2M85A

Phd domain from human shprh
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
FNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase,ligase
molecule keywords E3 ubiquitin-protein ligase SHPRH
publication title PHD domain from human SHPRH.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 65
sequence length 65
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m85A00
5AITA 4I7BA 2VPBA 3GV4A 2YQLA 2KFTA 5LCWB 3SOXA 2F6NA 4CA1A 2VPGA 2YSMA 2YU4A 3QZVA 4N3WA 2KGGA 4F52B 5H1TA 2CKLA 5C11A 4YABA 4CCGX 4Q6FA 2RSDA 5D1LB 5B8DA 5TDWA 4S3OC 4A0CD 1JM7B 3L1ZB 4AYCA 3O7AA 5AIUA 5B77A 5DKAA 1WIMA 2KYUA 3U5NA 3PHDA 2PNXA 1WEVA 4UI9B 3HTKC 4S3OB 3DPLR 3KV6A 2CSZA 2Y1MA 1N87A 5C13A 2M85A 3DQVR 2ECGA 5LKUA 2FUIA 2HYED 2AN6A 2LGVA 3MHSA 4WZ2A 3O35A 1Z60A 1VYXA 4YBMA 2L0BA 2F42A 3LQJA 3RPGC 3N9NA 4MVTA 1MM3A 1WFKA 3C6WA 5FEYA 1XWHA 4B86C 3SOUA 2MA6A 5FERA 3RPGB 2ZETC 5LKTA 2ECIA 4GNEA 4GNFA 1WESA 2VP7A 4X3GA 5H1UA 3M62A 3EB6A 3O70A 3ASLA 4AVXA 2EA6A 1WEQA 2BAYA 5TBNA 3N9MA 2K16A 1FP0A 3ZPVE 1X4IA 1WEPA 3RTRB 3O34A 5J3XA 4ZQLA 4I7CA 4R2YA 4A4BA 4LJNA 5TRBA 2ECNA 2VPEA 2LGKA 2FSAA 4BBQA 4V3LC 1WGMA 4IC3A 2E6RA 2M6MA 2VJFB 4W4UA 1CHCA 3ZVYA 2LGGA 3M99A 2K1JA 2YT5A 2EGPA 3LQHA 2C2VS 1VFYA 4PTBA 2QJ0A 2L75A 2L5UA 4R8PK 4LADB 3U5OA 3T6RA 2YHOA 5DINA 1LDJB 2KIZA 1RMDA 1K2FA 2C2LA 2K4DA 2MA5A 5B78A 4WZ3B 2MUMA 4YAXA 2MIQA 3HCTA 1LDKC 2LDRA 1IYMA 1WENA 3KQIA 5KH9A 2ECJA 2YYRA 4L58A 2YREA 4ZUXU 1HYJA 2F6JA 3N9LA 4R7EA 4XI1A 2YQMA 2M3HA 5I3LA 4V3KC 3ZVZB 2QICA 1ZBDB 2KE1A 4O64A 2L80A 2KWKA 3PUQA 3NG2A 3SHBA 2D8SA 1JM7A 5G05B 3PURA 1FBVA 1X4JA 3IHPA 4P5OB 1V87A 2XB1A 3MHHA 5D1MB 4TKPB 4GB0A 2K17A 1T1HA 2MNYA 2VJEB 1G25A 2FUUA 2KWNA 1WE9A 2YSJA 2LV9A 4B7YC 1WEOA 1Z2QA 4AP4A 2LQ6A 5H1VA 3U5MA 5G04B 2IDAA 4FIPA 3FL2A 2JMIA 4QF2A 3N9PA 2KWOA 3O33A 3VK6A 3I2DA 4QF3A 2HDPA 4L7XA 2YUCA 2Y43A 3LQIA 2H0DB 4LK9A 5TABA 1WILA 5FB1A 2ECWA 3SOWA 2VNFA 4IC2A 2CKLB 3GL6A 2VPDA 5FB0A 2LN0A 5LKZA 2KREA 4GNDA 2YHNA 2NAAA 4AYCB 5TDRA 4LLBA 5D1KB 4UP0A 4WA6A 2E6SA 2H0DA 2VJFA 2G45A 2RI7A 4FK5A 2MD8C 3O36A 4A49A 5B76A 3ZNIA 4N4FA 2LGLA 2YURA 2UZGA 4LKAA 1WEEA 1BORA 2KWJA 4A4CA 2LXPC 5G0FA 5H9MA 4YC9A 5JG6A 2JMDA 2I50A 5LKXA 2KGIA 1WEUA 2XEUA 2DX8A 4BHWA 4AUQB 3N9OA 5B79A 2MD7B 2ECTA 1Z6UA 3ZYQA 1WEWA 1VD4A 4YADA 1U6GB 2PUYA 2KR4A 2LRIC 1F62A 4FO9A 3EB5A 4FJCA 4YBTA 2EODA 2CT2A 2JMJA 2CSYA 1WEMA 3HCSA 2MT5A 2Y1NA 3L1XA 2MNZA 4PPEA 1DVPA 2KU3A 3ZPV1 3L11A 4C9ZA 3HCUA 3V43A 2ECVA 4ZDTA 3ZTGA 3T7LA 2G6QA 3O37A 5KH7A 3N9QA 2G43A 2LXHC 3LRQA 5KH3A 3C5KA 2VJEA 3KV5A 1JOCA 4MSXA 3U5PA 4YBSA 3M63A 2M1RA 3KNVA 2OXQC 2YW8A 5EYAF 4YATA 4NN2A 2JRJA 4GNGA 4UP5A 1E4UA 4I7DA 4WZ0A 1HYIA 5B75A 1MM2A 2L43A 1X4UA 2QIZA
chains in the Genus database with same CATH superfamily
5AITA 4I7BA 2VPBA 3GV4A 2YQLA 2KFTA 5LCWB 3SOXA 2F6NA 4CA1A 2VPGA 2YSMA 2YU4A 3QZVA 4N3WA 2KGGA 2LAUA 4F52B 5H1TA 2CKLA 3T9KA 5C11A 4YABA 4CCGX 4Q6FA 2RSDA 2EXUA 5D1LB 5B8DA 5TDWA 4S3OC 4A0CD 1JM7B 3MDBC 3L1ZB 4AYCA 3O7AA 5AIUA 5B77A 5DKAA 1MBMA 1WIMA 2CSVA 2KYUA 3U5NA 3PHDA 4O62A 2PNXA 1WEVA 4UI9B 3HTKC 4S3OB 3DPLR 3KV6A 2CSZA 2Y1MA 1N87A 5C13A 2M85A 3DQVR 2ECGA 5LKUA 2FUIA 2HYED 2AN6A 2LGVA 3MHSA 4WZ2A 3O35A 3H7HA 1Z60A 1VYXA 4YBMA 2L0BA 2F42A 3LQJA 3LJUX 3RPGC 3N9NA 4MVTA 1MM3A 1WFKA 3C6WA 5FEYA 1XWHA 4B86C 3FJUB 3SOUA 3O47A 2M13A 2MA6A 5FERA 3RPGB 2ZETC 5LKTA 2ECIA 4GNEA 4GNFA 1WESA 2VP7A 4X3GA 5H1UA 3M62A 3EB6A 3O70A 3ASLA 4AVXA 2EA6A 2YVRA 1WEQA 2BAYA 5TBNA 3N9MA 2K16A 1FP0A 3ZPVE 1X4IA 1WEPA 3RTRB 3O34A 5J3XA 4F1PA 4ZQLA 4I7CA 4R2YA 4A4BA 3JUEA 4LJNA 5TRBA 2ECNA 2VPEA 2LGKA 2FSAA 4BBQA 4V3LC 2IQJA 1WGMA 4IC3A 5K3QA 2E6RA 2M6MA 2VJFB 4W4UA 1CHCA 3ZVYA 2LGGA 3M99A 2K1JA 2JUNA 2YT5A 2EGPA 3LQHA 2C2VS 3DDTA 1VFYA 4PTBA 2QJ0A 2L75A 2L5UA 4R8PK 4LADB 3U5OA 3T6RA 2YHOA 5DINA 1LDJB 2KIZA 1RMDA 1K2FA 2C2LA 2K4DA 2MA5A 3FEHA 3LVRE 5B78A 4WZ3B 2MUMA 4YAXA 2MIQA 3HCTA 1LDKC 2LDRA 4QQ4A 1IYMA 1WENA 2DSMA 3KQIA 2MKEA 5KH9A 2ECJA 2YYRA 4L58A 2YREA 4ZUXU 1HYJA 2F6JA 3N9LA 4R7EA 2XOCA 4OGEA 3M7KA 4XI1A 2YQMA 2M3HA 2B0OE 5I3LA 4V3KC 3E2DA 3ZVZB 2QICA 1ZBDB 2KE1A 4O64A 2L80A 2KWKA 3PUQA 3NG2A 3SHBA 2D8SA 1JM7A 3DWDA 3PURA 5G05B 2P57A 1FBVA 1X4JA 3IHPA 4P5OB 1V87A 2XB1A 3MHHA 5D1MB 4TKPB 3PLWA 4GB0A 2K17A 1T1HA 2MNYA 2CRRA 2VJEB 1G25A 2FUUA 2CRWA 2KWNA 1WE9A 2YSJA 2LV9A 4B7YC 1WEOA 1Z2QA 4AP4A 2LQ6A 3LDYA 5H1VA 3U5MA 5G04B 2IDAA 4FIPA 3FL2A 2JMIA 3LVQE 5SVIB 4QF2A 3N9PA 2KWOA 3O33A 3VK6A 3I2DA 4QF3A 2HDPA 4L7XA 2YUCA 2Y43A 2KKYA 3LQIA 2H0DB 4LK9A 5TABA 4H9DA 1WILA 5FB1A 2ECWA 3SOWA 2VNFA 4IC2A 2CKLB 3GL6A 2VPDA 5FB0A 2LN0A 5LKZA 2CONA 2KREA 4GNDA 2YHNA 2NAAA 4AYCB 5TDRA 4LLBA 5D1KB 2JM3A 4UP0A 4WA6A 2E6SA 2H0DA 4Z0RA 2VJFA 2G45A 2RI7A 4FK5A 2MD8C 3O36A 4A49A 5B76A 3ZNIA 4N4FA 2LGLA 2OWAA 2KKXA 2YURA 2UZGA 4LKAA 1WEEA 1BORA 2KWJA 4A4CA 2LXPC 5G0FA 5H9MA 4YC9A 4OGCA 5JG6A 2JMDA 2I50A 5LKXA 1DCQA 2KGIA 1WEUA 5SVYA 2XEUA 2DX8A 4BHWA 4AUQB 3N9OA 5B79A 2MD7B 3SUBA 2ECTA 2FD4A 1Z6UA 3ZYQA 1WEWA 1VD4A 4YADA 1U6GB 2PUYA 2KR4A 2LRIC 1F62A 4FO9A 2D8UA 3EB5A 4FJCA 4YBTA 2EODA 2CT2A 2JMJA 2CSYA 1WEMA 3HCSA 2MT5A 2Y1NA 3Q1DA 3L1XA 2MNZA 4PPEA 1DVPA 2KU3A 3ZPV1 3L11A 4C9ZA 2EGMA 2E61A 3HCUA 3V43A 2DJAA 2ECVA 4ZDTA 2XP0A 3ZTGA 3T7LA 2G6QA 3O37A 5KH7A 3N9QA 2G43A 2LXHC 3LRQA 5KH3A 2XOZA 3C5KA 2VJEA 3KV5A 1JOCA 2XOYA 4MSXA 3U5PA 4YBSA 3M63A 3FAOA 2M1RA 5SVXA 3KNVA 2OXQC 2YW8A 5EYAF 3FANA 3FM8C 4YATA 4NN2A 4Z0OA 2JRJA 4GNGA 4UP5A 1E4UA 5SVIA 4I7DA 4WZ0A 2FFWA 2RR4A 5B75A 1MM2A 1HYIA 2L7PA 2L43A 1X4UA 2QIZA 3KDEC
chains in the Genus database with same CATH topology
5AITA 4I7BA 2VPBA 3GV4A 2YQLA 2KFTA 5LCWB 3SOXA 2F6NA 4CA1A 2VPGA 2YSMA 2YU4A 3QZVA 4N3WA 2KGGA 4F52B 5H1TA 2CKLA 5C11A 4YABA 4CCGX 4Q6FA 2RSDA 5D1LB 5B8DA 5TDWA 4S3OC 4A0CD 1JM7B 3L1ZB 4AYCA 3O7AA 5AIUA 5B77A 5DKAA 1WIMA 2KYUA 3U5NA 3PHDA 2PNXA 1WEVA 4UI9B 3HTKC 4S3OB 3DPLR 3KV6A 2CSZA 2Y1MA 1N87A 5C13A 2M85A 3DQVR 2ECGA 5LKUA 2FUIA 2HYED 2AN6A 2LGVA 3MHSA 4WZ2A 3O35A 1Z60A 1VYXA 4YBMA 2L0BA 2F42A 3LQJA 3RPGC 3N9NA 4MVTA 1MM3A 1WFKA 3C6WA 5FEYA 1XWHA 4B86C 3SOUA 2MA6A 5FERA 3RPGB 2ZETC 5LKTA 2ECIA 4GNEA 4GNFA 1WESA 2VP7A 4X3GA 5H1UA 3M62A 3EB6A 3O70A 3ASLA 4AVXA 2EA6A 1WEQA 2BAYA 5TBNA 3N9MA 2K16A 1FP0A 3ZPVE 1X4IA 1WEPA 3RTRB 3O34A 5J3XA 4ZQLA 4I7CA 4R2YA 4A4BA 4LJNA 5TRBA 2ECNA 2VPEA 2LGKA 2FSAA 4BBQA 4V3LC 1WGMA 4IC3A 2E6RA 2M6MA 2VJFB 4W4UA 1CHCA 3ZVYA 2LGGA 3M99A 2K1JA 2YT5A 2EGPA 3LQHA 2C2VS 1VFYA 4PTBA 2QJ0A 2L75A 2L5UA 4R8PK 4LADB 3U5OA 3T6RA 2YHOA 5DINA 1LDJB 2KIZA 1RMDA 1K2FA 2C2LA 2K4DA 2MA5A 5B78A 4WZ3B 2MUMA 4YAXA 2MIQA 3HCTA 1LDKC 2LDRA 1IYMA 1WENA 3KQIA 5KH9A 2ECJA 2YYRA 4L58A 2YREA 4ZUXU 1HYJA 2F6JA 3N9LA 4R7EA 4XI1A 2YQMA 2M3HA 5I3LA 4V3KC 3ZVZB 2QICA 1ZBDB 2KE1A 4O64A 2L80A 2KWKA 3PUQA 3NG2A 3SHBA 2D8SA 1JM7A 5G05B 3PURA 1FBVA 1X4JA 3IHPA 4P5OB 1V87A 2XB1A 3MHHA 5D1MB 4TKPB 4GB0A 2K17A 1T1HA 2MNYA 2VJEB 1G25A 2FUUA 2KWNA 1WE9A 2YSJA 2LV9A 4B7YC 1WEOA 1Z2QA 4AP4A 2LQ6A 5H1VA 3U5MA 5G04B 2IDAA 4FIPA 3FL2A 2JMIA 4QF2A 3N9PA 2KWOA 3O33A 3VK6A 3I2DA 4QF3A 2HDPA 4L7XA 2YUCA 2Y43A 3LQIA 2H0DB 4LK9A 5TABA 1WILA 5FB1A 2ECWA 3SOWA 2VNFA 4IC2A 2CKLB 3GL6A 2VPDA 5FB0A 2LN0A 5LKZA 2KREA 4GNDA 2YHNA 2NAAA 4AYCB 5TDRA 4LLBA 5D1KB 4UP0A 4WA6A 2E6SA 2H0DA 2VJFA 2G45A 2RI7A 4FK5A 2MD8C 3O36A 4A49A 5B76A 3ZNIA 4N4FA 2LGLA 2YURA 2UZGA 4LKAA 1WEEA 1BORA 2KWJA 4A4CA 2LXPC 5G0FA 5H9MA 4YC9A 5JG6A 2JMDA 2I50A 5LKXA 2KGIA 1WEUA 2XEUA 2DX8A 4BHWA 4AUQB 3N9OA 5B79A 2MD7B 2ECTA 1Z6UA 3ZYQA 1WEWA 1VD4A 4YADA 1U6GB 2PUYA 2KR4A 2LRIC 1F62A 4FO9A 3EB5A 4FJCA 4YBTA 2EODA 2CT2A 2JMJA 2CSYA 1WEMA 3HCSA 2MT5A 2Y1NA 3L1XA 2MNZA 4PPEA 1DVPA 2KU3A 3ZPV1 3L11A 4C9ZA 3HCUA 3V43A 2ECVA 4ZDTA 3ZTGA 3T7LA 2G6QA 3O37A 5KH7A 3N9QA 2G43A 2LXHC 3LRQA 5KH3A 3C5KA 2VJEA 3KV5A 1JOCA 4MSXA 3U5PA 4YBSA 3M63A 2M1RA 3KNVA 2OXQC 2YW8A 5EYAF 4YATA 4NN2A 2JRJA 4GNGA 4UP5A 1E4UA 4I7DA 4WZ0A 1HYIA 5B75A 1MM2A 2L43A 1X4UA 2QIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIT A;  4I7B A;  2VPB A;  3GV4 A;  2YQL A;  2KFT A;  5LCW B;  3SOX A;  2F6N A;  4CA1 A;  2VPG A;  2YSM A;  2YU4 A;  3QZV A;  4N3W A;  2KGG A;  4F52 B;  5H1T A;  2CKL A;  5C11 A;  4YAB A;  4CCG X;  4Q6F A;  2RSD A;  5D1L B;  5B8D A;  5TDW A;  4S3O C;  4A0C D;  1JM7 B;  3L1Z B;  4AYC A;  3O7A A;  5AIU A;  5B77 A;  5DKA A;  1WIM A;  2KYU A;  3U5N A;  3PHD A;  2PNX A;  1WEV A;  4UI9 B;  3HTK C;  4S3O B;  3DPL R;  3KV6 A;  2CSZ A;  2Y1M A;  1N87 A;  5C13 A;  2M85 A;  3DQV R;  2ECG A;  5LKU A;  2FUI A;  2HYE D;  2AN6 A;  2LGV A;  3MHS A;  4WZ2 A;  3O35 A;  1Z60 A;  1VYX A;  4YBM A;  2L0B A;  2F42 A;  3LQJ A;  3RPG C;  3N9N A;  4MVT A;  1MM3 A;  1WFK A;  3C6W A;  5FEY A;  1XWH A;  4B86 C;  3SOU A;  2MA6 A;  5FER A;  3RPG B;  2ZET C;  5LKT A;  2ECI A;  4GNE A;  4GNF A;  1WES A;  2VP7 A;  4X3G A;  5H1U A;  3M62 A;  3EB6 A;  3O70 A;  3ASL A;  4AVX A;  2EA6 A;  1WEQ A;  2BAY A;  5TBN A;  3N9M A;  2K16 A;  1FP0 A;  3ZPV E;  1X4I A;  1WEP A;  3RTR B;  3O34 A;  5J3X A;  4ZQL A;  4I7C A;  4R2Y A;  4A4B A;  4LJN A;  5TRB A;  2ECN A;  2VPE A;  2LGK A;  2FSA A;  4BBQ A;  4V3L C;  1WGM A;  4IC3 A;  2E6R A;  2M6M A;  2VJF B;  4W4U A;  1CHC A;  3ZVY A;  2LGG A;  3M99 A;  2K1J A;  2YT5 A;  2EGP A;  3LQH A;  2C2V S;  1VFY A;  4PTB A;  2QJ0 A;  2L75 A;  2L5U A;  4R8P K;  4LAD B;  3U5O A;  3T6R A;  2YHO A;  5DIN A;  1LDJ B;  2KIZ A;  1RMD A;  1K2F A;  2C2L A;  2K4D A;  2MA5 A;  5B78 A;  4WZ3 B;  2MUM A;  4YAX A;  2MIQ A;  3HCT A;  1LDK C;  2LDR A;  1IYM A;  1WEN A;  3KQI A;  5KH9 A;  2ECJ A;  2YYR A;  4L58 A;  2YRE A;  4ZUX U;  1HYJ A;  2F6J A;  3N9L A;  4R7E A;  4XI1 A;  2YQM A;  2M3H A;  5I3L A;  4V3K C;  3ZVZ B;  2QIC A;  1ZBD B;  2KE1 A;  4O64 A;  2L80 A;  2KWK A;  3PUQ A;  3NG2 A;  3SHB A;  2D8S A;  1JM7 A;  5G05 B;  3PUR A;  1FBV A;  1X4J A;  3IHP A;  4P5O B;  1V87 A;  2XB1 A;  3MHH A;  5D1M B;  4TKP B;  4GB0 A;  2K17 A;  1T1H A;  2MNY A;  2VJE B;  1G25 A;  2FUU A;  2KWN A;  1WE9 A;  2YSJ A;  2LV9 A;  4B7Y C;  1WEO A;  1Z2Q A;  4AP4 A;  2LQ6 A;  5H1V A;  3U5M A;  5G04 B;  2IDA A;  4FIP A;  3FL2 A;  2JMI A;  4QF2 A;  3N9P A;  2KWO A;  3O33 A;  3VK6 A;  3I2D A;  4QF3 A;  2HDP A;  4L7X A;  2YUC A;  2Y43 A;  3LQI A;  2H0D B;  4LK9 A;  5TAB A;  1WIL A;  5FB1 A;  2ECW A;  3SOW A;  2VNF A;  4IC2 A;  2CKL B;  3GL6 A;  2VPD A;  5FB0 A;  2LN0 A;  5LKZ A;  2KRE A;  4GND A;  2YHN A;  2NAA A;  4AYC B;  5TDR A;  4LLB A;  5D1K B;  4UP0 A;  4WA6 A;  2E6S A;  2H0D A;  2VJF A;  2G45 A;  2RI7 A;  4FK5 A;  2MD8 C;  3O36 A;  4A49 A;  5B76 A;  3ZNI A;  4N4F A;  2LGL A;  2YUR A;  2UZG A;  4LKA A;  1WEE A;  1BOR A;  2KWJ A;  4A4C A;  2LXP C;  5G0F A;  5H9M A;  4YC9 A;  5JG6 A;  2JMD A;  2I50 A;  5LKX A;  2KGI A;  1WEU A;  2XEU A;  2DX8 A;  4BHW A;  4AUQ B;  3N9O A;  5B79 A;  2MD7 B;  2ECT A;  1Z6U A;  3ZYQ A;  1WEW A;  1VD4 A;  4YAD A;  1U6G B;  2PUY A;  2KR4 A;  2LRI C;  1F62 A;  4FO9 A;  3EB5 A;  4FJC A;  4YBT A;  2EOD A;  2CT2 A;  2JMJ A;  2CSY A;  1WEM A;  3HCS A;  2MT5 A;  2Y1N A;  3L1X A;  2MNZ A;  4PPE A;  1DVP A;  2KU3 A;  3ZPV 1;  3L11 A;  4C9Z A;  3HCU A;  3V43 A;  2ECV A;  4ZDT A;  3ZTG A;  3T7L A;  2G6Q A;  3O37 A;  5KH7 A;  3N9Q A;  2G43 A;  2LXH C;  3LRQ A;  5KH3 A;  3C5K A;  2VJE A;  3KV5 A;  1JOC A;  4MSX A;  3U5P A;  4YBS A;  3M63 A;  2M1R A;  3KNV A;  2OXQ C;  2YW8 A;  5EYA F;  4YAT A;  4NN2 A;  2JRJ A;  4GNG A;  4UP5 A;  1E4U A;  4I7D A;  4WZ0 A;  1HYI A;  5B75 A;  1MM2 A;  2L43 A;  1X4U A;  2QIZ A; 
#chains in the Genus database with same CATH topology
 5AIT A;  4I7B A;  2VPB A;  3GV4 A;  2YQL A;  2KFT A;  5LCW B;  3SOX A;  2F6N A;  4CA1 A;  2VPG A;  2YSM A;  2YU4 A;  3QZV A;  4N3W A;  2KGG A;  2LAU A;  4F52 B;  5H1T A;  2CKL A;  3T9K A;  5C11 A;  4YAB A;  4CCG X;  4Q6F A;  2RSD A;  2EXU A;  5D1L B;  5B8D A;  5TDW A;  4S3O C;  4A0C D;  1JM7 B;  3MDB C;  3L1Z B;  4AYC A;  3O7A A;  5AIU A;  5B77 A;  5DKA A;  1MBM A;  1WIM A;  2CSV A;  2KYU A;  3U5N A;  3PHD A;  4O62 A;  2PNX A;  1WEV A;  4UI9 B;  3HTK C;  4S3O B;  3DPL R;  3KV6 A;  2CSZ A;  2Y1M A;  1N87 A;  5C13 A;  2M85 A;  3DQV R;  2ECG A;  5LKU A;  2FUI A;  2HYE D;  2AN6 A;  2LGV A;  3MHS A;  4WZ2 A;  3O35 A;  3H7H A;  1Z60 A;  1VYX A;  4YBM A;  2L0B A;  2F42 A;  3LQJ A;  3LJU X;  3RPG C;  3N9N A;  4MVT A;  1MM3 A;  1WFK A;  3C6W A;  5FEY A;  1XWH A;  4B86 C;  3FJU B;  3SOU A;  3O47 A;  2M13 A;  2MA6 A;  5FER A;  3RPG B;  2ZET C;  5LKT A;  2ECI A;  4GNE A;  4GNF A;  1WES A;  2VP7 A;  4X3G A;  5H1U A;  3M62 A;  3EB6 A;  3O70 A;  3ASL A;  4AVX A;  2EA6 A;  2YVR A;  1WEQ A;  2BAY A;  5TBN A;  3N9M A;  2K16 A;  1FP0 A;  3ZPV E;  1X4I A;  1WEP A;  3RTR B;  3O34 A;  5J3X A;  4F1P A;  4ZQL A;  4I7C A;  4R2Y A;  4A4B A;  3JUE A;  4LJN A;  5TRB A;  2ECN A;  2VPE A;  2LGK A;  2FSA A;  4BBQ A;  4V3L C;  2IQJ A;  1WGM A;  4IC3 A;  5K3Q A;  2E6R A;  2M6M A;  2VJF B;  4W4U A;  1CHC A;  3ZVY A;  2LGG A;  3M99 A;  2K1J A;  2JUN A;  2YT5 A;  2EGP A;  3LQH A;  2C2V S;  3DDT A;  1VFY A;  4PTB A;  2QJ0 A;  2L75 A;  2L5U A;  4R8P K;  4LAD B;  3U5O A;  3T6R A;  2YHO A;  5DIN A;  1LDJ B;  2KIZ A;  1RMD A;  1K2F A;  2C2L A;  2K4D A;  2MA5 A;  3FEH A;  3LVR E;  5B78 A;  4WZ3 B;  2MUM A;  4YAX A;  2MIQ A;  3HCT A;  1LDK C;  2LDR A;  4QQ4 A;  1IYM A;  1WEN A;  2DSM A;  3KQI A;  2MKE A;  5KH9 A;  2ECJ A;  2YYR A;  4L58 A;  2YRE A;  4ZUX U;  1HYJ A;  2F6J A;  3N9L A;  4R7E A;  2XOC A;  4OGE A;  3M7K A;  4XI1 A;  2YQM A;  2M3H A;  2B0O E;  5I3L A;  4V3K C;  3E2D A;  3ZVZ B;  2QIC A;  1ZBD B;  2KE1 A;  4O64 A;  2L80 A;  2KWK A;  3PUQ A;  3NG2 A;  3SHB A;  2D8S A;  1JM7 A;  3DWD A;  3PUR A;  5G05 B;  2P57 A;  1FBV A;  1X4J A;  3IHP A;  4P5O B;  1V87 A;  2XB1 A;  3MHH A;  5D1M B;  4TKP B;  3PLW A;  4GB0 A;  2K17 A;  1T1H A;  2MNY A;  2CRR A;  2VJE B;  1G25 A;  2FUU A;  2CRW A;  2KWN A;  1WE9 A;  2YSJ A;  2LV9 A;  4B7Y C;  1WEO A;  1Z2Q A;  4AP4 A;  2LQ6 A;  3LDY A;  5H1V A;  3U5M A;  5G04 B;  2IDA A;  4FIP A;  3FL2 A;  2JMI A;  3LVQ E;  5SVI B;  4QF2 A;  3N9P A;  2KWO A;  3O33 A;  3VK6 A;  3I2D A;  4QF3 A;  2HDP A;  4L7X A;  2YUC A;  2Y43 A;  2KKY A;  3LQI A;  2H0D B;  4LK9 A;  5TAB A;  4H9D A;  1WIL A;  5FB1 A;  2ECW A;  3SOW A;  2VNF A;  4IC2 A;  2CKL B;  3GL6 A;  2VPD A;  5FB0 A;  2LN0 A;  5LKZ A;  2CON A;  2KRE A;  4GND A;  2YHN A;  2NAA A;  4AYC B;  5TDR A;  4LLB A;  5D1K B;  2JM3 A;  4UP0 A;  4WA6 A;  2E6S A;  2H0D A;  4Z0R A;  2VJF A;  2G45 A;  2RI7 A;  4FK5 A;  2MD8 C;  3O36 A;  4A49 A;  5B76 A;  3ZNI A;  4N4F A;  2LGL A;  2OWA A;  2KKX A;  2YUR A;  2UZG A;  4LKA A;  1WEE A;  1BOR A;  2KWJ A;  4A4C A;  2LXP C;  5G0F A;  5H9M A;  4YC9 A;  4OGC A;  5JG6 A;  2JMD A;  2I50 A;  5LKX A;  1DCQ A;  2KGI A;  1WEU A;  5SVY A;  2XEU A;  2DX8 A;  4BHW A;  4AUQ B;  3N9O A;  5B79 A;  2MD7 B;  3SUB A;  2ECT A;  2FD4 A;  1Z6U A;  3ZYQ A;  1WEW A;  1VD4 A;  4YAD A;  1U6G B;  2PUY A;  2KR4 A;  2LRI C;  1F62 A;  4FO9 A;  2D8U A;  3EB5 A;  4FJC A;  4YBT A;  2EOD A;  2CT2 A;  2JMJ A;  2CSY A;  1WEM A;  3HCS A;  2MT5 A;  2Y1N A;  3Q1D A;  3L1X A;  2MNZ A;  4PPE A;  1DVP A;  2KU3 A;  3ZPV 1;  3L11 A;  4C9Z A;  2EGM A;  2E61 A;  3HCU A;  3V43 A;  2DJA A;  2ECV A;  4ZDT A;  2XP0 A;  3ZTG A;  3T7L A;  2G6Q A;  3O37 A;  5KH7 A;  3N9Q A;  2G43 A;  2LXH C;  3LRQ A;  5KH3 A;  2XOZ A;  3C5K A;  2VJE A;  3KV5 A;  1JOC A;  2XOY A;  4MSX A;  3U5P A;  4YBS A;  3M63 A;  3FAO A;  2M1R A;  5SVX A;  3KNV A;  2OXQ C;  2YW8 A;  5EYA F;  3FAN A;  3FM8 C;  4YAT A;  4NN2 A;  4Z0O A;  2JRJ A;  4GNG A;  4UP5 A;  1E4U A;  5SVI A;  4I7D A;  4WZ0 A;  2FFW A;  2RR4 A;  5B75 A;  1MM2 A;  1HYI A;  2L7P A;  2L43 A;  1X4U A;  2QIZ A;  3KDE C; 
#chains in the Genus database with same CATH homology
 5AIT A;  4I7B A;  2VPB A;  3GV4 A;  2YQL A;  2KFT A;  5LCW B;  3SOX A;  2F6N A;  4CA1 A;  2VPG A;  2YSM A;  2YU4 A;  3QZV A;  4N3W A;  2KGG A;  4F52 B;  5H1T A;  2CKL A;  5C11 A;  4YAB A;  4CCG X;  4Q6F A;  2RSD A;  5D1L B;  5B8D A;  5TDW A;  4S3O C;  4A0C D;  1JM7 B;  3L1Z B;  4AYC A;  3O7A A;  5AIU A;  5B77 A;  5DKA A;  1WIM A;  2KYU A;  3U5N A;  3PHD A;  2PNX A;  1WEV A;  4UI9 B;  3HTK C;  4S3O B;  3DPL R;  3KV6 A;  2CSZ A;  2Y1M A;  1N87 A;  5C13 A;  2M85 A;  3DQV R;  2ECG A;  5LKU A;  2FUI A;  2HYE D;  2AN6 A;  2LGV A;  3MHS A;  4WZ2 A;  3O35 A;  1Z60 A;  1VYX A;  4YBM A;  2L0B A;  2F42 A;  3LQJ A;  3RPG C;  3N9N A;  4MVT A;  1MM3 A;  1WFK A;  3C6W A;  5FEY A;  1XWH A;  4B86 C;  3SOU A;  2MA6 A;  5FER A;  3RPG B;  2ZET C;  5LKT A;  2ECI A;  4GNE A;  4GNF A;  1WES A;  2VP7 A;  4X3G A;  5H1U A;  3M62 A;  3EB6 A;  3O70 A;  3ASL A;  4AVX A;  2EA6 A;  1WEQ A;  2BAY A;  5TBN A;  3N9M A;  2K16 A;  1FP0 A;  3ZPV E;  1X4I A;  1WEP A;  3RTR B;  3O34 A;  5J3X A;  4ZQL A;  4I7C A;  4R2Y A;  4A4B A;  4LJN A;  5TRB A;  2ECN A;  2VPE A;  2LGK A;  2FSA A;  4BBQ A;  4V3L C;  1WGM A;  4IC3 A;  2E6R A;  2M6M A;  2VJF B;  4W4U A;  1CHC A;  3ZVY A;  2LGG A;  3M99 A;  2K1J A;  2YT5 A;  2EGP A;  3LQH A;  2C2V S;  1VFY A;  4PTB A;  2QJ0 A;  2L75 A;  2L5U A;  4R8P K;  4LAD B;  3U5O A;  3T6R A;  2YHO A;  5DIN A;  1LDJ B;  2KIZ A;  1RMD A;  1K2F A;  2C2L A;  2K4D A;  2MA5 A;  5B78 A;  4WZ3 B;  2MUM A;  4YAX A;  2MIQ A;  3HCT A;  1LDK C;  2LDR A;  1IYM A;  1WEN A;  3KQI A;  5KH9 A;  2ECJ A;  2YYR A;  4L58 A;  2YRE A;  4ZUX U;  1HYJ A;  2F6J A;  3N9L A;  4R7E A;  4XI1 A;  2YQM A;  2M3H A;  5I3L A;  4V3K C;  3ZVZ B;  2QIC A;  1ZBD B;  2KE1 A;  4O64 A;  2L80 A;  2KWK A;  3PUQ A;  3NG2 A;  3SHB A;  2D8S A;  1JM7 A;  5G05 B;  3PUR A;  1FBV A;  1X4J A;  3IHP A;  4P5O B;  1V87 A;  2XB1 A;  3MHH A;  5D1M B;  4TKP B;  4GB0 A;  2K17 A;  1T1H A;  2MNY A;  2VJE B;  1G25 A;  2FUU A;  2KWN A;  1WE9 A;  2YSJ A;  2LV9 A;  4B7Y C;  1WEO A;  1Z2Q A;  4AP4 A;  2LQ6 A;  5H1V A;  3U5M A;  5G04 B;  2IDA A;  4FIP A;  3FL2 A;  2JMI A;  4QF2 A;  3N9P A;  2KWO A;  3O33 A;  3VK6 A;  3I2D A;  4QF3 A;  2HDP A;  4L7X A;  2YUC A;  2Y43 A;  3LQI A;  2H0D B;  4LK9 A;  5TAB A;  1WIL A;  5FB1 A;  2ECW A;  3SOW A;  2VNF A;  4IC2 A;  2CKL B;  3GL6 A;  2VPD A;  5FB0 A;  2LN0 A;  5LKZ A;  2KRE A;  4GND A;  2YHN A;  2NAA A;  4AYC B;  5TDR A;  4LLB A;  5D1K B;  4UP0 A;  4WA6 A;  2E6S A;  2H0D A;  2VJF A;  2G45 A;  2RI7 A;  4FK5 A;  2MD8 C;  3O36 A;  4A49 A;  5B76 A;  3ZNI A;  4N4F A;  2LGL A;  2YUR A;  2UZG A;  4LKA A;  1WEE A;  1BOR A;  2KWJ A;  4A4C A;  2LXP C;  5G0F A;  5H9M A;  4YC9 A;  5JG6 A;  2JMD A;  2I50 A;  5LKX A;  2KGI A;  1WEU A;  2XEU A;  2DX8 A;  4BHW A;  4AUQ B;  3N9O A;  5B79 A;  2MD7 B;  2ECT A;  1Z6U A;  3ZYQ A;  1WEW A;  1VD4 A;  4YAD A;  1U6G B;  2PUY A;  2KR4 A;  2LRI C;  1F62 A;  4FO9 A;  3EB5 A;  4FJC A;  4YBT A;  2EOD A;  2CT2 A;  2JMJ A;  2CSY A;  1WEM A;  3HCS A;  2MT5 A;  2Y1N A;  3L1X A;  2MNZ A;  4PPE A;  1DVP A;  2KU3 A;  3ZPV 1;  3L11 A;  4C9Z A;  3HCU A;  3V43 A;  2ECV A;  4ZDT A;  3ZTG A;  3T7L A;  2G6Q A;  3O37 A;  5KH7 A;  3N9Q A;  2G43 A;  2LXH C;  3LRQ A;  5KH3 A;  3C5K A;  2VJE A;  3KV5 A;  1JOC A;  4MSX A;  3U5P A;  4YBS A;  3M63 A;  2M1R A;  3KNV A;  2OXQ C;  2YW8 A;  5EYA F;  4YAT A;  4NN2 A;  2JRJ A;  4GNG A;  4UP5 A;  1E4U A;  4I7D A;  4WZ0 A;  1HYI A;  5B75 A;  1MM2 A;  2L43 A;  1X4U A;  2QIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...