2M85A

Phd domain from human shprh
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
b'FNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase SHPRH
publication title PHD domain from human SHPRH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase,ligase
total genus 7
structure length 65
sequence length 65
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m85A00
1WEWA 1HYIA 3PURA 1JM7A 3C6WA 1XWHA 2M3HA 3LQIA 4XI1A 4UP0A 5KH9A 2QICA 3T7LA 2MD7B 2YQMA 3O36A 3VK6A 5EYAF 4BHWA 1VYXA 3SOWA 1WILA 3ZNIA 1BORA 5KH3A 2JMDA 1X4UA 2LGGA 2F6NA 2MT5A 3N9PA 3LRQA 1N87A 2OXQC 2M85A 1WEVA 3RPGC 1FBVA 4L7XA 3RTRB 2JRJA 4AYCA 5FEYA 2LGLA 4LLBA 2Y1MA 3T6RA 4WZ2A 5G0FA 2MNYA 5H9MA 1WEOA 4V3KC 2KGIA 2L0BA 3L11A 4FJCA 5H1TA 5C13A 2JMIA 2KU3A 3C5KA 2VJFB 4AP4A 2MUMA 3I2DA 2G6QA 2YURA 1WESA 2AN6A 4FIPA 4AVXA 5I3LA 5LKXA 5JG6A 2BAYA 4LK9A 4GNEA 2VPBA 1VD4A 2FSAA 3HTKC 3U5PA 1V87A 4A4BA 3LQHA 2YT5A 2Y1NA 4QF2A 3DQVR 2QIZA 1LDKC 2MD8C 3U5OA 4ZUXU 3M99A 3ZPV1 5B77A 4QF3A 1IYMA 4IC3A 4ZDTA 3N9NA 3ZYQA 5TABA 2CSYA 4S3OC 2EGPA 1X4IA 5FB1A 2L80A 4GB0A 5LKUA 5B76A 2LGKA 3RPGB 3O37A 2LV9A 4LADB 4PPEA 3FL2A 3N9QA 3ZVZB 2LGVA 3NG2A 2K16A 4YATA 3GV4A 2KWOA 2YQLA 3N9MA 3L1XA 3O35A 5TDRA 5LKZA 1JOCA 5AITA 2VJEB 4LKAA 2L43A 5DKAA 2YSMA 5B79A 5G04B 2ZETC 5B75A 5B8DA 2LN0A 2H0DB 2FUUA 2E6RA 3EB5A 2CKLB 4R2YA 2F42A 3MHHA 3ZVYA 2NAAA 2YU4A 4TKPB 4Q6FA 2C2VS 3M63A 2EA6A 2MIQA 4A49A 2M1RA 2KWNA 4PTBA 3U5NA 1WEPA 3KQIA 3DPLR 4LJNA 4B7YC 4I7CA 2MA6A 3M62A 3O70A 3KNVA 2HYED 4WZ3B 1WEUA 1X4JA 3MHSA 2RI7A 2H0DA 2YW8A 1VFYA 4V3LC 2CSZA 4AUQB 5FB0A 1LDJB 2VPEA 1MM2A 2L5UA 2KREA 2I50A 2Y43A 2ECVA 4YADA 4GNDA 2YHNA 5LKTA 4A4CA 3U5MA 3SOXA 2LDRA 2L75A 3GL6A 1WE9A 5G05B 2ECIA 5TDWA 2CT2A 4W4UA 4C9ZA 3ZTGA 3KV5A 2VJFA 4P5OB 4L58A 2YSJA 5AIUA 1WIMA 3EB6A 2LQ6A 4YBSA 3V43A 5C11A 1RMDA 3ASLA 2YHOA 2ECWA 4CCGX 2MA5A 4ZQLA 5DINA 4CA1A 4AYCB 5TRBA 1WEQA 2VNFA 5J3XA 2VPDA 3O7AA 5KH7A 2FUIA 4A0CD 5B78A 1WENA 1WGMA 4N4FA 2LXHC 2IDAA 1G25A 4N3WA 2YYRA 3KV6A 2PNXA 2XB1A 2JMJA 2VP7A 3O33A 3O34A 4B86C 1Z2QA 2YREA 5D1MB 4MSXA 2XEUA 4BBQA 3HCUA 4YBTA 2RSDA 4R7EA 3LQJA 1ZBDB 2MNZA 2ECTA 1U6GB 2KYUA 4S3OB 2ECJA 4WZ0A 2VJEA 3L1ZB 3QZVA 2KGGA 2KE1A 2D8SA 1Z60A 2K17A 3HCTA 4YC9A 4WA6A 2VPGA 4YAXA 5TBNA 2M6MA 2YUCA 4I7DA 5D1LB 1Z6UA 1HYJA 2HDPA 2K1JA 2F6JA 4UP5A 2KFTA 3HCSA 3PUQA 2ECNA 4IC2A 2G45A 2ECGA 1K2FA 4I7BA 1DVPA 2K4DA 2CKLA 2C2LA 2KWKA 1T1HA 1CHCA 2KWJA 3N9LA 3N9OA 1JM7B 2KR4A 5H1VA 5FERA 1MM3A 3IHPA 4GNGA 2KIZA 2PUYA 1E4UA 4NN2A 2LRIC 4X3GA 4FK5A 3ZPVE 2DX8A 2LXPC 5D1KB 2QJ0A 1WEMA 4GNFA 1WEEA 3SOUA 4R8PK 4O64A 3PHDA 1F62A 1FP0A 4YABA 4YBMA 2UZGA 4F52B 4UI9B 2E6SA 5LCWB 2G43A 3SHBA 5H1UA 2EODA 4MVTA 4FO9A 1WFKA
chains in the Genus database with same CATH superfamily
5SVYA 1WEWA 1HYIA 3PURA 1JM7A 3C6WA 1XWHA 2M3HA 3LQIA 4XI1A 4UP0A 5KH9A 2QICA 3T7LA 2D8UA 2MD7B 2YQMA 3Q1DA 3H7HA 3O36A 3VK6A 5EYAF 5SVXA 4BHWA 1VYXA 3SOWA 1WILA 3ZNIA 1BORA 5KH3A 2JMDA 1X4UA 2LGGA 3MDBC 2F6NA 2MT5A 3N9PA 3LRQA 1N87A 2OXQC 2M85A 1WEVA 3RPGC 1FBVA 4L7XA 3RTRB 2JRJA 4AYCA 5FEYA 2LGLA 2KKYA 4LLBA 2Y1MA 3T6RA 4WZ2A 5G0FA 2MNYA 5H9MA 1WEOA 4V3KC 2KGIA 2L0BA 3L11A 4FJCA 5H1TA 5C13A 2JMIA 2KU3A 3C5KA 2VJFB 4AP4A 2MUMA 3I2DA 2G6QA 2YURA 1WESA 2AN6A 2EXUA 4FIPA 4AVXA 5I3LA 5LKXA 2XP0A 5JG6A 2BAYA 4LK9A 4GNEA 2VPBA 1VD4A 2FSAA 3PLWA 3HTKC 3U5PA 1V87A 4A4BA 3LQHA 2DSMA 2YT5A 2Y1NA 4QF2A 3DQVR 2QIZA 1LDKC 2MD8C 3U5OA 4ZUXU 3M99A 3ZPV1 5B77A 4QF3A 1IYMA 4IC3A 1DCQA 4ZDTA 3N9NA 3ZYQA 5TABA 2CSYA 4S3OC 2EGPA 1X4IA 5FB1A 2L80A 4GB0A 5LKUA 2XOYA 5B76A 2LGKA 4H9DA 3RPGB 3O37A 2XOCA 2LV9A 4LADB 4PPEA 3FL2A 3N9QA 3ZVZB 2LGVA 3NG2A 2K16A 4YATA 3GV4A 2KWOA 2YQLA 3N9MA 3L1XA 3O35A 5TDRA 5LKZA 1JOCA 5AITA 2VJEB 4LKAA 2L43A 5DKAA 2YSMA 5B79A 5G04B 5K3QA 2ZETC 2LAUA 5B75A 4F1PA 5B8DA 2LN0A 2H0DB 2FUUA 2E6RA 3EB5A 2CKLB 4R2YA 2F42A 4Z0RA 3MHHA 3JUEA 3LDYA 2KKXA 3ZVYA 2NAAA 3SUBA 2YU4A 4TKPB 4Q6FA 2C2VS 4OGEA 3M63A 2EA6A 2MIQA 5SVIA 4A49A 2M1RA 2KWNA 2JM3A 3LVQE 2FD4A 4PTBA 3FAOA 3U5NA 1WEPA 3KQIA 3DPLR 4LJNA 4B7YC 4I7CA 2MA6A 3M62A 3O70A 3KNVA 2HYED 4WZ3B 2P57A 1WEUA 1X4JA 3MHSA 2RI7A 2H0DA 2YW8A 1VFYA 2EGMA 4V3LC 2CSZA 4AUQB 2M13A 5FB0A 1LDJB 2VPEA 2DJAA 1MM2A 2L5UA 2KREA 2I50A 2Y43A 2ECVA 4YADA 4GNDA 2XOZA 2YHNA 5LKTA 4A4CA 3U5MA 3SOXA 2LDRA 2L75A 3GL6A 1WE9A 5G05B 2ECIA 5TDWA 2CT2A 4W4UA 4C9ZA 2CSVA 3KV5A 3ZTGA 2VJFA 4P5OB 4L58A 2YSJA 5AIUA 1WIMA 3EB6A 4O62A 2LQ6A 4YBSA 3V43A 5C11A 1RMDA 3ASLA 2YHOA 2ECWA 4CCGX 2OWAA 2MA5A 1MBMA 4ZQLA 3FM8C 5DINA 4CA1A 4AYCB 5TRBA 1WEQA 2VNFA 5J3XA 2VPDA 3O7AA 5KH7A 2FUIA 4A0CD 3O47A 5B78A 1WENA 1WGMA 4N4FA 2LXHC 2IDAA 1G25A 4N3WA 2YYRA 3KV6A 2PNXA 2XB1A 2JMJA 2VP7A 2CONA 3O33A 3O34A 4B86C 3DWDA 1Z2QA 2YREA 4MSXA 2XEUA 5D1MB 4BBQA 3HCUA 3M7KA 4YBTA 2RSDA 4R7EA 3LQJA 1ZBDB 2MNZA 2ECTA 1U6GB 2KYUA 4S3OB 2IQJA 4Z0OA 4QQ4A 2ECJA 4WZ0A 2VJEA 3L1ZB 2FFWA 2MKEA 3QZVA 2KGGA 2KE1A 2D8SA 1Z60A 2K17A 3FEHA 3HCTA 4YC9A 4WA6A 2VPGA 4YAXA 5TBNA 2M6MA 2YUCA 4I7DA 5D1LB 1Z6UA 1HYJA 2HDPA 2K1JA 2F6JA 4UP5A 2CRWA 2KFTA 3HCSA 3PUQA 2ECNA 4IC2A 2G45A 3FANA 2ECGA 1K2FA 3DDTA 4I7BA 1DVPA 2K4DA 2CKLA 2C2LA 2KWKA 1T1HA 1CHCA 2RR4A 2KWJA 3N9LA 3N9OA 1JM7B 2KR4A 5H1VA 5FERA 1MM3A 3IHPA 4GNGA 3E2DA 2KIZA 2PUYA 1E4UA 4NN2A 2E61A 3FJUB 2LRIC 2JUNA 4X3GA 4FK5A 3ZPVE 2DX8A 2LXPC 5D1KB 2QJ0A 1WEMA 3LVRE 4GNFA 1WEEA 3SOUA 4R8PK 4O64A 3PHDA 3KDEC 1F62A 1FP0A 4YABA 4YBMA 2UZGA 4F52B 4UI9B 2YVRA 2E6SA 2CRRA 2L7PA 5LCWB 2B0OE 3T9KA 2G43A 3LJUX 3SHBA 4OGCA 2EODA 4MVTA 5H1UA 5SVIB 4FO9A 1WFKA
chains in the Genus database with same CATH topology
1WEWA 1HYIA 3PURA 1JM7A 3C6WA 1XWHA 2M3HA 3LQIA 4XI1A 4UP0A 5KH9A 2QICA 3T7LA 2MD7B 2YQMA 3O36A 3VK6A 5EYAF 4BHWA 1VYXA 3SOWA 1WILA 3ZNIA 1BORA 5KH3A 2JMDA 1X4UA 2LGGA 2F6NA 2MT5A 3N9PA 3LRQA 1N87A 2OXQC 2M85A 1WEVA 3RPGC 1FBVA 4L7XA 3RTRB 2JRJA 4AYCA 5FEYA 2LGLA 4LLBA 2Y1MA 3T6RA 4WZ2A 5G0FA 2MNYA 5H9MA 1WEOA 4V3KC 2KGIA 2L0BA 3L11A 4FJCA 5H1TA 5C13A 2JMIA 2KU3A 3C5KA 2VJFB 4AP4A 2MUMA 3I2DA 2G6QA 2YURA 1WESA 2AN6A 4FIPA 4AVXA 5I3LA 5LKXA 5JG6A 2BAYA 4LK9A 4GNEA 2VPBA 1VD4A 2FSAA 3HTKC 3U5PA 1V87A 4A4BA 3LQHA 2YT5A 2Y1NA 4QF2A 3DQVR 2QIZA 1LDKC 2MD8C 3U5OA 4ZUXU 3M99A 3ZPV1 5B77A 4QF3A 1IYMA 4IC3A 4ZDTA 3N9NA 3ZYQA 5TABA 2CSYA 4S3OC 2EGPA 1X4IA 5FB1A 2L80A 4GB0A 5LKUA 5B76A 2LGKA 3RPGB 3O37A 2LV9A 4LADB 4PPEA 3FL2A 3N9QA 3ZVZB 2LGVA 3NG2A 2K16A 4YATA 3GV4A 2KWOA 2YQLA 3N9MA 3L1XA 3O35A 5TDRA 5LKZA 1JOCA 5AITA 2VJEB 4LKAA 2L43A 5DKAA 2YSMA 5B79A 5G04B 2ZETC 5B75A 5B8DA 2LN0A 2H0DB 2FUUA 2E6RA 3EB5A 2CKLB 4R2YA 2F42A 3MHHA 3ZVYA 2NAAA 2YU4A 4TKPB 4Q6FA 2C2VS 3M63A 2EA6A 2MIQA 4A49A 2M1RA 2KWNA 4PTBA 3U5NA 1WEPA 3KQIA 3DPLR 4LJNA 4B7YC 4I7CA 2MA6A 3M62A 3O70A 3KNVA 2HYED 4WZ3B 1WEUA 1X4JA 3MHSA 2RI7A 2H0DA 2YW8A 1VFYA 4V3LC 2CSZA 4AUQB 5FB0A 1LDJB 2VPEA 1MM2A 2L5UA 2KREA 2I50A 2Y43A 2ECVA 4YADA 4GNDA 2YHNA 5LKTA 4A4CA 3U5MA 3SOXA 2LDRA 2L75A 3GL6A 1WE9A 5G05B 2ECIA 5TDWA 2CT2A 4W4UA 4C9ZA 3ZTGA 3KV5A 2VJFA 4P5OB 4L58A 2YSJA 5AIUA 1WIMA 3EB6A 2LQ6A 4YBSA 3V43A 5C11A 1RMDA 3ASLA 2YHOA 2ECWA 4CCGX 2MA5A 4ZQLA 5DINA 4CA1A 4AYCB 5TRBA 1WEQA 2VNFA 5J3XA 2VPDA 3O7AA 5KH7A 2FUIA 4A0CD 5B78A 1WENA 1WGMA 4N4FA 2LXHC 2IDAA 1G25A 4N3WA 2YYRA 3KV6A 2PNXA 2XB1A 2JMJA 2VP7A 3O33A 3O34A 4B86C 1Z2QA 2YREA 5D1MB 4MSXA 2XEUA 4BBQA 3HCUA 4YBTA 2RSDA 4R7EA 3LQJA 1ZBDB 2MNZA 2ECTA 1U6GB 2KYUA 4S3OB 2ECJA 4WZ0A 2VJEA 3L1ZB 3QZVA 2KGGA 2KE1A 2D8SA 1Z60A 2K17A 3HCTA 4YC9A 4WA6A 2VPGA 4YAXA 5TBNA 2M6MA 2YUCA 4I7DA 5D1LB 1Z6UA 1HYJA 2HDPA 2K1JA 2F6JA 4UP5A 2KFTA 3HCSA 3PUQA 2ECNA 4IC2A 2G45A 2ECGA 1K2FA 4I7BA 1DVPA 2K4DA 2CKLA 2C2LA 2KWKA 1T1HA 1CHCA 2KWJA 3N9LA 3N9OA 1JM7B 2KR4A 5H1VA 5FERA 1MM3A 3IHPA 4GNGA 2KIZA 2PUYA 1E4UA 4NN2A 2LRIC 4X3GA 4FK5A 3ZPVE 2DX8A 2LXPC 5D1KB 2QJ0A 1WEMA 4GNFA 1WEEA 3SOUA 4R8PK 4O64A 3PHDA 1F62A 1FP0A 4YABA 4YBMA 2UZGA 4F52B 4UI9B 2E6SA 5LCWB 2G43A 3SHBA 5H1UA 2EODA 4MVTA 4FO9A 1WFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEW A;  1HYI A;  3PUR A;  1JM7 A;  3C6W A;  1XWH A;  2M3H A;  3LQI A;  4XI1 A;  4UP0 A;  5KH9 A;  2QIC A;  3T7L A;  2MD7 B;  2YQM A;  3O36 A;  3VK6 A;  5EYA F;  4BHW A;  1VYX A;  3SOW A;  1WIL A;  3ZNI A;  1BOR A;  5KH3 A;  2JMD A;  1X4U A;  2LGG A;  2F6N A;  2MT5 A;  3N9P A;  3LRQ A;  1N87 A;  2OXQ C;  2M85 A;  1WEV A;  3RPG C;  1FBV A;  4L7X A;  3RTR B;  2JRJ A;  4AYC A;  5FEY A;  2LGL A;  4LLB A;  2Y1M A;  3T6R A;  4WZ2 A;  5G0F A;  2MNY A;  5H9M A;  1WEO A;  4V3K C;  2KGI A;  2L0B A;  3L11 A;  4FJC A;  5H1T A;  5C13 A;  2JMI A;  2KU3 A;  3C5K A;  2VJF B;  4AP4 A;  2MUM A;  3I2D A;  2G6Q A;  2YUR A;  1WES A;  2AN6 A;  4FIP A;  4AVX A;  5I3L A;  5LKX A;  5JG6 A;  2BAY A;  4LK9 A;  4GNE A;  2VPB A;  1VD4 A;  2FSA A;  3HTK C;  3U5P A;  1V87 A;  4A4B A;  3LQH A;  2YT5 A;  2Y1N A;  4QF2 A;  3DQV R;  2QIZ A;  1LDK C;  2MD8 C;  3U5O A;  4ZUX U;  3M99 A;  3ZPV 1;  5B77 A;  4QF3 A;  1IYM A;  4IC3 A;  4ZDT A;  3N9N A;  3ZYQ A;  5TAB A;  2CSY A;  4S3O C;  2EGP A;  1X4I A;  5FB1 A;  2L80 A;  4GB0 A;  5LKU A;  5B76 A;  2LGK A;  3RPG B;  3O37 A;  2LV9 A;  4LAD B;  4PPE A;  3FL2 A;  3N9Q A;  3ZVZ B;  2LGV A;  3NG2 A;  2K16 A;  4YAT A;  3GV4 A;  2KWO A;  2YQL A;  3N9M A;  3L1X A;  3O35 A;  5TDR A;  5LKZ A;  1JOC A;  5AIT A;  2VJE B;  4LKA A;  2L43 A;  5DKA A;  2YSM A;  5B79 A;  5G04 B;  2ZET C;  5B75 A;  5B8D A;  2LN0 A;  2H0D B;  2FUU A;  2E6R A;  3EB5 A;  2CKL B;  4R2Y A;  2F42 A;  3MHH A;  3ZVY A;  2NAA A;  2YU4 A;  4TKP B;  4Q6F A;  2C2V S;  3M63 A;  2EA6 A;  2MIQ A;  4A49 A;  2M1R A;  2KWN A;  4PTB A;  3U5N A;  1WEP A;  3KQI A;  3DPL R;  4LJN A;  4B7Y C;  4I7C A;  2MA6 A;  3M62 A;  3O70 A;  3KNV A;  2HYE D;  4WZ3 B;  1WEU A;  1X4J A;  3MHS A;  2RI7 A;  2H0D A;  2YW8 A;  1VFY A;  4V3L C;  2CSZ A;  4AUQ B;  5FB0 A;  1LDJ B;  2VPE A;  1MM2 A;  2L5U A;  2KRE A;  2I50 A;  2Y43 A;  2ECV A;  4YAD A;  4GND A;  2YHN A;  5LKT A;  4A4C A;  3U5M A;  3SOX A;  2LDR A;  2L75 A;  3GL6 A;  1WE9 A;  5G05 B;  2ECI A;  5TDW A;  2CT2 A;  4W4U A;  4C9Z A;  3ZTG A;  3KV5 A;  2VJF A;  4P5O B;  4L58 A;  2YSJ A;  5AIU A;  1WIM A;  3EB6 A;  2LQ6 A;  4YBS A;  3V43 A;  5C11 A;  1RMD A;  3ASL A;  2YHO A;  2ECW A;  4CCG X;  2MA5 A;  4ZQL A;  5DIN A;  4CA1 A;  4AYC B;  5TRB A;  1WEQ A;  2VNF A;  5J3X A;  2VPD A;  3O7A A;  5KH7 A;  2FUI A;  4A0C D;  5B78 A;  1WEN A;  1WGM A;  4N4F A;  2LXH C;  2IDA A;  1G25 A;  4N3W A;  2YYR A;  3KV6 A;  2PNX A;  2XB1 A;  2JMJ A;  2VP7 A;  3O33 A;  3O34 A;  4B86 C;  1Z2Q A;  2YRE A;  5D1M B;  4MSX A;  2XEU A;  4BBQ A;  3HCU A;  4YBT A;  2RSD A;  4R7E A;  3LQJ A;  1ZBD B;  2MNZ A;  2ECT A;  1U6G B;  2KYU A;  4S3O B;  2ECJ A;  4WZ0 A;  2VJE A;  3L1Z B;  3QZV A;  2KGG A;  2KE1 A;  2D8S A;  1Z60 A;  2K17 A;  3HCT A;  4YC9 A;  4WA6 A;  2VPG A;  4YAX A;  5TBN A;  2M6M A;  2YUC A;  4I7D A;  5D1L B;  1Z6U A;  1HYJ A;  2HDP A;  2K1J A;  2F6J A;  4UP5 A;  2KFT A;  3HCS A;  3PUQ A;  2ECN A;  4IC2 A;  2G45 A;  2ECG A;  1K2F A;  4I7B A;  1DVP A;  2K4D A;  2CKL A;  2C2L A;  2KWK A;  1T1H A;  1CHC A;  2KWJ A;  3N9L A;  3N9O A;  1JM7 B;  2KR4 A;  5H1V A;  5FER A;  1MM3 A;  3IHP A;  4GNG A;  2KIZ A;  2PUY A;  1E4U A;  4NN2 A;  2LRI C;  4X3G A;  4FK5 A;  3ZPV E;  2DX8 A;  2LXP C;  5D1K B;  2QJ0 A;  1WEM A;  4GNF A;  1WEE A;  3SOU A;  4R8P K;  4O64 A;  3PHD A;  1F62 A;  1FP0 A;  4YAB A;  4YBM A;  2UZG A;  4F52 B;  4UI9 B;  2E6S A;  5LCW B;  2G43 A;  3SHB A;  5H1U A;  2EOD A;  4MVT A;  4FO9 A;  1WFK A; 
#chains in the Genus database with same CATH topology
 5SVY A;  1WEW A;  1HYI A;  3PUR A;  1JM7 A;  3C6W A;  1XWH A;  2M3H A;  3LQI A;  4XI1 A;  4UP0 A;  5KH9 A;  2QIC A;  3T7L A;  2D8U A;  2MD7 B;  2YQM A;  3Q1D A;  3H7H A;  3O36 A;  3VK6 A;  5EYA F;  5SVX A;  4BHW A;  1VYX A;  3SOW A;  1WIL A;  3ZNI A;  1BOR A;  5KH3 A;  2JMD A;  1X4U A;  2LGG A;  3MDB C;  2F6N A;  2MT5 A;  3N9P A;  3LRQ A;  1N87 A;  2OXQ C;  2M85 A;  1WEV A;  3RPG C;  1FBV A;  4L7X A;  3RTR B;  2JRJ A;  4AYC A;  5FEY A;  2LGL A;  2KKY A;  4LLB A;  2Y1M A;  3T6R A;  4WZ2 A;  5G0F A;  2MNY A;  5H9M A;  1WEO A;  4V3K C;  2KGI A;  2L0B A;  3L11 A;  4FJC A;  5H1T A;  5C13 A;  2JMI A;  2KU3 A;  3C5K A;  2VJF B;  4AP4 A;  2MUM A;  3I2D A;  2G6Q A;  2YUR A;  1WES A;  2AN6 A;  2EXU A;  4FIP A;  4AVX A;  5I3L A;  5LKX A;  2XP0 A;  5JG6 A;  2BAY A;  4LK9 A;  4GNE A;  2VPB A;  1VD4 A;  2FSA A;  3PLW A;  3HTK C;  3U5P A;  1V87 A;  4A4B A;  3LQH A;  2DSM A;  2YT5 A;  2Y1N A;  4QF2 A;  3DQV R;  2QIZ A;  1LDK C;  2MD8 C;  3U5O A;  4ZUX U;  3M99 A;  3ZPV 1;  5B77 A;  4QF3 A;  1IYM A;  4IC3 A;  1DCQ A;  4ZDT A;  3N9N A;  3ZYQ A;  5TAB A;  2CSY A;  4S3O C;  2EGP A;  1X4I A;  5FB1 A;  2L80 A;  4GB0 A;  5LKU A;  2XOY A;  5B76 A;  2LGK A;  4H9D A;  3RPG B;  3O37 A;  2XOC A;  2LV9 A;  4LAD B;  4PPE A;  3FL2 A;  3N9Q A;  3ZVZ B;  2LGV A;  3NG2 A;  2K16 A;  4YAT A;  3GV4 A;  2KWO A;  2YQL A;  3N9M A;  3L1X A;  3O35 A;  5TDR A;  5LKZ A;  1JOC A;  5AIT A;  2VJE B;  4LKA A;  2L43 A;  5DKA A;  2YSM A;  5B79 A;  5G04 B;  5K3Q A;  2ZET C;  2LAU A;  5B75 A;  4F1P A;  5B8D A;  2LN0 A;  2H0D B;  2FUU A;  2E6R A;  3EB5 A;  2CKL B;  4R2Y A;  2F42 A;  4Z0R A;  3MHH A;  3JUE A;  3LDY A;  2KKX A;  3ZVY A;  2NAA A;  3SUB A;  2YU4 A;  4TKP B;  4Q6F A;  2C2V S;  4OGE A;  3M63 A;  2EA6 A;  2MIQ A;  5SVI A;  4A49 A;  2M1R A;  2KWN A;  2JM3 A;  3LVQ E;  2FD4 A;  4PTB A;  3FAO A;  3U5N A;  1WEP A;  3KQI A;  3DPL R;  4LJN A;  4B7Y C;  4I7C A;  2MA6 A;  3M62 A;  3O70 A;  3KNV A;  2HYE D;  4WZ3 B;  2P57 A;  1WEU A;  1X4J A;  3MHS A;  2RI7 A;  2H0D A;  2YW8 A;  1VFY A;  2EGM A;  4V3L C;  2CSZ A;  4AUQ B;  2M13 A;  5FB0 A;  1LDJ B;  2VPE A;  2DJA A;  1MM2 A;  2L5U A;  2KRE A;  2I50 A;  2Y43 A;  2ECV A;  4YAD A;  4GND A;  2XOZ A;  2YHN A;  5LKT A;  4A4C A;  3U5M A;  3SOX A;  2LDR A;  2L75 A;  3GL6 A;  1WE9 A;  5G05 B;  2ECI A;  5TDW A;  2CT2 A;  4W4U A;  4C9Z A;  2CSV A;  3KV5 A;  3ZTG A;  2VJF A;  4P5O B;  4L58 A;  2YSJ A;  5AIU A;  1WIM A;  3EB6 A;  4O62 A;  2LQ6 A;  4YBS A;  3V43 A;  5C11 A;  1RMD A;  3ASL A;  2YHO A;  2ECW A;  4CCG X;  2OWA A;  2MA5 A;  1MBM A;  4ZQL A;  3FM8 C;  5DIN A;  4CA1 A;  4AYC B;  5TRB A;  1WEQ A;  2VNF A;  5J3X A;  2VPD A;  3O7A A;  5KH7 A;  2FUI A;  4A0C D;  3O47 A;  5B78 A;  1WEN A;  1WGM A;  4N4F A;  2LXH C;  2IDA A;  1G25 A;  4N3W A;  2YYR A;  3KV6 A;  2PNX A;  2XB1 A;  2JMJ A;  2VP7 A;  2CON A;  3O33 A;  3O34 A;  4B86 C;  3DWD A;  1Z2Q A;  2YRE A;  4MSX A;  2XEU A;  5D1M B;  4BBQ A;  3HCU A;  3M7K A;  4YBT A;  2RSD A;  4R7E A;  3LQJ A;  1ZBD B;  2MNZ A;  2ECT A;  1U6G B;  2KYU A;  4S3O B;  2IQJ A;  4Z0O A;  4QQ4 A;  2ECJ A;  4WZ0 A;  2VJE A;  3L1Z B;  2FFW A;  2MKE A;  3QZV A;  2KGG A;  2KE1 A;  2D8S A;  1Z60 A;  2K17 A;  3FEH A;  3HCT A;  4YC9 A;  4WA6 A;  2VPG A;  4YAX A;  5TBN A;  2M6M A;  2YUC A;  4I7D A;  5D1L B;  1Z6U A;  1HYJ A;  2HDP A;  2K1J A;  2F6J A;  4UP5 A;  2CRW A;  2KFT A;  3HCS A;  3PUQ A;  2ECN A;  4IC2 A;  2G45 A;  3FAN A;  2ECG A;  1K2F A;  3DDT A;  4I7B A;  1DVP A;  2K4D A;  2CKL A;  2C2L A;  2KWK A;  1T1H A;  1CHC A;  2RR4 A;  2KWJ A;  3N9L A;  3N9O A;  1JM7 B;  2KR4 A;  5H1V A;  5FER A;  1MM3 A;  3IHP A;  4GNG A;  3E2D A;  2KIZ A;  2PUY A;  1E4U A;  4NN2 A;  2E61 A;  3FJU B;  2LRI C;  2JUN A;  4X3G A;  4FK5 A;  3ZPV E;  2DX8 A;  2LXP C;  5D1K B;  2QJ0 A;  1WEM A;  3LVR E;  4GNF A;  1WEE A;  3SOU A;  4R8P K;  4O64 A;  3PHD A;  3KDE C;  1F62 A;  1FP0 A;  4YAB A;  4YBM A;  2UZG A;  4F52 B;  4UI9 B;  2YVR A;  2E6S A;  2CRR A;  2L7P A;  5LCW B;  2B0O E;  3T9K A;  2G43 A;  3LJU X;  3SHB A;  4OGC A;  2EOD A;  4MVT A;  5H1U A;  5SVI B;  4FO9 A;  1WFK A; 
#chains in the Genus database with same CATH homology
 1WEW A;  1HYI A;  3PUR A;  1JM7 A;  3C6W A;  1XWH A;  2M3H A;  3LQI A;  4XI1 A;  4UP0 A;  5KH9 A;  2QIC A;  3T7L A;  2MD7 B;  2YQM A;  3O36 A;  3VK6 A;  5EYA F;  4BHW A;  1VYX A;  3SOW A;  1WIL A;  3ZNI A;  1BOR A;  5KH3 A;  2JMD A;  1X4U A;  2LGG A;  2F6N A;  2MT5 A;  3N9P A;  3LRQ A;  1N87 A;  2OXQ C;  2M85 A;  1WEV A;  3RPG C;  1FBV A;  4L7X A;  3RTR B;  2JRJ A;  4AYC A;  5FEY A;  2LGL A;  4LLB A;  2Y1M A;  3T6R A;  4WZ2 A;  5G0F A;  2MNY A;  5H9M A;  1WEO A;  4V3K C;  2KGI A;  2L0B A;  3L11 A;  4FJC A;  5H1T A;  5C13 A;  2JMI A;  2KU3 A;  3C5K A;  2VJF B;  4AP4 A;  2MUM A;  3I2D A;  2G6Q A;  2YUR A;  1WES A;  2AN6 A;  4FIP A;  4AVX A;  5I3L A;  5LKX A;  5JG6 A;  2BAY A;  4LK9 A;  4GNE A;  2VPB A;  1VD4 A;  2FSA A;  3HTK C;  3U5P A;  1V87 A;  4A4B A;  3LQH A;  2YT5 A;  2Y1N A;  4QF2 A;  3DQV R;  2QIZ A;  1LDK C;  2MD8 C;  3U5O A;  4ZUX U;  3M99 A;  3ZPV 1;  5B77 A;  4QF3 A;  1IYM A;  4IC3 A;  4ZDT A;  3N9N A;  3ZYQ A;  5TAB A;  2CSY A;  4S3O C;  2EGP A;  1X4I A;  5FB1 A;  2L80 A;  4GB0 A;  5LKU A;  5B76 A;  2LGK A;  3RPG B;  3O37 A;  2LV9 A;  4LAD B;  4PPE A;  3FL2 A;  3N9Q A;  3ZVZ B;  2LGV A;  3NG2 A;  2K16 A;  4YAT A;  3GV4 A;  2KWO A;  2YQL A;  3N9M A;  3L1X A;  3O35 A;  5TDR A;  5LKZ A;  1JOC A;  5AIT A;  2VJE B;  4LKA A;  2L43 A;  5DKA A;  2YSM A;  5B79 A;  5G04 B;  2ZET C;  5B75 A;  5B8D A;  2LN0 A;  2H0D B;  2FUU A;  2E6R A;  3EB5 A;  2CKL B;  4R2Y A;  2F42 A;  3MHH A;  3ZVY A;  2NAA A;  2YU4 A;  4TKP B;  4Q6F A;  2C2V S;  3M63 A;  2EA6 A;  2MIQ A;  4A49 A;  2M1R A;  2KWN A;  4PTB A;  3U5N A;  1WEP A;  3KQI A;  3DPL R;  4LJN A;  4B7Y C;  4I7C A;  2MA6 A;  3M62 A;  3O70 A;  3KNV A;  2HYE D;  4WZ3 B;  1WEU A;  1X4J A;  3MHS A;  2RI7 A;  2H0D A;  2YW8 A;  1VFY A;  4V3L C;  2CSZ A;  4AUQ B;  5FB0 A;  1LDJ B;  2VPE A;  1MM2 A;  2L5U A;  2KRE A;  2I50 A;  2Y43 A;  2ECV A;  4YAD A;  4GND A;  2YHN A;  5LKT A;  4A4C A;  3U5M A;  3SOX A;  2LDR A;  2L75 A;  3GL6 A;  1WE9 A;  5G05 B;  2ECI A;  5TDW A;  2CT2 A;  4W4U A;  4C9Z A;  3ZTG A;  3KV5 A;  2VJF A;  4P5O B;  4L58 A;  2YSJ A;  5AIU A;  1WIM A;  3EB6 A;  2LQ6 A;  4YBS A;  3V43 A;  5C11 A;  1RMD A;  3ASL A;  2YHO A;  2ECW A;  4CCG X;  2MA5 A;  4ZQL A;  5DIN A;  4CA1 A;  4AYC B;  5TRB A;  1WEQ A;  2VNF A;  5J3X A;  2VPD A;  3O7A A;  5KH7 A;  2FUI A;  4A0C D;  5B78 A;  1WEN A;  1WGM A;  4N4F A;  2LXH C;  2IDA A;  1G25 A;  4N3W A;  2YYR A;  3KV6 A;  2PNX A;  2XB1 A;  2JMJ A;  2VP7 A;  3O33 A;  3O34 A;  4B86 C;  1Z2Q A;  2YRE A;  5D1M B;  4MSX A;  2XEU A;  4BBQ A;  3HCU A;  4YBT A;  2RSD A;  4R7E A;  3LQJ A;  1ZBD B;  2MNZ A;  2ECT A;  1U6G B;  2KYU A;  4S3O B;  2ECJ A;  4WZ0 A;  2VJE A;  3L1Z B;  3QZV A;  2KGG A;  2KE1 A;  2D8S A;  1Z60 A;  2K17 A;  3HCT A;  4YC9 A;  4WA6 A;  2VPG A;  4YAX A;  5TBN A;  2M6M A;  2YUC A;  4I7D A;  5D1L B;  1Z6U A;  1HYJ A;  2HDP A;  2K1J A;  2F6J A;  4UP5 A;  2KFT A;  3HCS A;  3PUQ A;  2ECN A;  4IC2 A;  2G45 A;  2ECG A;  1K2F A;  4I7B A;  1DVP A;  2K4D A;  2CKL A;  2C2L A;  2KWK A;  1T1H A;  1CHC A;  2KWJ A;  3N9L A;  3N9O A;  1JM7 B;  2KR4 A;  5H1V A;  5FER A;  1MM3 A;  3IHP A;  4GNG A;  2KIZ A;  2PUY A;  1E4U A;  4NN2 A;  2LRI C;  4X3G A;  4FK5 A;  3ZPV E;  2DX8 A;  2LXP C;  5D1K B;  2QJ0 A;  1WEM A;  4GNF A;  1WEE A;  3SOU A;  4R8P K;  4O64 A;  3PHD A;  1F62 A;  1FP0 A;  4YAB A;  4YBM A;  2UZG A;  4F52 B;  4UI9 B;  2E6S A;  5LCW B;  2G43 A;  3SHB A;  5H1U A;  2EOD A;  4MVT A;  4FO9 A;  1WFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...