2VPGA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
b'MAVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 15
structure length 61
sequence length 61
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpgA00
2L43A 2PNXA 4QF3A 3N9NA 5AIUA 4WZ2A 5D1MB 4XI1A 2KR4A 5D1LB 1LDJB 3FL2A 3U5NA 2KWNA 4Q6FA 1K2FA 1X4UA 2ECGA 2RSDA 4FO9A 4BBQA 2Y43A 4CCGX 4FIPA 1HYIA 3LQIA 3QZVA 4MVTA 4W4UA 2L75A 1F62A 2KREA 3MHSA 4FJCA 5H1UA 2YW8A 4ZQLA 2CSZA 5B77A 2YQMA 2EGPA 1HYJA 2LGLA 2K17A 1WEQA 1T1HA 2XB1A 1VFYA 2H0DB 5TABA 2LGGA 4QF2A 4UP0A 2VPGA 1WILA 2LQ6A 3L11A 3PHDA 3LQJA 2YURA 2ECJA 2LV9A 3T6RA 3GL6A 4GNEA 1DVPA 2YYRA 1FBVA 5C13A 3PURA 4LKAA 2YQLA 2CT2A 2ECVA 2D8SA 2KU3A 4ZUXU 1LDKC 2ECIA 2CSYA 2VPEA 2EODA 1VYXA 4AYCB 2MD7B 2YSJA 3ASLA 2LXHC 3N9PA 3EB5A 1BORA 3N9OA 5J3XA 5LKXA 1WE9A 2C2VS 5G0FA 2MUMA 2M1RA 5FB1A 5FERA 2KWKA 1MM2A 3O36A 3M99A 1U6GB 2MA6A 5KH3A 2YHOA 2G45A 2MNYA 5TDRA 4CA1A 2K1JA 2JMJA 5C11A 4AP4A 2QICA 3PUQA 2UZGA 4GNDA 5DINA 2NAAA 1MM3A 2AN6A 2H0DA 2G6QA 4UI9B 5LKTA 2JRJA 5B75A 5FEYA 4S3OB 3U5PA 4P5OB 2VPDA 4MSXA 3M62A 3RPGB 2HYED 3ZTGA 2CKLB 5LCWB 3U5MA 3DPLR 3U5OA 3ZPVE 4YC9A 2Y1NA 1JM7B 2L80A 1JOCA 1ZBDB 4AYCA 3N9LA 2FSAA 4O64A 2RI7A 4GB0A 5TRBA 3ZNIA 2KE1A 3DQVR 2F42A 3KNVA 4LLBA 5AITA 2VJEB 1E4UA 3O34A 1X4IA 4N4FA 2KGGA 4R7EA 2ECNA 4YBMA 2MA5A 4WA6A 4BHWA 3SOXA 4WZ0A 4I7CA 2HDPA 2KWOA 4YBTA 5G05B 3SOUA 5EYAF 1WEMA 2FUIA 4A4CA 2M3HA 2KGIA 2OXQC 5B79A 3GV4A 5LKZA 1RMDA 1WEWA 1WENA 4FK5A 3HCSA 3N9QA 3KQIA 3C5KA 2E6RA 3L1XA 3LRQA 2LXPC 2YHNA 2M85A 4R2YA 4V3KC 3T7LA 2F6NA 4A49A 1Z6UA 3MHHA 1IYMA 4L58A 2CKLA 5LKUA 3O33A 5H1TA 4F52B 4PTBA 1VD4A 2Y1MA 2XEUA 3NG2A 4B86C 2VP7A 2MIQA 1JM7A 3ZYQA 2M6MA 4I7DA 2DX8A 4TKPB 2KIZA 2BAYA 3O70A 1WEEA 1WEUA 2G43A 3HTKC 3I2DA 1N87A 3SHBA 3O7AA 5B8DA 1WEOA 2VJEA 3ZVYA 2QJ0A 2ECTA 2MNZA 3RPGC 2F6JA 2KYUA 4YABA 2YSMA 1Z2QA 2LGVA 4X3GA 5JG6A 2VNFA 2K16A 4C9ZA 2I50A 4A0CD 5G04B 4LJNA 1V87A 4YATA 5H1VA 3SOWA 2E6SA 2LN0A 3C6WA 3O37A 5B76A 2C2LA 2JMIA 4NN2A 1WFKA 5B78A 4L7XA 4A4BA 4GNFA 4LADB 2YUCA 2FUUA 4GNGA 1WEPA 2YU4A 1FP0A 4YADA 3ZVZB 4YBSA 2PUYA 2IDAA 1Z60A 2LGKA 1WESA 5KH7A 5TBNA 4AUQB 4UP5A 5TDWA 3O35A 4B7YC 2KFTA 3IHPA 1WGMA 5DKAA 3EB6A 4YAXA 3HCTA 5D1KB 2L0BA 1WIMA 2KWJA 3M63A 1X4JA 2VJFA 4AVXA 2ZETC 4PPEA 2K4DA 3N9MA 5I3LA 2L5UA 2EA6A 3L1ZB 1XWHA 4WZ3B 2MD8C 4N3WA 4R8PK 5FB0A 2YT5A 2VPBA 1WEVA 3KV5A 3KV6A 5H9MA 3V43A 2LRIC 3LQHA 3VK6A 5KH9A 1CHCA 3ZPV1 2VJFB 2QIZA 4ZDTA 2JMDA 2MT5A 3RTRB 4LK9A 2ECWA 4IC3A 2YREA 1G25A 4IC2A 4V3LC 2LDRA 4S3OC 3HCUA 4I7BA
chains in the Genus database with same CATH superfamily
2L43A 2PNXA 4QF3A 3N9NA 5SVIA 2CRRA 5AIUA 4WZ2A 5D1MB 4XI1A 2FD4A 2KR4A 5D1LB 1LDJB 2KKYA 3FL2A 3U5NA 2KWNA 4Q6FA 1K2FA 1X4UA 2ECGA 2RSDA 4FO9A 4BBQA 2Y43A 3O47A 4CCGX 4FIPA 1HYIA 3LQIA 3QZVA 4MVTA 4W4UA 2L75A 1F62A 2KREA 3MHSA 4FJCA 5H1UA 2YW8A 4ZQLA 2CSZA 5B77A 2YQMA 2EGPA 1HYJA 2LGLA 2K17A 1WEQA 1T1HA 2XB1A 1VFYA 2H0DB 5TABA 2LGGA 4QF2A 4UP0A 3JUEA 3LVQE 2VPGA 1WILA 2LQ6A 3L11A 3PHDA 3LQJA 2YURA 2ECJA 2LV9A 3T6RA 3GL6A 4GNEA 1DVPA 2YYRA 1FBVA 5C13A 3PURA 4LKAA 2YQLA 2CT2A 3SUBA 2ECVA 2D8SA 2KU3A 4ZUXU 1LDKC 2ECIA 2CSYA 2VPEA 2EODA 1VYXA 4AYCB 2MD7B 2JM3A 2YSJA 3ASLA 2LXHC 4F1PA 3N9PA 3EB5A 1BORA 3N9OA 5J3XA 5LKXA 1WE9A 2LAUA 3LVRE 2C2VS 5G0FA 4Z0RA 2MUMA 2M1RA 5FB1A 5FERA 2EXUA 3Q1DA 2KWKA 1MM2A 3O36A 3M99A 5SVYA 1U6GB 2MA6A 5KH3A 2YHOA 2G45A 2XP0A 2MNYA 5TDRA 4CA1A 2D8UA 5SVXA 2K1JA 2JMJA 5C11A 4AP4A 2QICA 3PUQA 2UZGA 3LJUX 4QQ4A 4GNDA 5DINA 3DDTA 2NAAA 1MM3A 2AN6A 2H0DA 2G6QA 3FM8C 4UI9B 5LKTA 2JRJA 5B75A 3KDEC 5FEYA 4S3OB 3U5PA 4P5OB 2OWAA 2VPDA 4MSXA 3M62A 3RPGB 2EGMA 2CSVA 2HYED 2CRWA 2M13A 3ZTGA 2CKLB 2XOZA 5LCWB 3U5MA 3DPLR 3FAOA 3U5OA 3ZPVE 4YC9A 2Y1NA 1JM7B 2L80A 1JOCA 1ZBDB 4AYCA 3N9LA 2FSAA 4O64A 2RI7A 4GB0A 5TRBA 3ZNIA 2KE1A 3DQVR 2F42A 3FEHA 3KNVA 4LLBA 2CONA 5AITA 2VJEB 1E4UA 3O34A 1X4IA 4N4FA 3LDYA 2KGGA 4R7EA 2ECNA 4OGEA 4YBMA 2E61A 2MA5A 4WA6A 4BHWA 3SOXA 2L7PA 4WZ0A 4I7CA 2HDPA 2KWOA 4YBTA 5G05B 3SOUA 2DSMA 5EYAF 1WEMA 2FUIA 4A4CA 2M3HA 2KGIA 2OXQC 5B79A 3GV4A 5LKZA 1RMDA 1WEWA 1WENA 4FK5A 3FANA 3HCSA 1DCQA 3N9QA 3KQIA 3C5KA 2E6RA 4H9DA 3L1XA 3LRQA 2LXPC 2YHNA 2JUNA 2M85A 4R2YA 4V3KC 1MBMA 4OGCA 3T7LA 2F6NA 3H7HA 4A49A 1Z6UA 3MHHA 1IYMA 4L58A 2CKLA 5LKUA 3O33A 5H1TA 4F52B 4PTBA 3M7KA 2P57A 1VD4A 2Y1MA 2XEUA 3NG2A 4B86C 2VP7A 2MIQA 1JM7A 5K3QA 3ZYQA 2M6MA 4I7DA 2DX8A 4TKPB 2KIZA 2BAYA 3O70A 1WEEA 1WEUA 2G43A 3HTKC 3I2DA 1N87A 3SHBA 2RR4A 3O7AA 5B8DA 1WEOA 2VJEA 3ZVYA 2QJ0A 2ECTA 3T9KA 2MNZA 3RPGC 2F6JA 2KYUA 4YABA 2YSMA 1Z2QA 2LGVA 4X3GA 5JG6A 2VNFA 2K16A 4C9ZA 2I50A 2B0OE 4A0CD 2YVRA 5G04B 2IQJA 4LJNA 1V87A 4YATA 5H1VA 2FFWA 3SOWA 2E6SA 2LN0A 3C6WA 3O37A 5B76A 2C2LA 2JMIA 4NN2A 1WFKA 5B78A 4L7XA 4A4BA 4GNFA 4LADB 2YUCA 2FUUA 4GNGA 1WEPA 3MDBC 2YU4A 1FP0A 4YADA 3ZVZB 4YBSA 2PUYA 2IDAA 2DJAA 1Z60A 2LGKA 1WESA 5SVIB 3E2DA 5KH7A 4Z0OA 5TBNA 4AUQB 4UP5A 5TDWA 3O35A 4B7YC 2KFTA 3IHPA 1WGMA 5DKAA 3EB6A 4YAXA 3DWDA 3HCTA 5D1KB 2L0BA 1WIMA 2KWJA 3M63A 1X4JA 2VJFA 4AVXA 2XOYA 2ZETC 4PPEA 2K4DA 3N9MA 3PLWA 5I3LA 2L5UA 2EA6A 3L1ZB 1XWHA 4WZ3B 2MD8C 2XOCA 4N3WA 4R8PK 5FB0A 2YT5A 2MKEA 2KKXA 2VPBA 1WEVA 3KV5A 3KV6A 5H9MA 3V43A 2LRIC 3FJUB 3LQHA 3VK6A 5KH9A 1CHCA 3ZPV1 2VJFB 2QIZA 4ZDTA 2JMDA 2MT5A 4O62A 3RTRB 4LK9A 2ECWA 4IC3A 2YREA 1G25A 4IC2A 4V3LC 2LDRA 4S3OC 3HCUA 4I7BA
chains in the Genus database with same CATH topology
2L43A 2PNXA 4QF3A 3N9NA 5AIUA 4WZ2A 5D1MB 4XI1A 2KR4A 5D1LB 1LDJB 3FL2A 3U5NA 2KWNA 4Q6FA 1K2FA 1X4UA 2ECGA 2RSDA 4FO9A 4BBQA 2Y43A 4CCGX 4FIPA 1HYIA 3LQIA 3QZVA 4MVTA 4W4UA 2L75A 1F62A 2KREA 3MHSA 4FJCA 5H1UA 2YW8A 4ZQLA 2CSZA 5B77A 2YQMA 2EGPA 1HYJA 2LGLA 2K17A 1WEQA 1T1HA 2XB1A 1VFYA 2H0DB 5TABA 2LGGA 4QF2A 4UP0A 2VPGA 1WILA 2LQ6A 3L11A 3PHDA 3LQJA 2YURA 2ECJA 2LV9A 3T6RA 3GL6A 4GNEA 1DVPA 2YYRA 1FBVA 5C13A 3PURA 4LKAA 2YQLA 2CT2A 2ECVA 2D8SA 2KU3A 4ZUXU 1LDKC 2ECIA 2CSYA 2VPEA 2EODA 1VYXA 4AYCB 2MD7B 2YSJA 3ASLA 2LXHC 3N9PA 3EB5A 1BORA 3N9OA 5J3XA 5LKXA 1WE9A 2C2VS 5G0FA 2MUMA 2M1RA 5FB1A 5FERA 2KWKA 1MM2A 3O36A 3M99A 1U6GB 2MA6A 5KH3A 2YHOA 2G45A 2MNYA 5TDRA 4CA1A 2K1JA 2JMJA 5C11A 4AP4A 2QICA 3PUQA 2UZGA 4GNDA 5DINA 2NAAA 1MM3A 2AN6A 2H0DA 2G6QA 4UI9B 5LKTA 2JRJA 5B75A 5FEYA 4S3OB 3U5PA 4P5OB 2VPDA 4MSXA 3M62A 3RPGB 2HYED 3ZTGA 2CKLB 5LCWB 3U5MA 3DPLR 3U5OA 3ZPVE 4YC9A 2Y1NA 1JM7B 2L80A 1JOCA 1ZBDB 4AYCA 3N9LA 2FSAA 4O64A 2RI7A 4GB0A 5TRBA 3ZNIA 2KE1A 3DQVR 2F42A 3KNVA 4LLBA 5AITA 2VJEB 1E4UA 3O34A 1X4IA 4N4FA 2KGGA 4R7EA 2ECNA 4YBMA 2MA5A 4WA6A 4BHWA 3SOXA 4WZ0A 4I7CA 2HDPA 2KWOA 4YBTA 5G05B 3SOUA 5EYAF 1WEMA 2FUIA 4A4CA 2M3HA 2KGIA 2OXQC 5B79A 3GV4A 5LKZA 1RMDA 1WEWA 1WENA 4FK5A 3HCSA 3N9QA 3KQIA 3C5KA 2E6RA 3L1XA 3LRQA 2LXPC 2YHNA 2M85A 4R2YA 4V3KC 3T7LA 2F6NA 4A49A 1Z6UA 3MHHA 1IYMA 4L58A 2CKLA 5LKUA 3O33A 5H1TA 4F52B 4PTBA 1VD4A 2Y1MA 2XEUA 3NG2A 4B86C 2VP7A 2MIQA 1JM7A 3ZYQA 2M6MA 4I7DA 2DX8A 4TKPB 2KIZA 2BAYA 3O70A 1WEEA 1WEUA 2G43A 3HTKC 3I2DA 1N87A 3SHBA 3O7AA 5B8DA 1WEOA 2VJEA 3ZVYA 2QJ0A 2ECTA 2MNZA 3RPGC 2F6JA 2KYUA 4YABA 2YSMA 1Z2QA 2LGVA 4X3GA 5JG6A 2VNFA 2K16A 4C9ZA 2I50A 4A0CD 5G04B 4LJNA 1V87A 4YATA 5H1VA 3SOWA 2E6SA 2LN0A 3C6WA 3O37A 5B76A 2C2LA 2JMIA 4NN2A 1WFKA 5B78A 4L7XA 4A4BA 4GNFA 4LADB 2YUCA 2FUUA 4GNGA 1WEPA 2YU4A 1FP0A 4YADA 3ZVZB 4YBSA 2PUYA 2IDAA 1Z60A 2LGKA 1WESA 5KH7A 5TBNA 4AUQB 4UP5A 5TDWA 3O35A 4B7YC 2KFTA 3IHPA 1WGMA 5DKAA 3EB6A 4YAXA 3HCTA 5D1KB 2L0BA 1WIMA 2KWJA 3M63A 1X4JA 2VJFA 4AVXA 2ZETC 4PPEA 2K4DA 3N9MA 5I3LA 2L5UA 2EA6A 3L1ZB 1XWHA 4WZ3B 2MD8C 4N3WA 4R8PK 5FB0A 2YT5A 2VPBA 1WEVA 3KV5A 3KV6A 5H9MA 3V43A 2LRIC 3LQHA 3VK6A 5KH9A 1CHCA 3ZPV1 2VJFB 2QIZA 4ZDTA 2JMDA 2MT5A 3RTRB 4LK9A 2ECWA 4IC3A 2YREA 1G25A 4IC2A 4V3LC 2LDRA 4S3OC 3HCUA 4I7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L43 A;  2PNX A;  4QF3 A;  3N9N A;  5AIU A;  4WZ2 A;  5D1M B;  4XI1 A;  2KR4 A;  5D1L B;  1LDJ B;  3FL2 A;  3U5N A;  2KWN A;  4Q6F A;  1K2F A;  1X4U A;  2ECG A;  2RSD A;  4FO9 A;  4BBQ A;  2Y43 A;  4CCG X;  4FIP A;  1HYI A;  3LQI A;  3QZV A;  4MVT A;  4W4U A;  2L75 A;  1F62 A;  2KRE A;  3MHS A;  4FJC A;  5H1U A;  2YW8 A;  4ZQL A;  2CSZ A;  5B77 A;  2YQM A;  2EGP A;  1HYJ A;  2LGL A;  2K17 A;  1WEQ A;  1T1H A;  2XB1 A;  1VFY A;  2H0D B;  5TAB A;  2LGG A;  4QF2 A;  4UP0 A;  2VPG A;  1WIL A;  2LQ6 A;  3L11 A;  3PHD A;  3LQJ A;  2YUR A;  2ECJ A;  2LV9 A;  3T6R A;  3GL6 A;  4GNE A;  1DVP A;  2YYR A;  1FBV A;  5C13 A;  3PUR A;  4LKA A;  2YQL A;  2CT2 A;  2ECV A;  2D8S A;  2KU3 A;  4ZUX U;  1LDK C;  2ECI A;  2CSY A;  2VPE A;  2EOD A;  1VYX A;  4AYC B;  2MD7 B;  2YSJ A;  3ASL A;  2LXH C;  3N9P A;  3EB5 A;  1BOR A;  3N9O A;  5J3X A;  5LKX A;  1WE9 A;  2C2V S;  5G0F A;  2MUM A;  2M1R A;  5FB1 A;  5FER A;  2KWK A;  1MM2 A;  3O36 A;  3M99 A;  1U6G B;  2MA6 A;  5KH3 A;  2YHO A;  2G45 A;  2MNY A;  5TDR A;  4CA1 A;  2K1J A;  2JMJ A;  5C11 A;  4AP4 A;  2QIC A;  3PUQ A;  2UZG A;  4GND A;  5DIN A;  2NAA A;  1MM3 A;  2AN6 A;  2H0D A;  2G6Q A;  4UI9 B;  5LKT A;  2JRJ A;  5B75 A;  5FEY A;  4S3O B;  3U5P A;  4P5O B;  2VPD A;  4MSX A;  3M62 A;  3RPG B;  2HYE D;  3ZTG A;  2CKL B;  5LCW B;  3U5M A;  3DPL R;  3U5O A;  3ZPV E;  4YC9 A;  2Y1N A;  1JM7 B;  2L80 A;  1JOC A;  1ZBD B;  4AYC A;  3N9L A;  2FSA A;  4O64 A;  2RI7 A;  4GB0 A;  5TRB A;  3ZNI A;  2KE1 A;  3DQV R;  2F42 A;  3KNV A;  4LLB A;  5AIT A;  2VJE B;  1E4U A;  3O34 A;  1X4I A;  4N4F A;  2KGG A;  4R7E A;  2ECN A;  4YBM A;  2MA5 A;  4WA6 A;  4BHW A;  3SOX A;  4WZ0 A;  4I7C A;  2HDP A;  2KWO A;  4YBT A;  5G05 B;  3SOU A;  5EYA F;  1WEM A;  2FUI A;  4A4C A;  2M3H A;  2KGI A;  2OXQ C;  5B79 A;  3GV4 A;  5LKZ A;  1RMD A;  1WEW A;  1WEN A;  4FK5 A;  3HCS A;  3N9Q A;  3KQI A;  3C5K A;  2E6R A;  3L1X A;  3LRQ A;  2LXP C;  2YHN A;  2M85 A;  4R2Y A;  4V3K C;  3T7L A;  2F6N A;  4A49 A;  1Z6U A;  3MHH A;  1IYM A;  4L58 A;  2CKL A;  5LKU A;  3O33 A;  5H1T A;  4F52 B;  4PTB A;  1VD4 A;  2Y1M A;  2XEU A;  3NG2 A;  4B86 C;  2VP7 A;  2MIQ A;  1JM7 A;  3ZYQ A;  2M6M A;  4I7D A;  2DX8 A;  4TKP B;  2KIZ A;  2BAY A;  3O70 A;  1WEE A;  1WEU A;  2G43 A;  3HTK C;  3I2D A;  1N87 A;  3SHB A;  3O7A A;  5B8D A;  1WEO A;  2VJE A;  3ZVY A;  2QJ0 A;  2ECT A;  2MNZ A;  3RPG C;  2F6J A;  2KYU A;  4YAB A;  2YSM A;  1Z2Q A;  2LGV A;  4X3G A;  5JG6 A;  2VNF A;  2K16 A;  4C9Z A;  2I50 A;  4A0C D;  5G04 B;  4LJN A;  1V87 A;  4YAT A;  5H1V A;  3SOW A;  2E6S A;  2LN0 A;  3C6W A;  3O37 A;  5B76 A;  2C2L A;  2JMI A;  4NN2 A;  1WFK A;  5B78 A;  4L7X A;  4A4B A;  4GNF A;  4LAD B;  2YUC A;  2FUU A;  4GNG A;  1WEP A;  2YU4 A;  1FP0 A;  4YAD A;  3ZVZ B;  4YBS A;  2PUY A;  2IDA A;  1Z60 A;  2LGK A;  1WES A;  5KH7 A;  5TBN A;  4AUQ B;  4UP5 A;  5TDW A;  3O35 A;  4B7Y C;  2KFT A;  3IHP A;  1WGM A;  5DKA A;  3EB6 A;  4YAX A;  3HCT A;  5D1K B;  2L0B A;  1WIM A;  2KWJ A;  3M63 A;  1X4J A;  2VJF A;  4AVX A;  2ZET C;  4PPE A;  2K4D A;  3N9M A;  5I3L A;  2L5U A;  2EA6 A;  3L1Z B;  1XWH A;  4WZ3 B;  2MD8 C;  4N3W A;  4R8P K;  5FB0 A;  2YT5 A;  2VPB A;  1WEV A;  3KV5 A;  3KV6 A;  5H9M A;  3V43 A;  2LRI C;  3LQH A;  3VK6 A;  5KH9 A;  1CHC A;  3ZPV 1;  2VJF B;  2QIZ A;  4ZDT A;  2JMD A;  2MT5 A;  3RTR B;  4LK9 A;  2ECW A;  4IC3 A;  2YRE A;  1G25 A;  4IC2 A;  4V3L C;  2LDR A;  4S3O C;  3HCU A;  4I7B A; 
#chains in the Genus database with same CATH topology
 2L43 A;  2PNX A;  4QF3 A;  3N9N A;  5SVI A;  2CRR A;  5AIU A;  4WZ2 A;  5D1M B;  4XI1 A;  2FD4 A;  2KR4 A;  5D1L B;  1LDJ B;  2KKY A;  3FL2 A;  3U5N A;  2KWN A;  4Q6F A;  1K2F A;  1X4U A;  2ECG A;  2RSD A;  4FO9 A;  4BBQ A;  2Y43 A;  3O47 A;  4CCG X;  4FIP A;  1HYI A;  3LQI A;  3QZV A;  4MVT A;  4W4U A;  2L75 A;  1F62 A;  2KRE A;  3MHS A;  4FJC A;  5H1U A;  2YW8 A;  4ZQL A;  2CSZ A;  5B77 A;  2YQM A;  2EGP A;  1HYJ A;  2LGL A;  2K17 A;  1WEQ A;  1T1H A;  2XB1 A;  1VFY A;  2H0D B;  5TAB A;  2LGG A;  4QF2 A;  4UP0 A;  3JUE A;  3LVQ E;  2VPG A;  1WIL A;  2LQ6 A;  3L11 A;  3PHD A;  3LQJ A;  2YUR A;  2ECJ A;  2LV9 A;  3T6R A;  3GL6 A;  4GNE A;  1DVP A;  2YYR A;  1FBV A;  5C13 A;  3PUR A;  4LKA A;  2YQL A;  2CT2 A;  3SUB A;  2ECV A;  2D8S A;  2KU3 A;  4ZUX U;  1LDK C;  2ECI A;  2CSY A;  2VPE A;  2EOD A;  1VYX A;  4AYC B;  2MD7 B;  2JM3 A;  2YSJ A;  3ASL A;  2LXH C;  4F1P A;  3N9P A;  3EB5 A;  1BOR A;  3N9O A;  5J3X A;  5LKX A;  1WE9 A;  2LAU A;  3LVR E;  2C2V S;  5G0F A;  4Z0R A;  2MUM A;  2M1R A;  5FB1 A;  5FER A;  2EXU A;  3Q1D A;  2KWK A;  1MM2 A;  3O36 A;  3M99 A;  5SVY A;  1U6G B;  2MA6 A;  5KH3 A;  2YHO A;  2G45 A;  2XP0 A;  2MNY A;  5TDR A;  4CA1 A;  2D8U A;  5SVX A;  2K1J A;  2JMJ A;  5C11 A;  4AP4 A;  2QIC A;  3PUQ A;  2UZG A;  3LJU X;  4QQ4 A;  4GND A;  5DIN A;  3DDT A;  2NAA A;  1MM3 A;  2AN6 A;  2H0D A;  2G6Q A;  3FM8 C;  4UI9 B;  5LKT A;  2JRJ A;  5B75 A;  3KDE C;  5FEY A;  4S3O B;  3U5P A;  4P5O B;  2OWA A;  2VPD A;  4MSX A;  3M62 A;  3RPG B;  2EGM A;  2CSV A;  2HYE D;  2CRW A;  2M13 A;  3ZTG A;  2CKL B;  2XOZ A;  5LCW B;  3U5M A;  3DPL R;  3FAO A;  3U5O A;  3ZPV E;  4YC9 A;  2Y1N A;  1JM7 B;  2L80 A;  1JOC A;  1ZBD B;  4AYC A;  3N9L A;  2FSA A;  4O64 A;  2RI7 A;  4GB0 A;  5TRB A;  3ZNI A;  2KE1 A;  3DQV R;  2F42 A;  3FEH A;  3KNV A;  4LLB A;  2CON A;  5AIT A;  2VJE B;  1E4U A;  3O34 A;  1X4I A;  4N4F A;  3LDY A;  2KGG A;  4R7E A;  2ECN A;  4OGE A;  4YBM A;  2E61 A;  2MA5 A;  4WA6 A;  4BHW A;  3SOX A;  2L7P A;  4WZ0 A;  4I7C A;  2HDP A;  2KWO A;  4YBT A;  5G05 B;  3SOU A;  2DSM A;  5EYA F;  1WEM A;  2FUI A;  4A4C A;  2M3H A;  2KGI A;  2OXQ C;  5B79 A;  3GV4 A;  5LKZ A;  1RMD A;  1WEW A;  1WEN A;  4FK5 A;  3FAN A;  3HCS A;  1DCQ A;  3N9Q A;  3KQI A;  3C5K A;  2E6R A;  4H9D A;  3L1X A;  3LRQ A;  2LXP C;  2YHN A;  2JUN A;  2M85 A;  4R2Y A;  4V3K C;  1MBM A;  4OGC A;  3T7L A;  2F6N A;  3H7H A;  4A49 A;  1Z6U A;  3MHH A;  1IYM A;  4L58 A;  2CKL A;  5LKU A;  3O33 A;  5H1T A;  4F52 B;  4PTB A;  3M7K A;  2P57 A;  1VD4 A;  2Y1M A;  2XEU A;  3NG2 A;  4B86 C;  2VP7 A;  2MIQ A;  1JM7 A;  5K3Q A;  3ZYQ A;  2M6M A;  4I7D A;  2DX8 A;  4TKP B;  2KIZ A;  2BAY A;  3O70 A;  1WEE A;  1WEU A;  2G43 A;  3HTK C;  3I2D A;  1N87 A;  3SHB A;  2RR4 A;  3O7A A;  5B8D A;  1WEO A;  2VJE A;  3ZVY A;  2QJ0 A;  2ECT A;  3T9K A;  2MNZ A;  3RPG C;  2F6J A;  2KYU A;  4YAB A;  2YSM A;  1Z2Q A;  2LGV A;  4X3G A;  5JG6 A;  2VNF A;  2K16 A;  4C9Z A;  2I50 A;  2B0O E;  4A0C D;  2YVR A;  5G04 B;  2IQJ A;  4LJN A;  1V87 A;  4YAT A;  5H1V A;  2FFW A;  3SOW A;  2E6S A;  2LN0 A;  3C6W A;  3O37 A;  5B76 A;  2C2L A;  2JMI A;  4NN2 A;  1WFK A;  5B78 A;  4L7X A;  4A4B A;  4GNF A;  4LAD B;  2YUC A;  2FUU A;  4GNG A;  1WEP A;  3MDB C;  2YU4 A;  1FP0 A;  4YAD A;  3ZVZ B;  4YBS A;  2PUY A;  2IDA A;  2DJA A;  1Z60 A;  2LGK A;  1WES A;  5SVI B;  3E2D A;  5KH7 A;  4Z0O A;  5TBN A;  4AUQ B;  4UP5 A;  5TDW A;  3O35 A;  4B7Y C;  2KFT A;  3IHP A;  1WGM A;  5DKA A;  3EB6 A;  4YAX A;  3DWD A;  3HCT A;  5D1K B;  2L0B A;  1WIM A;  2KWJ A;  3M63 A;  1X4J A;  2VJF A;  4AVX A;  2XOY A;  2ZET C;  4PPE A;  2K4D A;  3N9M A;  3PLW A;  5I3L A;  2L5U A;  2EA6 A;  3L1Z B;  1XWH A;  4WZ3 B;  2MD8 C;  2XOC A;  4N3W A;  4R8P K;  5FB0 A;  2YT5 A;  2MKE A;  2KKX A;  2VPB A;  1WEV A;  3KV5 A;  3KV6 A;  5H9M A;  3V43 A;  2LRI C;  3FJU B;  3LQH A;  3VK6 A;  5KH9 A;  1CHC A;  3ZPV 1;  2VJF B;  2QIZ A;  4ZDT A;  2JMD A;  2MT5 A;  4O62 A;  3RTR B;  4LK9 A;  2ECW A;  4IC3 A;  2YRE A;  1G25 A;  4IC2 A;  4V3L C;  2LDR A;  4S3O C;  3HCU A;  4I7B A; 
#chains in the Genus database with same CATH homology
 2L43 A;  2PNX A;  4QF3 A;  3N9N A;  5AIU A;  4WZ2 A;  5D1M B;  4XI1 A;  2KR4 A;  5D1L B;  1LDJ B;  3FL2 A;  3U5N A;  2KWN A;  4Q6F A;  1K2F A;  1X4U A;  2ECG A;  2RSD A;  4FO9 A;  4BBQ A;  2Y43 A;  4CCG X;  4FIP A;  1HYI A;  3LQI A;  3QZV A;  4MVT A;  4W4U A;  2L75 A;  1F62 A;  2KRE A;  3MHS A;  4FJC A;  5H1U A;  2YW8 A;  4ZQL A;  2CSZ A;  5B77 A;  2YQM A;  2EGP A;  1HYJ A;  2LGL A;  2K17 A;  1WEQ A;  1T1H A;  2XB1 A;  1VFY A;  2H0D B;  5TAB A;  2LGG A;  4QF2 A;  4UP0 A;  2VPG A;  1WIL A;  2LQ6 A;  3L11 A;  3PHD A;  3LQJ A;  2YUR A;  2ECJ A;  2LV9 A;  3T6R A;  3GL6 A;  4GNE A;  1DVP A;  2YYR A;  1FBV A;  5C13 A;  3PUR A;  4LKA A;  2YQL A;  2CT2 A;  2ECV A;  2D8S A;  2KU3 A;  4ZUX U;  1LDK C;  2ECI A;  2CSY A;  2VPE A;  2EOD A;  1VYX A;  4AYC B;  2MD7 B;  2YSJ A;  3ASL A;  2LXH C;  3N9P A;  3EB5 A;  1BOR A;  3N9O A;  5J3X A;  5LKX A;  1WE9 A;  2C2V S;  5G0F A;  2MUM A;  2M1R A;  5FB1 A;  5FER A;  2KWK A;  1MM2 A;  3O36 A;  3M99 A;  1U6G B;  2MA6 A;  5KH3 A;  2YHO A;  2G45 A;  2MNY A;  5TDR A;  4CA1 A;  2K1J A;  2JMJ A;  5C11 A;  4AP4 A;  2QIC A;  3PUQ A;  2UZG A;  4GND A;  5DIN A;  2NAA A;  1MM3 A;  2AN6 A;  2H0D A;  2G6Q A;  4UI9 B;  5LKT A;  2JRJ A;  5B75 A;  5FEY A;  4S3O B;  3U5P A;  4P5O B;  2VPD A;  4MSX A;  3M62 A;  3RPG B;  2HYE D;  3ZTG A;  2CKL B;  5LCW B;  3U5M A;  3DPL R;  3U5O A;  3ZPV E;  4YC9 A;  2Y1N A;  1JM7 B;  2L80 A;  1JOC A;  1ZBD B;  4AYC A;  3N9L A;  2FSA A;  4O64 A;  2RI7 A;  4GB0 A;  5TRB A;  3ZNI A;  2KE1 A;  3DQV R;  2F42 A;  3KNV A;  4LLB A;  5AIT A;  2VJE B;  1E4U A;  3O34 A;  1X4I A;  4N4F A;  2KGG A;  4R7E A;  2ECN A;  4YBM A;  2MA5 A;  4WA6 A;  4BHW A;  3SOX A;  4WZ0 A;  4I7C A;  2HDP A;  2KWO A;  4YBT A;  5G05 B;  3SOU A;  5EYA F;  1WEM A;  2FUI A;  4A4C A;  2M3H A;  2KGI A;  2OXQ C;  5B79 A;  3GV4 A;  5LKZ A;  1RMD A;  1WEW A;  1WEN A;  4FK5 A;  3HCS A;  3N9Q A;  3KQI A;  3C5K A;  2E6R A;  3L1X A;  3LRQ A;  2LXP C;  2YHN A;  2M85 A;  4R2Y A;  4V3K C;  3T7L A;  2F6N A;  4A49 A;  1Z6U A;  3MHH A;  1IYM A;  4L58 A;  2CKL A;  5LKU A;  3O33 A;  5H1T A;  4F52 B;  4PTB A;  1VD4 A;  2Y1M A;  2XEU A;  3NG2 A;  4B86 C;  2VP7 A;  2MIQ A;  1JM7 A;  3ZYQ A;  2M6M A;  4I7D A;  2DX8 A;  4TKP B;  2KIZ A;  2BAY A;  3O70 A;  1WEE A;  1WEU A;  2G43 A;  3HTK C;  3I2D A;  1N87 A;  3SHB A;  3O7A A;  5B8D A;  1WEO A;  2VJE A;  3ZVY A;  2QJ0 A;  2ECT A;  2MNZ A;  3RPG C;  2F6J A;  2KYU A;  4YAB A;  2YSM A;  1Z2Q A;  2LGV A;  4X3G A;  5JG6 A;  2VNF A;  2K16 A;  4C9Z A;  2I50 A;  4A0C D;  5G04 B;  4LJN A;  1V87 A;  4YAT A;  5H1V A;  3SOW A;  2E6S A;  2LN0 A;  3C6W A;  3O37 A;  5B76 A;  2C2L A;  2JMI A;  4NN2 A;  1WFK A;  5B78 A;  4L7X A;  4A4B A;  4GNF A;  4LAD B;  2YUC A;  2FUU A;  4GNG A;  1WEP A;  2YU4 A;  1FP0 A;  4YAD A;  3ZVZ B;  4YBS A;  2PUY A;  2IDA A;  1Z60 A;  2LGK A;  1WES A;  5KH7 A;  5TBN A;  4AUQ B;  4UP5 A;  5TDW A;  3O35 A;  4B7Y C;  2KFT A;  3IHP A;  1WGM A;  5DKA A;  3EB6 A;  4YAX A;  3HCT A;  5D1K B;  2L0B A;  1WIM A;  2KWJ A;  3M63 A;  1X4J A;  2VJF A;  4AVX A;  2ZET C;  4PPE A;  2K4D A;  3N9M A;  5I3L A;  2L5U A;  2EA6 A;  3L1Z B;  1XWH A;  4WZ3 B;  2MD8 C;  4N3W A;  4R8P K;  5FB0 A;  2YT5 A;  2VPB A;  1WEV A;  3KV5 A;  3KV6 A;  5H9M A;  3V43 A;  2LRI C;  3LQH A;  3VK6 A;  5KH9 A;  1CHC A;  3ZPV 1;  2VJF B;  2QIZ A;  4ZDT A;  2JMD A;  2MT5 A;  3RTR B;  4LK9 A;  2ECW A;  4IC3 A;  2YRE A;  1G25 A;  4IC2 A;  4V3L C;  2LDR A;  4S3O C;  3HCU A;  4I7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...