3RPGB

Bmi1/ring1b-ubch5c complex structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rpgB00
4X3GA 1WEWA 5TBNA 2EODA 4S3OC 4WZ3B 2KGIA 2L43A 3LQHA 2KYUA 3HCTA 2CKLB 2CKLA 5G05B 3O33A 4GB0A 2VPEA 2M85A 1CHCA 1Z60A 2G43A 3U5MA 4AVXA 4ZUXU 5TDRA 2BAYA 2CSZA 3L11A 4O64A 5FB0A 2UZGA 2YREA 4I7CA 3PHDA 2FUIA 5B8DA 4LJNA 5G0FA 2YQLA 4PPEA 2KWNA 4GNGA 2RI7A 2ECGA 2KWOA 3GV4A 2I50A 4Q6FA 4C9ZA 1V87A 1WEPA 1N87A 1MM3A 3L1XA 3C6WA 3ZNIA 2K16A 2G6QA 1JOCA 2QICA 5TDWA 1F62A 1WILA 2LN0A 5B76A 4B7YC 4FJCA 4YAXA 5H1VA 3U5OA 2LGVA 3N9LA 2MIQA 2E6RA 3LRQA 1FP0A 4IC2A 5B78A 3MHHA 2LGKA 2ECIA 3EB6A 2CSYA 3ASLA 1WGMA 1RMDA 4R7EA 2YHOA 5J3XA 5KH3A 4AP4A 4FO9A 1JM7B 2MD7B 1JM7A 3SHBA 2K4DA 3N9PA 5C11A 4YBTA 3SOWA 1ZBDB 3M63A 5B77A 2DX8A 2KWJA 4CA1A 2JMIA 4LK9A 3LQIA 1WEOA 3KNVA 4ZDTA 2VP7A 3HCUA 3VK6A 1LDJB 3O35A 4NN2A 2YUCA 5H1TA 2LXHC 4PTBA 2IDAA 2VJEB 3KV6A 4YC9A 4YBSA 2AN6A 2CT2A 2QJ0A 3SOXA 4TKPB 3T6RA 4I7BA 2KREA 4GNDA 4LKAA 2D8SA 3O36A 2LV9A 2LDRA 4S3OB 1BORA 1IYMA 2YT5A 5TABA 4YABA 4FK5A 3T7LA 5LKTA 4AUQB 2KU3A 3C5KA 4R2YA 1WEUA 2KFTA 3ZYQA 5LKUA 4V3KC 2ECJA 3QZVA 2LQ6A 3LQJA 2YHNA 4A0CD 1DVPA 1FBVA 4BHWA 2F6JA 1T1HA 2YSMA 2F42A 2ECWA 3SOUA 4XI1A 4GNEA 1WE9A 4QF3A 2YURA 4IC3A 2L0BA 4F52B 5LKXA 5FB1A 2C2LA 2MT5A 4YATA 3O34A 4UP5A 3RPGC 5FERA 5LCWB 3U5NA 3M99A 2VPGA 1VFYA 2L75A 2Y1NA 2FUUA 2E6SA 1WENA 4R8PK 5KH9A 3ZTGA 1XWHA 2MA6A 3N9NA 3O70A 5DINA 2LXPC 4V3LC 5D1MB 1WEEA 1K2FA 1VYXA 2JRJA 3I2DA 1HYJA 2KGGA 3N9QA 5AIUA 4MSXA 3L1ZB 3PUQA 1Z2QA 2PUYA 2H0DB 2VJFB 4L7XA 2H0DA 2VJFA 2LGGA 3DPLR 2EGPA 1E4UA 2YSJA 3NG2A 3ZPVE 4WA6A 4L58A 4QF2A 3M62A 4UP0A 1MM2A 3GL6A 2LGLA 2L80A 2VJEA 2G45A 2MNYA 2M6MA 2VPBA 4ZQLA 4N4FA 5D1LB 1G25A 4BBQA 4MVTA 4AYCB 4AYCA 1X4UA 2Y1MA 2M3HA 4I7DA 1WEVA 3FL2A 2YQMA 3ZVYA 2MA5A 4FIPA 5AITA 4LLBA 2ZETC 2KWKA 3EB5A 3HTKC 5G04B 2EA6A 2KIZA 5I3LA 4WZ2A 3ZVZB 3KV5A 2KR4A 3DQVR 3KQIA 2MD8C 5C13A 5TRBA 1LDKC 4W4UA 4N3WA 2HDPA 2YYRA 5FEYA 2C2VS 2KE1A 2OXQC 5JG6A 2RSDA 4UI9B 2Y43A 5DKAA 2HYED 4A49A 2K17A 1WFKA 4A4CA 1X4JA 2FSAA 3O37A 2ECVA 2XEUA 2K1JA 2QIZA 2PNXA 5KH7A 4B86C 2YU4A 3PURA 2JMDA 4WZ0A 5D1KB 4CCGX 2YW8A 5EYAF 3RTRB 3U5PA 2MUMA 1WEMA 4A4BA 2JMJA 3HCSA 2L5UA 3ZPV1 2NAAA 1Z6UA 1X4IA 3MHSA 3V43A 2M1RA 3N9OA 4GNFA 3N9MA 5B79A 4LADB 1WIMA 2ECTA 1HYIA 2XB1A 4YADA 5B75A 1WESA 2F6NA 3O7AA 4P5OB 2MNZA 5H1UA 2VPDA 1U6GB 1VD4A 3IHPA 5LKZA 5H9MA 2VNFA 4YBMA 3RPGB 2LRIC 1WEQA 2ECNA
chains in the Genus database with same CATH superfamily
4X3GA 1WEWA 2KKYA 5TBNA 2EODA 4S3OC 4WZ3B 2KGIA 2L43A 3LQHA 2KYUA 2L7PA 3HCTA 2CKLB 2CKLA 5G05B 3O33A 4GB0A 2VPEA 2M85A 1CHCA 1Z60A 2G43A 3U5MA 4AVXA 2EXUA 4ZUXU 2XP0A 5TDRA 4OGEA 2BAYA 2CSZA 3L11A 4O64A 5FB0A 2UZGA 2YREA 4I7CA 3PHDA 2FUIA 5B8DA 4LJNA 5G0FA 2YQLA 4PPEA 2KWNA 4GNGA 2RI7A 3LJUX 2CRWA 2ECGA 2KWOA 2CSVA 3GV4A 2RR4A 2I50A 2XOZA 4Q6FA 4C9ZA 1V87A 3H7HA 1WEPA 1N87A 1MM3A 3L1XA 3C6WA 3ZNIA 2K16A 2G6QA 1JOCA 2QICA 4H9DA 5TDWA 1F62A 1WILA 2LN0A 3DDTA 5B76A 4B7YC 4FJCA 4YAXA 5H1VA 3U5OA 2YVRA 2LGVA 3N9LA 2MIQA 2E6RA 3LRQA 1FP0A 4QQ4A 2IQJA 4IC2A 5B78A 4OGCA 3MHHA 2E61A 2LGKA 2ECIA 3EB6A 2CSYA 3ASLA 5K3QA 1WGMA 1RMDA 4R7EA 2YHOA 5J3XA 2JUNA 5KH3A 4AP4A 4FO9A 3FEHA 1JM7B 2MD7B 1JM7A 3SHBA 2K4DA 3N9PA 5C11A 4YBTA 2XOYA 3SOWA 1ZBDB 3M63A 5B77A 2DX8A 2KWJA 2FD4A 4CA1A 3T9KA 2JMIA 4LK9A 3LQIA 2LAUA 1WEOA 3KNVA 4ZDTA 3M7KA 2VP7A 3HCUA 3VK6A 1LDJB 2EGMA 3O35A 4NN2A 2YUCA 5H1TA 2LXHC 3DWDA 2D8UA 4PTBA 2IDAA 2VJEB 3KV6A 4YC9A 2XOCA 4YBSA 2AN6A 5SVIB 5SVIA 3E2DA 2CT2A 2QJ0A 3SOXA 4TKPB 3T6RA 4I7BA 2KREA 4GNDA 4LKAA 2D8SA 3O36A 2LV9A 2LDRA 4S3OB 1BORA 1IYMA 2YT5A 5TABA 4YABA 4FK5A 3LVRE 3T7LA 3FAOA 5LKTA 4AUQB 2KU3A 3C5KA 4R2YA 1WEUA 2KFTA 3ZYQA 5LKUA 4V3KC 2ECJA 4F1PA 3QZVA 2LQ6A 3LQJA 2YHNA 4Z0RA 4A0CD 2MKEA 1DVPA 1FBVA 4BHWA 2F6JA 1T1HA 2YSMA 2F42A 2ECWA 2DJAA 3SOUA 4XI1A 4GNEA 1WE9A 4QF3A 2OWAA 2YURA 4IC3A 2CONA 2L0BA 4F52B 5LKXA 1MBMA 5FB1A 2C2LA 2MT5A 4YATA 3O34A 4UP5A 3RPGC 5FERA 5LCWB 3U5NA 3M99A 2VPGA 1VFYA 2L75A 2Y1NA 2E6SA 2FUUA 1WENA 4R8PK 5KH9A 3ZTGA 1XWHA 2MA6A 3N9NA 3O70A 5DINA 2LXPC 4V3LC 3JUEA 5D1MB 3MDBC 1WEEA 3PLWA 1K2FA 2DSMA 1VYXA 2JRJA 3I2DA 1HYJA 2KGGA 3N9QA 2CRRA 5AIUA 4MSXA 3L1ZB 3PUQA 1Z2QA 2PUYA 2H0DB 2VJFB 4L7XA 2H0DA 2VJFA 2LGGA 3DPLR 2EGPA 1E4UA 3FANA 2YSJA 3NG2A 3ZPVE 2B0OE 4WA6A 4L58A 4QF2A 3M62A 3Q1DA 4UP0A 1MM2A 2P57A 3GL6A 2LGLA 2L80A 2VJEA 2G45A 2MNYA 2FFWA 2M6MA 2VPBA 4ZQLA 4N4FA 5D1LB 1G25A 1DCQA 4BBQA 4MVTA 4AYCB 4AYCA 1X4UA 2Y1MA 2M3HA 4I7DA 1WEVA 3FL2A 2YQMA 3ZVYA 2MA5A 4FIPA 5AITA 4LLBA 2ZETC 2KWKA 3EB5A 3HTKC 5G04B 2EA6A 2KIZA 4Z0OA 5I3LA 4WZ2A 3ZVZB 3KV5A 2KR4A 3DQVR 3KQIA 2MD8C 5C13A 5TRBA 2KKXA 1LDKC 4W4UA 4N3WA 2HDPA 2YYRA 5FEYA 3FM8C 2C2VS 2KE1A 2OXQC 5JG6A 2RSDA 4UI9B 2Y43A 5DKAA 2HYED 4A49A 2K17A 3O47A 1WFKA 3LVQE 4A4CA 1X4JA 2FSAA 3FJUB 3O37A 2ECVA 5SVXA 2XEUA 2K1JA 2QIZA 2PNXA 5KH7A 4B86C 2YU4A 3PURA 2JMDA 2M13A 4WZ0A 5D1KB 4CCGX 2YW8A 5EYAF 3RTRB 3SUBA 3U5PA 2MUMA 1WEMA 4A4BA 2JMJA 3HCSA 2L5UA 3ZPV1 2NAAA 1Z6UA 1X4IA 3MHSA 5SVYA 3V43A 2M1RA 3N9OA 4GNFA 3N9MA 5B79A 4LADB 1WIMA 2ECTA 1HYIA 2XB1A 4YADA 4O62A 5B75A 1WESA 2F6NA 3O7AA 4P5OB 2MNZA 5H1UA 2VPDA 1U6GB 2JM3A 1VD4A 3IHPA 5LKZA 5H9MA 3LDYA 2VNFA 4YBMA 3RPGB 2LRIC 3KDEC 1WEQA 2ECNA
chains in the Genus database with same CATH topology
4X3GA 1WEWA 5TBNA 2EODA 4S3OC 4WZ3B 2KGIA 2L43A 3LQHA 2KYUA 3HCTA 2CKLB 2CKLA 5G05B 3O33A 4GB0A 2VPEA 2M85A 1CHCA 1Z60A 2G43A 3U5MA 4AVXA 4ZUXU 5TDRA 2BAYA 2CSZA 3L11A 4O64A 5FB0A 2UZGA 2YREA 4I7CA 3PHDA 2FUIA 5B8DA 4LJNA 5G0FA 2YQLA 4PPEA 2KWNA 4GNGA 2RI7A 2ECGA 2KWOA 3GV4A 2I50A 4Q6FA 4C9ZA 1V87A 1WEPA 1N87A 1MM3A 3L1XA 3C6WA 3ZNIA 2K16A 2G6QA 1JOCA 2QICA 5TDWA 1F62A 1WILA 2LN0A 5B76A 4B7YC 4FJCA 4YAXA 5H1VA 3U5OA 2LGVA 3N9LA 2MIQA 2E6RA 3LRQA 1FP0A 4IC2A 5B78A 3MHHA 2LGKA 2ECIA 3EB6A 2CSYA 3ASLA 1WGMA 1RMDA 4R7EA 2YHOA 5J3XA 5KH3A 4AP4A 4FO9A 1JM7B 2MD7B 1JM7A 3SHBA 2K4DA 3N9PA 5C11A 4YBTA 3SOWA 1ZBDB 3M63A 5B77A 2DX8A 2KWJA 4CA1A 2JMIA 4LK9A 3LQIA 1WEOA 3KNVA 4ZDTA 2VP7A 3HCUA 3VK6A 1LDJB 3O35A 4NN2A 2YUCA 5H1TA 2LXHC 4PTBA 2IDAA 2VJEB 3KV6A 4YC9A 4YBSA 2AN6A 2CT2A 2QJ0A 3SOXA 4TKPB 3T6RA 4I7BA 2KREA 4GNDA 4LKAA 2D8SA 3O36A 2LV9A 2LDRA 4S3OB 1BORA 1IYMA 2YT5A 5TABA 4YABA 4FK5A 3T7LA 5LKTA 4AUQB 2KU3A 3C5KA 4R2YA 1WEUA 2KFTA 3ZYQA 5LKUA 4V3KC 2ECJA 3QZVA 2LQ6A 3LQJA 2YHNA 4A0CD 1DVPA 1FBVA 4BHWA 2F6JA 1T1HA 2YSMA 2F42A 2ECWA 3SOUA 4XI1A 4GNEA 1WE9A 4QF3A 2YURA 4IC3A 2L0BA 4F52B 5LKXA 5FB1A 2C2LA 2MT5A 4YATA 3O34A 4UP5A 3RPGC 5FERA 5LCWB 3U5NA 3M99A 2VPGA 1VFYA 2L75A 2Y1NA 2FUUA 2E6SA 1WENA 4R8PK 5KH9A 3ZTGA 1XWHA 2MA6A 3N9NA 3O70A 5DINA 2LXPC 4V3LC 5D1MB 1WEEA 1K2FA 1VYXA 2JRJA 3I2DA 1HYJA 2KGGA 3N9QA 5AIUA 4MSXA 3L1ZB 3PUQA 1Z2QA 2PUYA 2H0DB 2VJFB 4L7XA 2H0DA 2VJFA 2LGGA 3DPLR 2EGPA 1E4UA 2YSJA 3NG2A 3ZPVE 4WA6A 4L58A 4QF2A 3M62A 4UP0A 1MM2A 3GL6A 2LGLA 2L80A 2VJEA 2G45A 2MNYA 2M6MA 2VPBA 4ZQLA 4N4FA 5D1LB 1G25A 4BBQA 4MVTA 4AYCB 4AYCA 1X4UA 2Y1MA 2M3HA 4I7DA 1WEVA 3FL2A 2YQMA 3ZVYA 2MA5A 4FIPA 5AITA 4LLBA 2ZETC 2KWKA 3EB5A 3HTKC 5G04B 2EA6A 2KIZA 5I3LA 4WZ2A 3ZVZB 3KV5A 2KR4A 3DQVR 3KQIA 2MD8C 5C13A 5TRBA 1LDKC 4W4UA 4N3WA 2HDPA 2YYRA 5FEYA 2C2VS 2KE1A 2OXQC 5JG6A 2RSDA 4UI9B 2Y43A 5DKAA 2HYED 4A49A 2K17A 1WFKA 4A4CA 1X4JA 2FSAA 3O37A 2ECVA 2XEUA 2K1JA 2QIZA 2PNXA 5KH7A 4B86C 2YU4A 3PURA 2JMDA 4WZ0A 5D1KB 4CCGX 2YW8A 5EYAF 3RTRB 3U5PA 2MUMA 1WEMA 4A4BA 2JMJA 3HCSA 2L5UA 3ZPV1 2NAAA 1Z6UA 1X4IA 3MHSA 3V43A 2M1RA 3N9OA 4GNFA 3N9MA 5B79A 4LADB 1WIMA 2ECTA 1HYIA 2XB1A 4YADA 5B75A 1WESA 2F6NA 3O7AA 4P5OB 2MNZA 5H1UA 2VPDA 1U6GB 1VD4A 3IHPA 5LKZA 5H9MA 2VNFA 4YBMA 3RPGB 2LRIC 1WEQA 2ECNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3G A;  1WEW A;  5TBN A;  2EOD A;  4S3O C;  4WZ3 B;  2KGI A;  2L43 A;  3LQH A;  2KYU A;  3HCT A;  2CKL B;  2CKL A;  5G05 B;  3O33 A;  4GB0 A;  2VPE A;  2M85 A;  1CHC A;  1Z60 A;  2G43 A;  3U5M A;  4AVX A;  4ZUX U;  5TDR A;  2BAY A;  2CSZ A;  3L11 A;  4O64 A;  5FB0 A;  2UZG A;  2YRE A;  4I7C A;  3PHD A;  2FUI A;  5B8D A;  4LJN A;  5G0F A;  2YQL A;  4PPE A;  2KWN A;  4GNG A;  2RI7 A;  2ECG A;  2KWO A;  3GV4 A;  2I50 A;  4Q6F A;  4C9Z A;  1V87 A;  1WEP A;  1N87 A;  1MM3 A;  3L1X A;  3C6W A;  3ZNI A;  2K16 A;  2G6Q A;  1JOC A;  2QIC A;  5TDW A;  1F62 A;  1WIL A;  2LN0 A;  5B76 A;  4B7Y C;  4FJC A;  4YAX A;  5H1V A;  3U5O A;  2LGV A;  3N9L A;  2MIQ A;  2E6R A;  3LRQ A;  1FP0 A;  4IC2 A;  5B78 A;  3MHH A;  2LGK A;  2ECI A;  3EB6 A;  2CSY A;  3ASL A;  1WGM A;  1RMD A;  4R7E A;  2YHO A;  5J3X A;  5KH3 A;  4AP4 A;  4FO9 A;  1JM7 B;  2MD7 B;  1JM7 A;  3SHB A;  2K4D A;  3N9P A;  5C11 A;  4YBT A;  3SOW A;  1ZBD B;  3M63 A;  5B77 A;  2DX8 A;  2KWJ A;  4CA1 A;  2JMI A;  4LK9 A;  3LQI A;  1WEO A;  3KNV A;  4ZDT A;  2VP7 A;  3HCU A;  3VK6 A;  1LDJ B;  3O35 A;  4NN2 A;  2YUC A;  5H1T A;  2LXH C;  4PTB A;  2IDA A;  2VJE B;  3KV6 A;  4YC9 A;  4YBS A;  2AN6 A;  2CT2 A;  2QJ0 A;  3SOX A;  4TKP B;  3T6R A;  4I7B A;  2KRE A;  4GND A;  4LKA A;  2D8S A;  3O36 A;  2LV9 A;  2LDR A;  4S3O B;  1BOR A;  1IYM A;  2YT5 A;  5TAB A;  4YAB A;  4FK5 A;  3T7L A;  5LKT A;  4AUQ B;  2KU3 A;  3C5K A;  4R2Y A;  1WEU A;  2KFT A;  3ZYQ A;  5LKU A;  4V3K C;  2ECJ A;  3QZV A;  2LQ6 A;  3LQJ A;  2YHN A;  4A0C D;  1DVP A;  1FBV A;  4BHW A;  2F6J A;  1T1H A;  2YSM A;  2F42 A;  2ECW A;  3SOU A;  4XI1 A;  4GNE A;  1WE9 A;  4QF3 A;  2YUR A;  4IC3 A;  2L0B A;  4F52 B;  5LKX A;  5FB1 A;  2C2L A;  2MT5 A;  4YAT A;  3O34 A;  4UP5 A;  3RPG C;  5FER A;  5LCW B;  3U5N A;  3M99 A;  2VPG A;  1VFY A;  2L75 A;  2Y1N A;  2FUU A;  2E6S A;  1WEN A;  4R8P K;  5KH9 A;  3ZTG A;  1XWH A;  2MA6 A;  3N9N A;  3O70 A;  5DIN A;  2LXP C;  4V3L C;  5D1M B;  1WEE A;  1K2F A;  1VYX A;  2JRJ A;  3I2D A;  1HYJ A;  2KGG A;  3N9Q A;  5AIU A;  4MSX A;  3L1Z B;  3PUQ A;  1Z2Q A;  2PUY A;  2H0D B;  2VJF B;  4L7X A;  2H0D A;  2VJF A;  2LGG A;  3DPL R;  2EGP A;  1E4U A;  2YSJ A;  3NG2 A;  3ZPV E;  4WA6 A;  4L58 A;  4QF2 A;  3M62 A;  4UP0 A;  1MM2 A;  3GL6 A;  2LGL A;  2L80 A;  2VJE A;  2G45 A;  2MNY A;  2M6M A;  2VPB A;  4ZQL A;  4N4F A;  5D1L B;  1G25 A;  4BBQ A;  4MVT A;  4AYC B;  4AYC A;  1X4U A;  2Y1M A;  2M3H A;  4I7D A;  1WEV A;  3FL2 A;  2YQM A;  3ZVY A;  2MA5 A;  4FIP A;  5AIT A;  4LLB A;  2ZET C;  2KWK A;  3EB5 A;  3HTK C;  5G04 B;  2EA6 A;  2KIZ A;  5I3L A;  4WZ2 A;  3ZVZ B;  3KV5 A;  2KR4 A;  3DQV R;  3KQI A;  2MD8 C;  5C13 A;  5TRB A;  1LDK C;  4W4U A;  4N3W A;  2HDP A;  2YYR A;  5FEY A;  2C2V S;  2KE1 A;  2OXQ C;  5JG6 A;  2RSD A;  4UI9 B;  2Y43 A;  5DKA A;  2HYE D;  4A49 A;  2K17 A;  1WFK A;  4A4C A;  1X4J A;  2FSA A;  3O37 A;  2ECV A;  2XEU A;  2K1J A;  2QIZ A;  2PNX A;  5KH7 A;  4B86 C;  2YU4 A;  3PUR A;  2JMD A;  4WZ0 A;  5D1K B;  4CCG X;  2YW8 A;  5EYA F;  3RTR B;  3U5P A;  2MUM A;  1WEM A;  4A4B A;  2JMJ A;  3HCS A;  2L5U A;  3ZPV 1;  2NAA A;  1Z6U A;  1X4I A;  3MHS A;  3V43 A;  2M1R A;  3N9O A;  4GNF A;  3N9M A;  5B79 A;  4LAD B;  1WIM A;  2ECT A;  1HYI A;  2XB1 A;  4YAD A;  5B75 A;  1WES A;  2F6N A;  3O7A A;  4P5O B;  2MNZ A;  5H1U A;  2VPD A;  1U6G B;  1VD4 A;  3IHP A;  5LKZ A;  5H9M A;  2VNF A;  4YBM A;  3RPG B;  2LRI C;  1WEQ A;  2ECN A; 
#chains in the Genus database with same CATH topology
 4X3G A;  1WEW A;  2KKY A;  5TBN A;  2EOD A;  4S3O C;  4WZ3 B;  2KGI A;  2L43 A;  3LQH A;  2KYU A;  2L7P A;  3HCT A;  2CKL B;  2CKL A;  5G05 B;  3O33 A;  4GB0 A;  2VPE A;  2M85 A;  1CHC A;  1Z60 A;  2G43 A;  3U5M A;  4AVX A;  2EXU A;  4ZUX U;  2XP0 A;  5TDR A;  4OGE A;  2BAY A;  2CSZ A;  3L11 A;  4O64 A;  5FB0 A;  2UZG A;  2YRE A;  4I7C A;  3PHD A;  2FUI A;  5B8D A;  4LJN A;  5G0F A;  2YQL A;  4PPE A;  2KWN A;  4GNG A;  2RI7 A;  3LJU X;  2CRW A;  2ECG A;  2KWO A;  2CSV A;  3GV4 A;  2RR4 A;  2I50 A;  2XOZ A;  4Q6F A;  4C9Z A;  1V87 A;  3H7H A;  1WEP A;  1N87 A;  1MM3 A;  3L1X A;  3C6W A;  3ZNI A;  2K16 A;  2G6Q A;  1JOC A;  2QIC A;  4H9D A;  5TDW A;  1F62 A;  1WIL A;  2LN0 A;  3DDT A;  5B76 A;  4B7Y C;  4FJC A;  4YAX A;  5H1V A;  3U5O A;  2YVR A;  2LGV A;  3N9L A;  2MIQ A;  2E6R A;  3LRQ A;  1FP0 A;  4QQ4 A;  2IQJ A;  4IC2 A;  5B78 A;  4OGC A;  3MHH A;  2E61 A;  2LGK A;  2ECI A;  3EB6 A;  2CSY A;  3ASL A;  5K3Q A;  1WGM A;  1RMD A;  4R7E A;  2YHO A;  5J3X A;  2JUN A;  5KH3 A;  4AP4 A;  4FO9 A;  3FEH A;  1JM7 B;  2MD7 B;  1JM7 A;  3SHB A;  2K4D A;  3N9P A;  5C11 A;  4YBT A;  2XOY A;  3SOW A;  1ZBD B;  3M63 A;  5B77 A;  2DX8 A;  2KWJ A;  2FD4 A;  4CA1 A;  3T9K A;  2JMI A;  4LK9 A;  3LQI A;  2LAU A;  1WEO A;  3KNV A;  4ZDT A;  3M7K A;  2VP7 A;  3HCU A;  3VK6 A;  1LDJ B;  2EGM A;  3O35 A;  4NN2 A;  2YUC A;  5H1T A;  2LXH C;  3DWD A;  2D8U A;  4PTB A;  2IDA A;  2VJE B;  3KV6 A;  4YC9 A;  2XOC A;  4YBS A;  2AN6 A;  5SVI B;  5SVI A;  3E2D A;  2CT2 A;  2QJ0 A;  3SOX A;  4TKP B;  3T6R A;  4I7B A;  2KRE A;  4GND A;  4LKA A;  2D8S A;  3O36 A;  2LV9 A;  2LDR A;  4S3O B;  1BOR A;  1IYM A;  2YT5 A;  5TAB A;  4YAB A;  4FK5 A;  3LVR E;  3T7L A;  3FAO A;  5LKT A;  4AUQ B;  2KU3 A;  3C5K A;  4R2Y A;  1WEU A;  2KFT A;  3ZYQ A;  5LKU A;  4V3K C;  2ECJ A;  4F1P A;  3QZV A;  2LQ6 A;  3LQJ A;  2YHN A;  4Z0R A;  4A0C D;  2MKE A;  1DVP A;  1FBV A;  4BHW A;  2F6J A;  1T1H A;  2YSM A;  2F42 A;  2ECW A;  2DJA A;  3SOU A;  4XI1 A;  4GNE A;  1WE9 A;  4QF3 A;  2OWA A;  2YUR A;  4IC3 A;  2CON A;  2L0B A;  4F52 B;  5LKX A;  1MBM A;  5FB1 A;  2C2L A;  2MT5 A;  4YAT A;  3O34 A;  4UP5 A;  3RPG C;  5FER A;  5LCW B;  3U5N A;  3M99 A;  2VPG A;  1VFY A;  2L75 A;  2Y1N A;  2E6S A;  2FUU A;  1WEN A;  4R8P K;  5KH9 A;  3ZTG A;  1XWH A;  2MA6 A;  3N9N A;  3O70 A;  5DIN A;  2LXP C;  4V3L C;  3JUE A;  5D1M B;  3MDB C;  1WEE A;  3PLW A;  1K2F A;  2DSM A;  1VYX A;  2JRJ A;  3I2D A;  1HYJ A;  2KGG A;  3N9Q A;  2CRR A;  5AIU A;  4MSX A;  3L1Z B;  3PUQ A;  1Z2Q A;  2PUY A;  2H0D B;  2VJF B;  4L7X A;  2H0D A;  2VJF A;  2LGG A;  3DPL R;  2EGP A;  1E4U A;  3FAN A;  2YSJ A;  3NG2 A;  3ZPV E;  2B0O E;  4WA6 A;  4L58 A;  4QF2 A;  3M62 A;  3Q1D A;  4UP0 A;  1MM2 A;  2P57 A;  3GL6 A;  2LGL A;  2L80 A;  2VJE A;  2G45 A;  2MNY A;  2FFW A;  2M6M A;  2VPB A;  4ZQL A;  4N4F A;  5D1L B;  1G25 A;  1DCQ A;  4BBQ A;  4MVT A;  4AYC B;  4AYC A;  1X4U A;  2Y1M A;  2M3H A;  4I7D A;  1WEV A;  3FL2 A;  2YQM A;  3ZVY A;  2MA5 A;  4FIP A;  5AIT A;  4LLB A;  2ZET C;  2KWK A;  3EB5 A;  3HTK C;  5G04 B;  2EA6 A;  2KIZ A;  4Z0O A;  5I3L A;  4WZ2 A;  3ZVZ B;  3KV5 A;  2KR4 A;  3DQV R;  3KQI A;  2MD8 C;  5C13 A;  5TRB A;  2KKX A;  1LDK C;  4W4U A;  4N3W A;  2HDP A;  2YYR A;  5FEY A;  3FM8 C;  2C2V S;  2KE1 A;  2OXQ C;  5JG6 A;  2RSD A;  4UI9 B;  2Y43 A;  5DKA A;  2HYE D;  4A49 A;  2K17 A;  3O47 A;  1WFK A;  3LVQ E;  4A4C A;  1X4J A;  2FSA A;  3FJU B;  3O37 A;  2ECV A;  5SVX A;  2XEU A;  2K1J A;  2QIZ A;  2PNX A;  5KH7 A;  4B86 C;  2YU4 A;  3PUR A;  2JMD A;  2M13 A;  4WZ0 A;  5D1K B;  4CCG X;  2YW8 A;  5EYA F;  3RTR B;  3SUB A;  3U5P A;  2MUM A;  1WEM A;  4A4B A;  2JMJ A;  3HCS A;  2L5U A;  3ZPV 1;  2NAA A;  1Z6U A;  1X4I A;  3MHS A;  5SVY A;  3V43 A;  2M1R A;  3N9O A;  4GNF A;  3N9M A;  5B79 A;  4LAD B;  1WIM A;  2ECT A;  1HYI A;  2XB1 A;  4YAD A;  4O62 A;  5B75 A;  1WES A;  2F6N A;  3O7A A;  4P5O B;  2MNZ A;  5H1U A;  2VPD A;  1U6G B;  2JM3 A;  1VD4 A;  3IHP A;  5LKZ A;  5H9M A;  3LDY A;  2VNF A;  4YBM A;  3RPG B;  2LRI C;  3KDE C;  1WEQ A;  2ECN A; 
#chains in the Genus database with same CATH homology
 4X3G A;  1WEW A;  5TBN A;  2EOD A;  4S3O C;  4WZ3 B;  2KGI A;  2L43 A;  3LQH A;  2KYU A;  3HCT A;  2CKL B;  2CKL A;  5G05 B;  3O33 A;  4GB0 A;  2VPE A;  2M85 A;  1CHC A;  1Z60 A;  2G43 A;  3U5M A;  4AVX A;  4ZUX U;  5TDR A;  2BAY A;  2CSZ A;  3L11 A;  4O64 A;  5FB0 A;  2UZG A;  2YRE A;  4I7C A;  3PHD A;  2FUI A;  5B8D A;  4LJN A;  5G0F A;  2YQL A;  4PPE A;  2KWN A;  4GNG A;  2RI7 A;  2ECG A;  2KWO A;  3GV4 A;  2I50 A;  4Q6F A;  4C9Z A;  1V87 A;  1WEP A;  1N87 A;  1MM3 A;  3L1X A;  3C6W A;  3ZNI A;  2K16 A;  2G6Q A;  1JOC A;  2QIC A;  5TDW A;  1F62 A;  1WIL A;  2LN0 A;  5B76 A;  4B7Y C;  4FJC A;  4YAX A;  5H1V A;  3U5O A;  2LGV A;  3N9L A;  2MIQ A;  2E6R A;  3LRQ A;  1FP0 A;  4IC2 A;  5B78 A;  3MHH A;  2LGK A;  2ECI A;  3EB6 A;  2CSY A;  3ASL A;  1WGM A;  1RMD A;  4R7E A;  2YHO A;  5J3X A;  5KH3 A;  4AP4 A;  4FO9 A;  1JM7 B;  2MD7 B;  1JM7 A;  3SHB A;  2K4D A;  3N9P A;  5C11 A;  4YBT A;  3SOW A;  1ZBD B;  3M63 A;  5B77 A;  2DX8 A;  2KWJ A;  4CA1 A;  2JMI A;  4LK9 A;  3LQI A;  1WEO A;  3KNV A;  4ZDT A;  2VP7 A;  3HCU A;  3VK6 A;  1LDJ B;  3O35 A;  4NN2 A;  2YUC A;  5H1T A;  2LXH C;  4PTB A;  2IDA A;  2VJE B;  3KV6 A;  4YC9 A;  4YBS A;  2AN6 A;  2CT2 A;  2QJ0 A;  3SOX A;  4TKP B;  3T6R A;  4I7B A;  2KRE A;  4GND A;  4LKA A;  2D8S A;  3O36 A;  2LV9 A;  2LDR A;  4S3O B;  1BOR A;  1IYM A;  2YT5 A;  5TAB A;  4YAB A;  4FK5 A;  3T7L A;  5LKT A;  4AUQ B;  2KU3 A;  3C5K A;  4R2Y A;  1WEU A;  2KFT A;  3ZYQ A;  5LKU A;  4V3K C;  2ECJ A;  3QZV A;  2LQ6 A;  3LQJ A;  2YHN A;  4A0C D;  1DVP A;  1FBV A;  4BHW A;  2F6J A;  1T1H A;  2YSM A;  2F42 A;  2ECW A;  3SOU A;  4XI1 A;  4GNE A;  1WE9 A;  4QF3 A;  2YUR A;  4IC3 A;  2L0B A;  4F52 B;  5LKX A;  5FB1 A;  2C2L A;  2MT5 A;  4YAT A;  3O34 A;  4UP5 A;  3RPG C;  5FER A;  5LCW B;  3U5N A;  3M99 A;  2VPG A;  1VFY A;  2L75 A;  2Y1N A;  2FUU A;  2E6S A;  1WEN A;  4R8P K;  5KH9 A;  3ZTG A;  1XWH A;  2MA6 A;  3N9N A;  3O70 A;  5DIN A;  2LXP C;  4V3L C;  5D1M B;  1WEE A;  1K2F A;  1VYX A;  2JRJ A;  3I2D A;  1HYJ A;  2KGG A;  3N9Q A;  5AIU A;  4MSX A;  3L1Z B;  3PUQ A;  1Z2Q A;  2PUY A;  2H0D B;  2VJF B;  4L7X A;  2H0D A;  2VJF A;  2LGG A;  3DPL R;  2EGP A;  1E4U A;  2YSJ A;  3NG2 A;  3ZPV E;  4WA6 A;  4L58 A;  4QF2 A;  3M62 A;  4UP0 A;  1MM2 A;  3GL6 A;  2LGL A;  2L80 A;  2VJE A;  2G45 A;  2MNY A;  2M6M A;  2VPB A;  4ZQL A;  4N4F A;  5D1L B;  1G25 A;  4BBQ A;  4MVT A;  4AYC B;  4AYC A;  1X4U A;  2Y1M A;  2M3H A;  4I7D A;  1WEV A;  3FL2 A;  2YQM A;  3ZVY A;  2MA5 A;  4FIP A;  5AIT A;  4LLB A;  2ZET C;  2KWK A;  3EB5 A;  3HTK C;  5G04 B;  2EA6 A;  2KIZ A;  5I3L A;  4WZ2 A;  3ZVZ B;  3KV5 A;  2KR4 A;  3DQV R;  3KQI A;  2MD8 C;  5C13 A;  5TRB A;  1LDK C;  4W4U A;  4N3W A;  2HDP A;  2YYR A;  5FEY A;  2C2V S;  2KE1 A;  2OXQ C;  5JG6 A;  2RSD A;  4UI9 B;  2Y43 A;  5DKA A;  2HYE D;  4A49 A;  2K17 A;  1WFK A;  4A4C A;  1X4J A;  2FSA A;  3O37 A;  2ECV A;  2XEU A;  2K1J A;  2QIZ A;  2PNX A;  5KH7 A;  4B86 C;  2YU4 A;  3PUR A;  2JMD A;  4WZ0 A;  5D1K B;  4CCG X;  2YW8 A;  5EYA F;  3RTR B;  3U5P A;  2MUM A;  1WEM A;  4A4B A;  2JMJ A;  3HCS A;  2L5U A;  3ZPV 1;  2NAA A;  1Z6U A;  1X4I A;  3MHS A;  3V43 A;  2M1R A;  3N9O A;  4GNF A;  3N9M A;  5B79 A;  4LAD B;  1WIM A;  2ECT A;  1HYI A;  2XB1 A;  4YAD A;  5B75 A;  1WES A;  2F6N A;  3O7A A;  4P5O B;  2MNZ A;  5H1U A;  2VPD A;  1U6G B;  1VD4 A;  3IHP A;  5LKZ A;  5H9M A;  2VNF A;  4YBM A;  3RPG B;  2LRI C;  1WEQ A;  2ECN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...