2M85A

Phd domain from human shprh
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
FNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase SHPRH
publication title PHD domain from human SHPRH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase,ligase
total genus 7
structure length 65
sequence length 65
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m85A00
5TDWA 4YBTA 2VPBA 4A49A 2F42A 4A4CA 1WESA 2H0DA 1WEVA 5TRBA 2ECIA 2LGGA 5LCWB 1X4JA 5LKTA 4YAXA 2Y1MA 2YSMA 2K17A 4YBMA 1MM3A 2E6RA 2UZGA 4ZDTA 1WENA 5I3LA 3C6WA 1HYIA 1WILA 4R8PK 4MSXA 2ECGA 2PUYA 2EA6A 2BAYA 5H9MA 4UP5A 5B8DA 4LKAA 4V3KC 5EYAF 2MA6A 3M99A 1MM2A 3LQIA 1F62A 4FO9A 2YU4A 3NG2A 1IYMA 2MA5A 2KFTA 3U5PA 1WFKA 2LGLA 2LXPC 2MNYA 1Z6UA 1G25A 2MD7B 2ECNA 2YSJA 4WA6A 4P5OB 2YUCA 2M1RA 3N9MA 4XI1A 4N3WA 1ZBDB 3GV4A 2YREA 4I7DA 4O64A 1JM7B 5JG6A 4UP0A 3ZVZB 1JM7A 3ASLA 3ZYQA 2IDAA 1FP0A 1T1HA 4R2YA 1WEUA 1E4UA 4L58A 4WZ2A 3KQIA 4V3LC 4CA1A 3DQVR 2QICA 1DVPA 2KE1A 3GL6A 5DKAA 3T6RA 2LQ6A 4YBSA 2I50A 1XWHA 1K2FA 2ECTA 5J3XA 3O36A 3HCTA 5B78A 2QJ0A 2CKLB 3L11A 3I2DA 3EB6A 3LQHA 2F6JA 2RI7A 4C9ZA 2DX8A 2LGKA 4W4UA 2ECVA 4B86C 2YYRA 3MHHA 5KH9A 4FK5A 3HCSA 2F6NA 1Z2QA 3SHBA 5FB1A 2EODA 1BORA 3N9PA 5D1KB 3U5MA 1WEQA 4UI9B 4QF3A 1WEWA 2LDRA 2Y43A 5G05B 3SOUA 3EB5A 2D8SA 4WZ0A 2ZETC 3HTKC 2K4DA 2YHOA 1V87A 2XB1A 3T7LA 5B79A 4LK9A 4GNGA 2M85A 4LADB 2JMDA 4N4FA 3ZNIA 2KWJA 2KREA 3LRQA 4YADA 2KWOA 2E6SA 2YW8A 5FB0A 5B76A 2RSDA 4IC2A 3SOXA 4QF2A 5FEYA 3N9NA 2YT5A 3M63A 2C2VS 3O37A 4MVTA 5AITA 1VYXA 2L80A 2HYED 2MIQA 2VP7A 4AYCB 4AVXA 4AYCA 4WZ3B 3V43A 2VPEA 3KV5A 5H1VA 1WEMA 4IC3A 2FSAA 4YC9A 4LLBA 3O34A 3N9LA 2KWNA 5C11A 2LXHC 3PUQA 1HYJA 3L1ZB 5D1LB 4ZQLA 2KU3A 2QIZA 1JOCA 2CSZA 4B7YC 4TKPB 2FUIA 2KIZA 2MT5A 5AIUA 5H1TA 3O70A 3ZPVE 3N9QA 2KYUA 4A4BA 2VPGA 2G43A 3M62A 2KGGA 2CKLA 2XEUA 3U5OA 3SOWA 2CSYA 4S3OB 4PTBA 5TBNA 5DINA 4L7XA 3O33A 5B77A 1LDJB 4S3OC 2OXQC 4GNDA 2EGPA 3PURA 4GNFA 3RPGB 4LJNA 3ZTGA 4BBQA 3HCUA 5G0FA 4R7EA 4AP4A 5LKUA 1LDKC 3KNVA 3KV6A 4Q6FA 2KGIA 2M3HA 2VPDA 2YQMA 2VNFA 2YURA 5D1MB 1WEPA 4I7BA 2H0DB 3LQJA 2CT2A 2M6MA 2KR4A 5B75A 2JMJA 3RTRB 2FUUA 2K16A 1FBVA 4YABA 2G45A 3U5NA 2JRJA 3O7AA 5LKXA 2AN6A 5TDRA 5KH3A 2YQLA 2NAAA 5KH7A 1X4IA 3VK6A 1VD4A 4YATA 1CHCA 5TABA 2K1JA 5C13A 2LRIC 4A0CD 5H1UA 3FL2A 5LKZA 4NN2A 3L1XA 2MNZA 2VJFB 1Z60A 2YHNA 2VJFA 3ZVYA 2HDPA 2L75A 3QZVA 2L0BA 4FIPA 2VJEB 5FERA 1U6GB 2PNXA 2VJEA 2Y1NA 3PHDA 3IHPA 4BHWA 4PPEA 1WEOA 3C5KA 2LV9A 5G04B 4FJCA 2L5UA 4X3GA 4ZUXU 1VFYA 1WIMA 2G6QA 4I7CA 2MD8C 4GB0A 4F52B 2C2LA 2ECJA 2LGVA 3MHSA 2JMIA 4AUQB 1N87A 3O35A 1WGMA 3ZPV1 1WEEA 1X4UA 3DPLR 1RMDA 4GNEA 2ECWA 3N9OA 1WE9A 2KWKA 2LN0A 4CCGX 2L43A 3RPGC 2MUMA
chains in the Genus database with same CATH superfamily
5TDWA 4YBTA 2VPBA 4A49A 2F42A 4A4CA 1WESA 2H0DA 1WEVA 5TRBA 2XOCA 2CRWA 2ECIA 2LGGA 5LCWB 1X4JA 5LKTA 4YAXA 4F1PA 2Y1MA 2YSMA 2K17A 4YBMA 1MM3A 2E6RA 2UZGA 4ZDTA 2EXUA 1WENA 5I3LA 3C6WA 4OGEA 1HYIA 1WILA 4R8PK 4MSXA 2ECGA 2PUYA 2EA6A 2BAYA 5H9MA 4UP5A 5B8DA 4LKAA 4V3KC 5EYAF 2MA6A 3M99A 1MM2A 3LQIA 1F62A 2LAUA 4FO9A 2YU4A 3NG2A 1IYMA 2MA5A 2KFTA 3U5PA 1WFKA 2LGLA 2LXPC 3FJUB 2MNYA 1Z6UA 1G25A 2MD7B 2ECNA 2YSJA 4WA6A 4P5OB 2YUCA 2M1RA 3N9MA 4XI1A 4N3WA 1ZBDB 3GV4A 2YREA 4I7DA 4O64A 1JM7B 5JG6A 4UP0A 3ZVZB 1JM7A 3ASLA 3ZYQA 2IDAA 1FP0A 1T1HA 4R2YA 1WEUA 1E4UA 4L58A 4WZ2A 3KQIA 3FAOA 4V3LC 4CA1A 3DQVR 2QICA 1DVPA 2KE1A 3GL6A 5DKAA 5SVYA 3T6RA 2CSVA 2LQ6A 4YBSA 4H9DA 4Z0OA 2I50A 1XWHA 1K2FA 2ECTA 5J3XA 3O36A 3HCTA 5B78A 2QJ0A 2CKLB 3L11A 3I2DA 3EB6A 3LQHA 3H7HA 2CRRA 2F6JA 2RI7A 4C9ZA 2DX8A 2LGKA 4W4UA 2YVRA 3DDTA 2ECVA 4B86C 2IQJA 2YYRA 3MHHA 5KH9A 4FK5A 3HCSA 2F6NA 1Z2QA 3SHBA 5FB1A 2EODA 1BORA 2XOZA 3N9PA 5D1KB 3U5MA 1WEQA 4UI9B 4QF3A 1WEWA 2LDRA 2Y43A 5G05B 3SOUA 3EB5A 2D8SA 4WZ0A 2ZETC 3HTKC 2FFWA 2K4DA 2YHOA 1V87A 2XB1A 3T7LA 5B79A 4LK9A 4GNGA 2M85A 4LADB 2JMDA 4N4FA 3ZNIA 2KWJA 2KREA 3LRQA 4YADA 2KWOA 2EGMA 2E6SA 2JUNA 2YW8A 1DCQA 5FB0A 3LJUX 5B76A 2RSDA 4IC2A 3SOXA 4QF2A 2DSMA 5FEYA 3N9NA 2YT5A 3M63A 2C2VS 3O37A 4MVTA 5AITA 1VYXA 2L80A 2HYED 2MIQA 2VP7A 4AYCB 4AVXA 2FD4A 5SVIB 4AYCA 4O62A 3SUBA 5SVIA 4WZ3B 3V43A 2VPEA 3KV5A 5H1VA 1WEMA 2KKYA 4IC3A 2FSAA 3FANA 4YC9A 4LLBA 2OWAA 3O34A 3N9LA 2KWNA 5C11A 2LXHC 3PUQA 3LVQE 1HYJA 3L1ZB 5D1LB 4ZQLA 2KU3A 2QIZA 1JOCA 2CSZA 4B7YC 3JUEA 4TKPB 2FUIA 2KIZA 2MT5A 3FEHA 5AIUA 5H1TA 3O70A 3ZPVE 2DJAA 3N9QA 3PLWA 2KYUA 5SVXA 4A4BA 2VPGA 2L7PA 2G43A 3M62A 2KGGA 2CKLA 2D8UA 2XEUA 3U5OA 3SOWA 3LDYA 2CSYA 4S3OB 4PTBA 5TBNA 5DINA 4L7XA 3O33A 5B77A 1LDJB 4S3OC 2OXQC 3Q1DA 4GNDA 2EGPA 3PURA 2MKEA 4GNFA 3RPGB 4LJNA 3ZTGA 4BBQA 3HCUA 5G0FA 4R7EA 4AP4A 5LKUA 1LDKC 3KNVA 2XP0A 3KV6A 4Q6FA 2KGIA 2M3HA 2VPDA 2YQMA 2VNFA 2E61A 1MBMA 2YURA 5D1MB 2KKXA 1WEPA 4I7BA 2H0DB 3LQJA 2CT2A 3LVRE 2M6MA 2KR4A 5B75A 2JMJA 2P57A 3RTRB 2FUUA 3MDBC 2K16A 1FBVA 4YABA 2G45A 3U5NA 2JRJA 3O7AA 5LKXA 2AN6A 5TDRA 3O47A 5KH3A 2YQLA 2NAAA 5KH7A 1X4IA 3VK6A 1VD4A 3E2DA 4YATA 1CHCA 5TABA 2K1JA 5C13A 2LRIC 4A0CD 3FM8C 5H1UA 3FL2A 4Z0RA 4NN2A 5LKZA 3L1XA 2MNZA 2VJFB 1Z60A 2YHNA 2VJFA 3ZVYA 2HDPA 2L75A 3QZVA 2L0BA 4FIPA 2VJEB 5FERA 1U6GB 2PNXA 2VJEA 2Y1NA 3PHDA 3IHPA 3DWDA 4BHWA 3T9KA 4PPEA 1WEOA 3C5KA 2XOYA 2LV9A 5G04B 4QQ4A 4FJCA 2L5UA 4X3GA 4ZUXU 1VFYA 1WIMA 2G6QA 4I7CA 3KDEC 2M13A 2MD8C 2CONA 2JM3A 4GB0A 5K3QA 4F52B 2C2LA 2ECJA 2LGVA 2B0OE 3MHSA 2JMIA 4AUQB 1N87A 3O35A 1WGMA 3ZPV1 1WEEA 1X4UA 3DPLR 1RMDA 4GNEA 2ECWA 3M7KA 3N9OA 1WE9A 2KWKA 2LN0A 4OGCA 4CCGX 2L43A 3RPGC 2RR4A 2MUMA
chains in the Genus database with same CATH topology
5TDWA 4YBTA 2VPBA 4A49A 2F42A 4A4CA 1WESA 2H0DA 1WEVA 5TRBA 2ECIA 2LGGA 5LCWB 1X4JA 5LKTA 4YAXA 2Y1MA 2YSMA 2K17A 4YBMA 1MM3A 2E6RA 2UZGA 4ZDTA 1WENA 5I3LA 3C6WA 1HYIA 1WILA 4R8PK 4MSXA 2ECGA 2PUYA 2EA6A 2BAYA 5H9MA 4UP5A 5B8DA 4LKAA 4V3KC 5EYAF 2MA6A 3M99A 1MM2A 3LQIA 1F62A 4FO9A 2YU4A 3NG2A 1IYMA 2MA5A 2KFTA 3U5PA 1WFKA 2LGLA 2LXPC 2MNYA 1Z6UA 1G25A 2MD7B 2ECNA 2YSJA 4WA6A 4P5OB 2YUCA 2M1RA 3N9MA 4XI1A 4N3WA 1ZBDB 3GV4A 2YREA 4I7DA 4O64A 1JM7B 5JG6A 4UP0A 3ZVZB 1JM7A 3ASLA 3ZYQA 2IDAA 1FP0A 1T1HA 4R2YA 1WEUA 1E4UA 4L58A 4WZ2A 3KQIA 4V3LC 4CA1A 3DQVR 2QICA 1DVPA 2KE1A 3GL6A 5DKAA 3T6RA 2LQ6A 4YBSA 2I50A 1XWHA 1K2FA 2ECTA 5J3XA 3O36A 3HCTA 5B78A 2QJ0A 2CKLB 3L11A 3I2DA 3EB6A 3LQHA 2F6JA 2RI7A 4C9ZA 2DX8A 2LGKA 4W4UA 2ECVA 4B86C 2YYRA 3MHHA 5KH9A 4FK5A 3HCSA 2F6NA 1Z2QA 3SHBA 5FB1A 2EODA 1BORA 3N9PA 5D1KB 3U5MA 1WEQA 4UI9B 4QF3A 1WEWA 2LDRA 2Y43A 5G05B 3SOUA 3EB5A 2D8SA 4WZ0A 2ZETC 3HTKC 2K4DA 2YHOA 1V87A 2XB1A 3T7LA 5B79A 4LK9A 4GNGA 2M85A 4LADB 2JMDA 4N4FA 3ZNIA 2KWJA 2KREA 3LRQA 4YADA 2KWOA 2E6SA 2YW8A 5FB0A 5B76A 2RSDA 4IC2A 3SOXA 4QF2A 5FEYA 3N9NA 2YT5A 3M63A 2C2VS 3O37A 4MVTA 5AITA 1VYXA 2L80A 2HYED 2MIQA 2VP7A 4AYCB 4AVXA 4AYCA 4WZ3B 3V43A 2VPEA 3KV5A 5H1VA 1WEMA 4IC3A 2FSAA 4YC9A 4LLBA 3O34A 3N9LA 2KWNA 5C11A 2LXHC 3PUQA 1HYJA 3L1ZB 5D1LB 4ZQLA 2KU3A 2QIZA 1JOCA 2CSZA 4B7YC 4TKPB 2FUIA 2KIZA 2MT5A 5AIUA 5H1TA 3O70A 3ZPVE 3N9QA 2KYUA 4A4BA 2VPGA 2G43A 3M62A 2KGGA 2CKLA 2XEUA 3U5OA 3SOWA 2CSYA 4S3OB 4PTBA 5TBNA 5DINA 4L7XA 3O33A 5B77A 1LDJB 4S3OC 2OXQC 4GNDA 2EGPA 3PURA 4GNFA 3RPGB 4LJNA 3ZTGA 4BBQA 3HCUA 5G0FA 4R7EA 4AP4A 5LKUA 1LDKC 3KNVA 3KV6A 4Q6FA 2KGIA 2M3HA 2VPDA 2YQMA 2VNFA 2YURA 5D1MB 1WEPA 4I7BA 2H0DB 3LQJA 2CT2A 2M6MA 2KR4A 5B75A 2JMJA 3RTRB 2FUUA 2K16A 1FBVA 4YABA 2G45A 3U5NA 2JRJA 3O7AA 5LKXA 2AN6A 5TDRA 5KH3A 2YQLA 2NAAA 5KH7A 1X4IA 3VK6A 1VD4A 4YATA 1CHCA 5TABA 2K1JA 5C13A 2LRIC 4A0CD 5H1UA 3FL2A 5LKZA 4NN2A 3L1XA 2MNZA 2VJFB 1Z60A 2YHNA 2VJFA 3ZVYA 2HDPA 2L75A 3QZVA 2L0BA 4FIPA 2VJEB 5FERA 1U6GB 2PNXA 2VJEA 2Y1NA 3PHDA 3IHPA 4BHWA 4PPEA 1WEOA 3C5KA 2LV9A 5G04B 4FJCA 2L5UA 4X3GA 4ZUXU 1VFYA 1WIMA 2G6QA 4I7CA 2MD8C 4GB0A 4F52B 2C2LA 2ECJA 2LGVA 3MHSA 2JMIA 4AUQB 1N87A 3O35A 1WGMA 3ZPV1 1WEEA 1X4UA 3DPLR 1RMDA 4GNEA 2ECWA 3N9OA 1WE9A 2KWKA 2LN0A 4CCGX 2L43A 3RPGC 2MUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDW A;  4YBT A;  2VPB A;  4A49 A;  2F42 A;  4A4C A;  1WES A;  2H0D A;  1WEV A;  5TRB A;  2ECI A;  2LGG A;  5LCW B;  1X4J A;  5LKT A;  4YAX A;  2Y1M A;  2YSM A;  2K17 A;  4YBM A;  1MM3 A;  2E6R A;  2UZG A;  4ZDT A;  1WEN A;  5I3L A;  3C6W A;  1HYI A;  1WIL A;  4R8P K;  4MSX A;  2ECG A;  2PUY A;  2EA6 A;  2BAY A;  5H9M A;  4UP5 A;  5B8D A;  4LKA A;  4V3K C;  5EYA F;  2MA6 A;  3M99 A;  1MM2 A;  3LQI A;  1F62 A;  4FO9 A;  2YU4 A;  3NG2 A;  1IYM A;  2MA5 A;  2KFT A;  3U5P A;  1WFK A;  2LGL A;  2LXP C;  2MNY A;  1Z6U A;  1G25 A;  2MD7 B;  2ECN A;  2YSJ A;  4WA6 A;  4P5O B;  2YUC A;  2M1R A;  3N9M A;  4XI1 A;  4N3W A;  1ZBD B;  3GV4 A;  2YRE A;  4I7D A;  4O64 A;  1JM7 B;  5JG6 A;  4UP0 A;  3ZVZ B;  1JM7 A;  3ASL A;  3ZYQ A;  2IDA A;  1FP0 A;  1T1H A;  4R2Y A;  1WEU A;  1E4U A;  4L58 A;  4WZ2 A;  3KQI A;  4V3L C;  4CA1 A;  3DQV R;  2QIC A;  1DVP A;  2KE1 A;  3GL6 A;  5DKA A;  3T6R A;  2LQ6 A;  4YBS A;  2I50 A;  1XWH A;  1K2F A;  2ECT A;  5J3X A;  3O36 A;  3HCT A;  5B78 A;  2QJ0 A;  2CKL B;  3L11 A;  3I2D A;  3EB6 A;  3LQH A;  2F6J A;  2RI7 A;  4C9Z A;  2DX8 A;  2LGK A;  4W4U A;  2ECV A;  4B86 C;  2YYR A;  3MHH A;  5KH9 A;  4FK5 A;  3HCS A;  2F6N A;  1Z2Q A;  3SHB A;  5FB1 A;  2EOD A;  1BOR A;  3N9P A;  5D1K B;  3U5M A;  1WEQ A;  4UI9 B;  4QF3 A;  1WEW A;  2LDR A;  2Y43 A;  5G05 B;  3SOU A;  3EB5 A;  2D8S A;  4WZ0 A;  2ZET C;  3HTK C;  2K4D A;  2YHO A;  1V87 A;  2XB1 A;  3T7L A;  5B79 A;  4LK9 A;  4GNG A;  2M85 A;  4LAD B;  2JMD A;  4N4F A;  3ZNI A;  2KWJ A;  2KRE A;  3LRQ A;  4YAD A;  2KWO A;  2E6S A;  2YW8 A;  5FB0 A;  5B76 A;  2RSD A;  4IC2 A;  3SOX A;  4QF2 A;  5FEY A;  3N9N A;  2YT5 A;  3M63 A;  2C2V S;  3O37 A;  4MVT A;  5AIT A;  1VYX A;  2L80 A;  2HYE D;  2MIQ A;  2VP7 A;  4AYC B;  4AVX A;  4AYC A;  4WZ3 B;  3V43 A;  2VPE A;  3KV5 A;  5H1V A;  1WEM A;  4IC3 A;  2FSA A;  4YC9 A;  4LLB A;  3O34 A;  3N9L A;  2KWN A;  5C11 A;  2LXH C;  3PUQ A;  1HYJ A;  3L1Z B;  5D1L B;  4ZQL A;  2KU3 A;  2QIZ A;  1JOC A;  2CSZ A;  4B7Y C;  4TKP B;  2FUI A;  2KIZ A;  2MT5 A;  5AIU A;  5H1T A;  3O70 A;  3ZPV E;  3N9Q A;  2KYU A;  4A4B A;  2VPG A;  2G43 A;  3M62 A;  2KGG A;  2CKL A;  2XEU A;  3U5O A;  3SOW A;  2CSY A;  4S3O B;  4PTB A;  5TBN A;  5DIN A;  4L7X A;  3O33 A;  5B77 A;  1LDJ B;  4S3O C;  2OXQ C;  4GND A;  2EGP A;  3PUR A;  4GNF A;  3RPG B;  4LJN A;  3ZTG A;  4BBQ A;  3HCU A;  5G0F A;  4R7E A;  4AP4 A;  5LKU A;  1LDK C;  3KNV A;  3KV6 A;  4Q6F A;  2KGI A;  2M3H A;  2VPD A;  2YQM A;  2VNF A;  2YUR A;  5D1M B;  1WEP A;  4I7B A;  2H0D B;  3LQJ A;  2CT2 A;  2M6M A;  2KR4 A;  5B75 A;  2JMJ A;  3RTR B;  2FUU A;  2K16 A;  1FBV A;  4YAB A;  2G45 A;  3U5N A;  2JRJ A;  3O7A A;  5LKX A;  2AN6 A;  5TDR A;  5KH3 A;  2YQL A;  2NAA A;  5KH7 A;  1X4I A;  3VK6 A;  1VD4 A;  4YAT A;  1CHC A;  5TAB A;  2K1J A;  5C13 A;  2LRI C;  4A0C D;  5H1U A;  3FL2 A;  5LKZ A;  4NN2 A;  3L1X A;  2MNZ A;  2VJF B;  1Z60 A;  2YHN A;  2VJF A;  3ZVY A;  2HDP A;  2L75 A;  3QZV A;  2L0B A;  4FIP A;  2VJE B;  5FER A;  1U6G B;  2PNX A;  2VJE A;  2Y1N A;  3PHD A;  3IHP A;  4BHW A;  4PPE A;  1WEO A;  3C5K A;  2LV9 A;  5G04 B;  4FJC A;  2L5U A;  4X3G A;  4ZUX U;  1VFY A;  1WIM A;  2G6Q A;  4I7C A;  2MD8 C;  4GB0 A;  4F52 B;  2C2L A;  2ECJ A;  2LGV A;  3MHS A;  2JMI A;  4AUQ B;  1N87 A;  3O35 A;  1WGM A;  3ZPV 1;  1WEE A;  1X4U A;  3DPL R;  1RMD A;  4GNE A;  2ECW A;  3N9O A;  1WE9 A;  2KWK A;  2LN0 A;  4CCG X;  2L43 A;  3RPG C;  2MUM A; 
#chains in the Genus database with same CATH topology
 5TDW A;  4YBT A;  2VPB A;  4A49 A;  2F42 A;  4A4C A;  1WES A;  2H0D A;  1WEV A;  5TRB A;  2XOC A;  2CRW A;  2ECI A;  2LGG A;  5LCW B;  1X4J A;  5LKT A;  4YAX A;  4F1P A;  2Y1M A;  2YSM A;  2K17 A;  4YBM A;  1MM3 A;  2E6R A;  2UZG A;  4ZDT A;  2EXU A;  1WEN A;  5I3L A;  3C6W A;  4OGE A;  1HYI A;  1WIL A;  4R8P K;  4MSX A;  2ECG A;  2PUY A;  2EA6 A;  2BAY A;  5H9M A;  4UP5 A;  5B8D A;  4LKA A;  4V3K C;  5EYA F;  2MA6 A;  3M99 A;  1MM2 A;  3LQI A;  1F62 A;  2LAU A;  4FO9 A;  2YU4 A;  3NG2 A;  1IYM A;  2MA5 A;  2KFT A;  3U5P A;  1WFK A;  2LGL A;  2LXP C;  3FJU B;  2MNY A;  1Z6U A;  1G25 A;  2MD7 B;  2ECN A;  2YSJ A;  4WA6 A;  4P5O B;  2YUC A;  2M1R A;  3N9M A;  4XI1 A;  4N3W A;  1ZBD B;  3GV4 A;  2YRE A;  4I7D A;  4O64 A;  1JM7 B;  5JG6 A;  4UP0 A;  3ZVZ B;  1JM7 A;  3ASL A;  3ZYQ A;  2IDA A;  1FP0 A;  1T1H A;  4R2Y A;  1WEU A;  1E4U A;  4L58 A;  4WZ2 A;  3KQI A;  3FAO A;  4V3L C;  4CA1 A;  3DQV R;  2QIC A;  1DVP A;  2KE1 A;  3GL6 A;  5DKA A;  5SVY A;  3T6R A;  2CSV A;  2LQ6 A;  4YBS A;  4H9D A;  4Z0O A;  2I50 A;  1XWH A;  1K2F A;  2ECT A;  5J3X A;  3O36 A;  3HCT A;  5B78 A;  2QJ0 A;  2CKL B;  3L11 A;  3I2D A;  3EB6 A;  3LQH A;  3H7H A;  2CRR A;  2F6J A;  2RI7 A;  4C9Z A;  2DX8 A;  2LGK A;  4W4U A;  2YVR A;  3DDT A;  2ECV A;  4B86 C;  2IQJ A;  2YYR A;  3MHH A;  5KH9 A;  4FK5 A;  3HCS A;  2F6N A;  1Z2Q A;  3SHB A;  5FB1 A;  2EOD A;  1BOR A;  2XOZ A;  3N9P A;  5D1K B;  3U5M A;  1WEQ A;  4UI9 B;  4QF3 A;  1WEW A;  2LDR A;  2Y43 A;  5G05 B;  3SOU A;  3EB5 A;  2D8S A;  4WZ0 A;  2ZET C;  3HTK C;  2FFW A;  2K4D A;  2YHO A;  1V87 A;  2XB1 A;  3T7L A;  5B79 A;  4LK9 A;  4GNG A;  2M85 A;  4LAD B;  2JMD A;  4N4F A;  3ZNI A;  2KWJ A;  2KRE A;  3LRQ A;  4YAD A;  2KWO A;  2EGM A;  2E6S A;  2JUN A;  2YW8 A;  1DCQ A;  5FB0 A;  3LJU X;  5B76 A;  2RSD A;  4IC2 A;  3SOX A;  4QF2 A;  2DSM A;  5FEY A;  3N9N A;  2YT5 A;  3M63 A;  2C2V S;  3O37 A;  4MVT A;  5AIT A;  1VYX A;  2L80 A;  2HYE D;  2MIQ A;  2VP7 A;  4AYC B;  4AVX A;  2FD4 A;  5SVI B;  4AYC A;  4O62 A;  3SUB A;  5SVI A;  4WZ3 B;  3V43 A;  2VPE A;  3KV5 A;  5H1V A;  1WEM A;  2KKY A;  4IC3 A;  2FSA A;  3FAN A;  4YC9 A;  4LLB A;  2OWA A;  3O34 A;  3N9L A;  2KWN A;  5C11 A;  2LXH C;  3PUQ A;  3LVQ E;  1HYJ A;  3L1Z B;  5D1L B;  4ZQL A;  2KU3 A;  2QIZ A;  1JOC A;  2CSZ A;  4B7Y C;  3JUE A;  4TKP B;  2FUI A;  2KIZ A;  2MT5 A;  3FEH A;  5AIU A;  5H1T A;  3O70 A;  3ZPV E;  2DJA A;  3N9Q A;  3PLW A;  2KYU A;  5SVX A;  4A4B A;  2VPG A;  2L7P A;  2G43 A;  3M62 A;  2KGG A;  2CKL A;  2D8U A;  2XEU A;  3U5O A;  3SOW A;  3LDY A;  2CSY A;  4S3O B;  4PTB A;  5TBN A;  5DIN A;  4L7X A;  3O33 A;  5B77 A;  1LDJ B;  4S3O C;  2OXQ C;  3Q1D A;  4GND A;  2EGP A;  3PUR A;  2MKE A;  4GNF A;  3RPG B;  4LJN A;  3ZTG A;  4BBQ A;  3HCU A;  5G0F A;  4R7E A;  4AP4 A;  5LKU A;  1LDK C;  3KNV A;  2XP0 A;  3KV6 A;  4Q6F A;  2KGI A;  2M3H A;  2VPD A;  2YQM A;  2VNF A;  2E61 A;  1MBM A;  2YUR A;  5D1M B;  2KKX A;  1WEP A;  4I7B A;  2H0D B;  3LQJ A;  2CT2 A;  3LVR E;  2M6M A;  2KR4 A;  5B75 A;  2JMJ A;  2P57 A;  3RTR B;  2FUU A;  3MDB C;  2K16 A;  1FBV A;  4YAB A;  2G45 A;  3U5N A;  2JRJ A;  3O7A A;  5LKX A;  2AN6 A;  5TDR A;  3O47 A;  5KH3 A;  2YQL A;  2NAA A;  5KH7 A;  1X4I A;  3VK6 A;  1VD4 A;  3E2D A;  4YAT A;  1CHC A;  5TAB A;  2K1J A;  5C13 A;  2LRI C;  4A0C D;  3FM8 C;  5H1U A;  3FL2 A;  4Z0R A;  4NN2 A;  5LKZ A;  3L1X A;  2MNZ A;  2VJF B;  1Z60 A;  2YHN A;  2VJF A;  3ZVY A;  2HDP A;  2L75 A;  3QZV A;  2L0B A;  4FIP A;  2VJE B;  5FER A;  1U6G B;  2PNX A;  2VJE A;  2Y1N A;  3PHD A;  3IHP A;  3DWD A;  4BHW A;  3T9K A;  4PPE A;  1WEO A;  3C5K A;  2XOY A;  2LV9 A;  5G04 B;  4QQ4 A;  4FJC A;  2L5U A;  4X3G A;  4ZUX U;  1VFY A;  1WIM A;  2G6Q A;  4I7C A;  3KDE C;  2M13 A;  2MD8 C;  2CON A;  2JM3 A;  4GB0 A;  5K3Q A;  4F52 B;  2C2L A;  2ECJ A;  2LGV A;  2B0O E;  3MHS A;  2JMI A;  4AUQ B;  1N87 A;  3O35 A;  1WGM A;  3ZPV 1;  1WEE A;  1X4U A;  3DPL R;  1RMD A;  4GNE A;  2ECW A;  3M7K A;  3N9O A;  1WE9 A;  2KWK A;  2LN0 A;  4OGC A;  4CCG X;  2L43 A;  3RPG C;  2RR4 A;  2MUM A; 
#chains in the Genus database with same CATH homology
 5TDW A;  4YBT A;  2VPB A;  4A49 A;  2F42 A;  4A4C A;  1WES A;  2H0D A;  1WEV A;  5TRB A;  2ECI A;  2LGG A;  5LCW B;  1X4J A;  5LKT A;  4YAX A;  2Y1M A;  2YSM A;  2K17 A;  4YBM A;  1MM3 A;  2E6R A;  2UZG A;  4ZDT A;  1WEN A;  5I3L A;  3C6W A;  1HYI A;  1WIL A;  4R8P K;  4MSX A;  2ECG A;  2PUY A;  2EA6 A;  2BAY A;  5H9M A;  4UP5 A;  5B8D A;  4LKA A;  4V3K C;  5EYA F;  2MA6 A;  3M99 A;  1MM2 A;  3LQI A;  1F62 A;  4FO9 A;  2YU4 A;  3NG2 A;  1IYM A;  2MA5 A;  2KFT A;  3U5P A;  1WFK A;  2LGL A;  2LXP C;  2MNY A;  1Z6U A;  1G25 A;  2MD7 B;  2ECN A;  2YSJ A;  4WA6 A;  4P5O B;  2YUC A;  2M1R A;  3N9M A;  4XI1 A;  4N3W A;  1ZBD B;  3GV4 A;  2YRE A;  4I7D A;  4O64 A;  1JM7 B;  5JG6 A;  4UP0 A;  3ZVZ B;  1JM7 A;  3ASL A;  3ZYQ A;  2IDA A;  1FP0 A;  1T1H A;  4R2Y A;  1WEU A;  1E4U A;  4L58 A;  4WZ2 A;  3KQI A;  4V3L C;  4CA1 A;  3DQV R;  2QIC A;  1DVP A;  2KE1 A;  3GL6 A;  5DKA A;  3T6R A;  2LQ6 A;  4YBS A;  2I50 A;  1XWH A;  1K2F A;  2ECT A;  5J3X A;  3O36 A;  3HCT A;  5B78 A;  2QJ0 A;  2CKL B;  3L11 A;  3I2D A;  3EB6 A;  3LQH A;  2F6J A;  2RI7 A;  4C9Z A;  2DX8 A;  2LGK A;  4W4U A;  2ECV A;  4B86 C;  2YYR A;  3MHH A;  5KH9 A;  4FK5 A;  3HCS A;  2F6N A;  1Z2Q A;  3SHB A;  5FB1 A;  2EOD A;  1BOR A;  3N9P A;  5D1K B;  3U5M A;  1WEQ A;  4UI9 B;  4QF3 A;  1WEW A;  2LDR A;  2Y43 A;  5G05 B;  3SOU A;  3EB5 A;  2D8S A;  4WZ0 A;  2ZET C;  3HTK C;  2K4D A;  2YHO A;  1V87 A;  2XB1 A;  3T7L A;  5B79 A;  4LK9 A;  4GNG A;  2M85 A;  4LAD B;  2JMD A;  4N4F A;  3ZNI A;  2KWJ A;  2KRE A;  3LRQ A;  4YAD A;  2KWO A;  2E6S A;  2YW8 A;  5FB0 A;  5B76 A;  2RSD A;  4IC2 A;  3SOX A;  4QF2 A;  5FEY A;  3N9N A;  2YT5 A;  3M63 A;  2C2V S;  3O37 A;  4MVT A;  5AIT A;  1VYX A;  2L80 A;  2HYE D;  2MIQ A;  2VP7 A;  4AYC B;  4AVX A;  4AYC A;  4WZ3 B;  3V43 A;  2VPE A;  3KV5 A;  5H1V A;  1WEM A;  4IC3 A;  2FSA A;  4YC9 A;  4LLB A;  3O34 A;  3N9L A;  2KWN A;  5C11 A;  2LXH C;  3PUQ A;  1HYJ A;  3L1Z B;  5D1L B;  4ZQL A;  2KU3 A;  2QIZ A;  1JOC A;  2CSZ A;  4B7Y C;  4TKP B;  2FUI A;  2KIZ A;  2MT5 A;  5AIU A;  5H1T A;  3O70 A;  3ZPV E;  3N9Q A;  2KYU A;  4A4B A;  2VPG A;  2G43 A;  3M62 A;  2KGG A;  2CKL A;  2XEU A;  3U5O A;  3SOW A;  2CSY A;  4S3O B;  4PTB A;  5TBN A;  5DIN A;  4L7X A;  3O33 A;  5B77 A;  1LDJ B;  4S3O C;  2OXQ C;  4GND A;  2EGP A;  3PUR A;  4GNF A;  3RPG B;  4LJN A;  3ZTG A;  4BBQ A;  3HCU A;  5G0F A;  4R7E A;  4AP4 A;  5LKU A;  1LDK C;  3KNV A;  3KV6 A;  4Q6F A;  2KGI A;  2M3H A;  2VPD A;  2YQM A;  2VNF A;  2YUR A;  5D1M B;  1WEP A;  4I7B A;  2H0D B;  3LQJ A;  2CT2 A;  2M6M A;  2KR4 A;  5B75 A;  2JMJ A;  3RTR B;  2FUU A;  2K16 A;  1FBV A;  4YAB A;  2G45 A;  3U5N A;  2JRJ A;  3O7A A;  5LKX A;  2AN6 A;  5TDR A;  5KH3 A;  2YQL A;  2NAA A;  5KH7 A;  1X4I A;  3VK6 A;  1VD4 A;  4YAT A;  1CHC A;  5TAB A;  2K1J A;  5C13 A;  2LRI C;  4A0C D;  5H1U A;  3FL2 A;  5LKZ A;  4NN2 A;  3L1X A;  2MNZ A;  2VJF B;  1Z60 A;  2YHN A;  2VJF A;  3ZVY A;  2HDP A;  2L75 A;  3QZV A;  2L0B A;  4FIP A;  2VJE B;  5FER A;  1U6G B;  2PNX A;  2VJE A;  2Y1N A;  3PHD A;  3IHP A;  4BHW A;  4PPE A;  1WEO A;  3C5K A;  2LV9 A;  5G04 B;  4FJC A;  2L5U A;  4X3G A;  4ZUX U;  1VFY A;  1WIM A;  2G6Q A;  4I7C A;  2MD8 C;  4GB0 A;  4F52 B;  2C2L A;  2ECJ A;  2LGV A;  3MHS A;  2JMI A;  4AUQ B;  1N87 A;  3O35 A;  1WGM A;  3ZPV 1;  1WEE A;  1X4U A;  3DPL R;  1RMD A;  4GNE A;  2ECW A;  3N9O A;  1WE9 A;  2KWK A;  2LN0 A;  4CCG X;  2L43 A;  3RPG C;  2MUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...