;  2VJE A;  3NG2 A;  5LKU A;  4R2Y A;  2I50 A;  4WZ0 A;  1U6G B;  2F6N A;  2M85 A;  2LXH C;  5I3L A;  1T1H A;  3RPG B;  5FB0 A;  2ECV A;  3U5N A;  2KE1 A;  4YC9 A;  4CA1 A;  3KNV A;  4QF3 A;  3T7L A;  2QJ0 A;  2HYE D;  1WGM A;  2XEU A;  5D1L B;  4A0C D;  3DQV R;  4V3L C;  2L5U A;  2Y43 A;  2PUY A;  2K4D A;  5FER A;  5EYA F;  4C9Z A;  4YBS A;  3PUR A;  4GNF A;  1WE9 A;  4WZ2 A;  2XB1 A;  2KFT A;  2MUM A;  4XI1 A;  4R7E A;  2ECJ A;  1X4I A;  2G45 A;  2YUC A;  2K1J A;  4L58 A;  1JOC A;  2JMD A;  4IC2 A;  1FBV A;  4WA6 A;  1RMD A;  4GND A;  4LKA A;  2E6S A;  1VYX A;  3LQH A;  3ZPV 1;  4GNE A;  3KV5 A;  4UP5 A;  4F52 B;  1MM2 A;  3RTR B;  5C13 A;  2LGG A;  1WEU A;  2L75 A;  1F62 A;  2VPB A;  3HCT A;  2KU3 A;  4AUQ B;  3C6W A;  2LV9 A;  4PTB A;  3SHB A;  1WEW A;  2MNZ A;  4YAD A;  3KV6 A;  3DPL R;  4YBT A;  2VNF A;  1DVP A;  2KWN A;  1WEN A;  2JMI A;  4S3O B;  5AIT A;  1WEE A;  5H9M A; 
#chains in the Genus database with same CATH topology
 2LDR A;  3M62 A;  3LQJ A;  2KRE A;  1LDJ B;  2CSY A;  3ZPV E;  2ECG A;  5TDW A;  2KR4 A;  4AYC B;  2LQ6 A;  4QF2 A;  5G04 B;  2KWO A;  2HDP A;  2YHO A;  3SUB A;  1WES A;  4LJN A;  5B75 A;  2H0D A;  2KGI A;  5D1K B;  4OGC A;  3L11 A;  3SOX A;  4A49 A;  1WIM A;  2G43 A;  2VPG A;  4YBM A;  2XOZ A;  2YQL A;  3Q1D A;  2MT5 A;  1HYI A;  3LVQ E;  2CON A;  5B76 A;  4LLB A;  4FO9 A;  3N9N A;  5KH7 A;  2VJE B;  4ZDT A;  3O33 A;  1G25 A;  2EA6 A;  2KIZ A;  4NN2 A;  1V87 A;  2OXQ C;  4OGE A;  5D1M B;  2ZET C;  2IQJ A;  4TKP B;  4P5O B;  3L1Z B;  2L80 A;  2XP0 A;  1E4U A;  3EB6 A;  2VPD A;  2VP7 A;  1WEV A;  3N9L A;  3C5K A;  1N87 A;  4L7X A;  1FP0 A;  1HYJ A;  2VPE A;  2F42 A;  3EB5 A;  5TRB A;  3ZNI A;  1X4U A;  2CT2 A;  4N4F A;  4A4B A;  2MA5 A;  1MM3 A;  4A4C A;  2FUI A;  5H1V A;  2PNX A;  3E2D A;  1Z6U A;  5B79 A;  4IC3 A;  2P57 A;  3HTK C;  2VJF A;  4GNG A;  2K17 A;  1IYM A;  4AVX A;  3LQI A;  2MIQ A;  2KKY A;  3SOW A;  1XWH A;  1JM7 B;  3FM8 C;  4B7Y C;  3FAO A;  2K16 A;  2M1R A;  3MHS A;  4YAT A;  2M3H A;  4O64 A;  4ZUX U;  2MD8 C;  5JG6 A;  3MHH A;  3U5P A;  4MVT A;  3H7H A;  4F1P A;  2Y1N A;  4N3W A;  3M7K A;  3MDB C;  5J3X A;  3M99 A;  2L43 A;  3ZYQ A;  3LVR E;  4O62 A;  2RI7 A;  2YRE A;  3U5M A;  2YHN A;  5B77 A;  4BHW A;  1WEQ A;  4MSX A;  2LN0 A;  4W4U A;  1K2F A;  1CHC A;  1WEP A;  5SVI A;  4UP0 A;  3N9Q A;  2CKL A;  2YSM A;  2LGL A;  2UZG A;  2Y1M A;  3O34 A;  3M63 A;  3LDY A;  4I7B A;  2EOD A;  5B8D A;  5G0F A;  5TDR A;  2LXP C;  2EGP A;  1LDK C;  2E6R A;  3LRQ A;  1WFK A;  5LKZ A;  4CCG X;  5H1T A;  2FUU A;  2YSJ A;  5LKT A;  4LAD B;  5C11 A;  3HCS A;  3FAN A;  4AYC A;  2C2V S;  3IHP A;  3V43 A;  2CSZ A;  5TBN A;  4H9D A;  2KWK A;  3O37 A;  3O35 A;  2M6M A;  5KH3 A;  2H0D B;  2ECN A;  2IDA A;  2D8S A;  2JMJ A;  2YVR A;  3ZVY A;  5FEY A;  1DCQ A;  2DSM A;  2ECI A;  4AP4 A;  2YUR A;  1VFY A;  4FJC A;  2M13 A;  2RSD A;  3L1X A;  3VK6 A;  4B86 C;  2QIC A;  4BBQ A;  2C2L A;  4UI9 B;  4FK5 A;  3ZTG A;  3O70 A;  2G6Q A;  2YU4 A;  3N9M A;  3RPG C;  3O47 A;  2LRI C;  1X4J A;  5SVY A;  3PUQ A;  4X3G A;  2MNY A;  1WIL A;  2YT5 A;  3GL6 A;  4PPE A;  1WEM A;  4I7D A;  5DIN A;  5AIU A;  3N9P A;  2CRR A;  4I7C A;  1Z60 A;  2AN6 A;  2FFW A;  2KWJ A;  3SOU A;  2KGG A;  2E61 A;  3HCU A;  1Z2Q A;  2VJF B;  2CRW A;  3FEH A;  1JM7 A;  3ASL A;  2JRJ A;  2LGV A;  2YQM A;  2L0B A;  5KH9 A;  5G05 B;  2EXU A;  5SVX A;  4Q6F A;  5DKA A;  2MA6 A;  1WEO A;  2BAY A;  4FIP A;  3U5O A;  3FL2 A;  3O7A A;  3GV4 A;  5TAB A;  3KQI A;  2FSA A;  2KYU A;  5H1U A;  2XOY A;  2EGM A;  4YAB A;  3LJU X;  2ECT A;  3O36 A;  5LKX A;  2CSV A;  3T6R A;  2LGK A;  5K3Q A;  2YYR A;  2OWA A;  2DX8 A;  4V3K C;  1MBM A;  2CKL B;  4WZ3 B;  4YAX A;  1VD4 A;  3DWD A;  1BOR A;  4S3O C;  2RR4 A;  1ZBD B;  2NAA A;  2JM3 A;  3N9O A;  3I2D A;  2ECW A;  3ZVZ B;  3QZV A;  2F6J A;  4GB0 A;  3JUE A;  2MD7 B;  2YW8 A;  4LK9 A;  5FB1 A;  2KKX A;  4R8P K;  2MKE A;  2DJA A;  2QIZ A;  5LCW B;  4ZQL A;  2FD4 A;  3PHD A;  5B78 A;  2VJE A;  3NG2 A;  5LKU A;  4R2Y A;  2I50 A;  4WZ0 A;  1U6G B;  2F6N A;  2M85 A;  2LXH C;  5I3L A;  1T1H A;  3RPG B;  5FB0 A;  3PLW A;  2ECV A;  3U5N A;  2KE1 A;  4YC9 A;  4CA1 A;  3KNV A;  4QF3 A;  3T7L A;  2QJ0 A;  2HYE D;  1WGM A;  4Z0O A;  2L7P A;  2XEU A;  5D1L B;  3T9K A;  3DQV R;  4A0C D;  4V3L C;  2L5U A;  3KDE C;  4QQ4 A;  2Y43 A;  2PUY A;  2K4D A;  2LAU A;  5FER A;  5EYA F;  4C9Z A;  4YBS A;  4Z0R A;  3FJU B;  3PUR A;  4GNF A;  1WE9 A;  4WZ2 A;  2XB1 A;  2KFT A;  2MUM A;  4XI1 A;  4R7E A;  2ECJ A;  2XOC A;  1X4I A;  2G45 A;  2YUC A;  2K1J A;  4L58 A;  1JOC A;  2JUN A;  2JMD A;  4IC2 A;  1FBV A;  4WA6 A;  1RMD A;  4GND A;  4LKA A;  2E6S A;  1VYX A;  3LQH A;  3ZPV 1;  4GNE A;  3KV5 A;  4UP5 A;  4F52 B;  3DDT A;  2B0O E;  1MM2 A;  3RTR B;  5C13 A;  2LGG A;  1WEU A;  2L75 A;  1F62 A;  2VPB A;  5SVI B;  3HCT A;  2KU3 A;  4AUQ B;  3C6W A;  2LV9 A;  4PTB A;  3SHB A;  1WEW A;  2MNZ A;  4YAD A;  3KV6 A;  3DPL R;  4YBT A;  2VNF A;  1DVP A;  2KWN A;  2D8U A;  1WEN A;  2JMI A;  4S3O B;  5AIT A;  1WEE A;  5H9M A; 
#chains in the Genus database with same CATH homology
 2LDR A;  3M62 A;  3LQJ A;  2KRE A;  1LDJ B;  2CSY A;  3ZPV E;  2ECG A;  5TDW A;  2KR4 A;  4AYC B;  2LQ6 A;  4QF2 A;  5G04 B;  2KWO A;  2HDP A;  2YHO A;  1WES A;  4LJN A;  5B75 A;  2H0D A;  2KGI A;  5D1K B;  3SOX A;  3L11 A;  4A49 A;  1WIM A;  2G43 A;  2VPG A;  4YBM A;  2YQL A;  2MT5 A;  1HYI A;  5B76 A;  4LLB A;  4FO9 A;  3N9N A;  5KH7 A;  2VJE B;  4ZDT A;  3O33 A;  1G25 A;  2EA6 A;  2KIZ A;  4NN2 A;  1V87 A;  2OXQ C;  5D1M B;  2ZET C;  4TKP B;  4P5O B;  3L1Z B;  2L80 A;  1E4U A;  3EB6 A;  2VPD A;  2VP7 A;  1WEV A;  3N9L A;  3C5K A;  1N87 A;  4L7X A;  1FP0 A;  1HYJ A;  2VPE A;  2F42 A;  3EB5 A;  5TRB A;  3ZNI A;  1X4U A;  2CT2 A;  4N4F A;  4A4B A;  2MA5 A;  1MM3 A;  4A4C A;  2FUI A;  5H1V A;  2PNX A;  1Z6U A;  5B79 A;  4IC3 A;  3HTK C;  2VJF A;  4GNG A;  2K17 A;  1IYM A;  4AVX A;  3LQI A;  2MIQ A;  3SOW A;  1XWH A;  1JM7 B;  4B7Y C;  2K16 A;  2M1R A;  3MHS A;  4YAT A;  2M3H A;  4O64 A;  4ZUX U;  2MD8 C;  5JG6 A;  3MHH A;  3U5P A;  4MVT A;  2Y1N A;  4N3W A;  5J3X A;  3M99 A;  2L43 A;  3ZYQ A;  2RI7 A;  2YRE A;  3U5M A;  2YHN A;  5B77 A;  4BHW A;  1WEQ A;  4MSX A;  2LN0 A;  4W4U A;  1K2F A;  1CHC A;  1WEP A;  4UP0 A;  3N9Q A;  2CKL A;  2YSM A;  2LGL A;  2UZG A;  2Y1M A;  3O34 A;  3M63 A;  4I7B A;  2EOD A;  5B8D A;  5G0F A;  5TDR A;  2LXP C;  2EGP A;  1LDK C;  2E6R A;  3LRQ A;  1WFK A;  5LKZ A;  4CCG X;  5H1T A;  2FUU A;  2YSJ A;  5LKT A;  4LAD B;  5C11 A;  3HCS A;  4AYC A;  2C2V S;  3IHP A;  3V43 A;  2CSZ A;  5TBN A;  2KWK A;  3O37 A;  3O35 A;  2M6M A;  5KH3 A;  2H0D B;  2ECN A;  2IDA A;  2D8S A;  2JMJ A;  3ZVY A;  5FEY A;  2ECI A;  4AP4 A;  2YUR A;  1VFY A;  4FJC A;  2RSD A;  3L1X A;  3VK6 A;  4B86 C;  2QIC A;  4BBQ A;  2C2L A;  4UI9 B;  4FK5 A;  3ZTG A;  3O70 A;  2G6Q A;  2YU4 A;  3N9M A;  3RPG C;  2LRI C;  1X4J A;  3PUQ A;  4X3G A;  2MNY A;  1WIL A;  2YT5 A;  3GL6 A;  4PPE A;  1WEM A;  4I7D A;  5DIN A;  5AIU A;  3N9P A;  4I7C A;  1Z60 A;  2AN6 A;  2KWJ A;  3SOU A;  2KGG A;  3HCU A;  1Z2Q A;  2VJF B;  1JM7 A;  3ASL A;  2JRJ A;  2LGV A;  2YQM A;  2L0B A;  5KH9 A;  5G05 B;  4Q6F A;  5DKA A;  2MA6 A;  1WEO A;  2BAY A;  4FIP A;  3U5O A;  3FL2 A;  3O7A A;  3GV4 A;  5TAB A;  3KQI A;  2FSA A;  2KYU A;  5H1U A;  4YAB A;  2ECT A;  3O36 A;  5LKX A;  3T6R A;  2LGK A;  2YYR A;  2DX8 A;  4V3K C;  2CKL B;  4WZ3 B;  4YAX A;  1VD4 A;  1BOR A;  4S3O C;  1ZBD B;  2NAA A;  3N9O A;  3I2D A;  2ECW A;  3ZVZ B;  3QZV A;  2F6J A;  4GB0 A;  2MD7 B;  2YW8 A;  4LK9 A;  5FB1 A;  4R8P K;  2QIZ A;  5LCW B;  4ZQL A;  3PHD A;  5B78 A;  2VJE A;  3NG2 A;  5LKU A;  4R2Y A;  2I50 A;  4WZ0 A;  1U6G B;  2F6N A;  2M85 A;  2LXH C;  5I3L A;  1T1H A;  3RPG B;  5FB0 A;  2ECV A;  3U5N A;  2KE1 A;  4YC9 A;  4CA1 A;  3KNV A;  4QF3 A;  3T7L A;  2QJ0 A;  2HYE D;  1WGM A;  2XEU A;  5D1L B;  4A0C D;  3DQV R;  4V3L C;  2L5U A;  2Y43 A;  2PUY A;  2K4D A;  5FER A;  5EYA F;  4C9Z A;  4YBS A;  3PUR A;  4GNF A;  1WE9 A;  4WZ2 A;  2XB1 A;  2KFT A;  2MUM A;  4XI1 A;  4R7E A;  2ECJ A;  1X4I A;  2G45 A;  2YUC A;  2K1J A;  4L58 A;  1JOC A;  2JMD A;  4IC2 A;  1FBV A;  4WA6 A;  1RMD A;  4GND A;  4LKA A;  2E6S A;  1VYX A;  3LQH A;  3ZPV 1;  4GNE A;  3KV5 A;  4UP5 A;  4F52 B;  1MM2 A;  3RTR B;  5C13 A;  2LGG A;  1WEU A;  2L75 A;  1F62 A;  2VPB A;  3HCT A;  2KU3 A;  4AUQ B;  3C6W A;  2LV9 A;  4PTB A;  3SHB A;  1WEW A;  2MNZ A;  4YAD A;  3KV6 A;  3DPL R;  4YBT A;  2VNF A;  1DVP A;  2KWN A;  1WEN A;  2JMI A;  4S3O B;  5AIT A;  1WEE A;  5H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...