2M85A

Phd domain from human shprh
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
b'FNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase SHPRH
molecule tags Hydrolase,ligase
source organism Homo sapiens
publication title PHD domain from human SHPRH.
pubmed doi rcsb
total genus 7
structure length 65
sequence length 65
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m85A00
3LQIA 3N9LA 4XI1A 3EB5A 2LXHC 2C2LA 2LGLA 5TABA 5TDWA 2YSMA 2OXQC 1Z60A 2M6MA 2EODA 2M3HA 1LDJB 3O7AA 3NG2A 3L11A 2YUCA 3HCUA 1IYMA 2YW8A 3FL2A 5G05B 1FBVA 2G6QA 1VD4A 3C5KA 4R8PK 3U5MA 4GNFA 1MM2A 3N9OA 4O64A 4WA6A 2QICA 2MNYA 2KU3A 4UP0A 2FSAA 2KIZA 3HCTA 4NN2A 4R2YA 4Q6FA 3ZVYA 1HYIA 4GNDA 3GL6A 5KH3A 4W4UA 4R7EA 2PUYA 4AYCB 2FUUA 2VJEB 2K16A 4YATA 5TRBA 2VJEA 3ZTGA 2QIZA 4AUQB 1WEVA 2HDPA 3T7LA 4ZDTA 1FP0A 4AP4A 4A49A 1WEUA 3O34A 4I7BA 2MIQA 2E6RA 1WILA 1WE9A 4LK9A 4BHWA 1LDKC 3U5PA 3U5OA 2VPGA 2Y1NA 4N3WA 3HTKC 2KGGA 4S3OB 4MSXA 4YBMA 3EB6A 3ZYQA 4GNEA 5D1MB 2MT5A 3VK6A 2KWJA 1WEPA 2F6JA 2KE1A 2YU4A 4UI9B 4V3LC 5G04B 3ZPVE 3PUQA 3SOXA 5B78A 1WEOA 2VPDA 3O70A 5TBNA 2RSDA 3M99A 4YABA 2YHNA 2Y43A 4FO9A 4LJNA 2CSZA 4TKPB 4LADB 2G43A 2YQMA 3ZPV1 5LKUA 2KYUA 2CKLA 1DVPA 2ECGA 2ECIA 4I7CA 2CKLB 2LGVA 2YYRA 4FIPA 5LKXA 4IC3A 2AN6A 2MD7B 1WFKA 3QZVA 3N9QA 4YC9A 2DX8A 2L5UA 3T6RA 2NAAA 2LGKA 2VJFA 1V87A 2H0DB 2VJFB 3SHBA 4PTBA 4WZ2A 2LQ6A 5B8DA 2RI7A 3RPGB 4FK5A 4YAXA 3KNVA 4A4CA 2ECVA 2KR4A 2H0DA 1WIMA 4WZ0A 3PHDA 3O33A 5B75A 2MA6A 1X4IA 2VNFA 2KGIA 2L0BA 4MVTA 5H1VA 2MD8C 5FB1A 2K17A 1CHCA 3O35A 4ZQLA 2VPBA 3RPGC 4S3OC 2JMDA 2EGPA 2KWNA 4AVXA 2KREA 5JG6A 3MHHA 4GB0A 1ZBDB 2ECNA 1K2FA 1WEEA 2LV9A 1VYXA 3M63A 5B79A 3GV4A 3N9MA 3PURA 1RMDA 2YSJA 3KV5A 2KWOA 3N9PA 2D8SA 2CSYA 5H1TA 1WENA 2LRIC 3O37A 4YADA 2JRJA 3DPLR 2ECTA 1N87A 1WEWA 2LGGA 2MNZA 4WZ3B 1Z6UA 2XEUA 5DKAA 4I7DA 1U6GB 2Y1MA 2KWKA 2YURA 4YBTA 4B7YC 1X4JA 4F52B 2F6NA 3SOWA 2CT2A 5LCWB 3ASLA 3HCSA 1X4UA 5C13A 2MUMA 3V43A 2M1RA 1JOCA 2QJ0A 2JMJA 4A4BA 4L7XA 2K4DA 4N4FA 5I3LA 5TDRA 1XWHA 3ZVZB 2LN0A 2JMIA 4CCGX 2YREA 3M62A 5FERA 4QF3A 4ZUXU 3N9NA 2XB1A 2L80A 4B86C 4LLBA 1JM7B 2ECJA 2YT5A 4UP5A 1G25A 3L1XA 3LQHA 5FB0A 1MM3A 3L1ZB 5AIUA 4A0CD 4P5OB 2VP7A 1E4UA 5D1LB 3ZNIA 3MHSA 4AYCA 1F62A 5AITA 2VPEA 1WEQA 4PPEA 2LXPC 1BORA 4LKAA 3RTRB 1Z2QA 3O36A 1VFYA 2PNXA 2G45A 2UZGA 2EA6A 2KFTA 3I2DA 5LKZA 1WESA 1WGMA 2K1JA 2HYED 4FJCA 4QF2A 2L75A 3LQJA 2C2VS 4GNGA 4X3GA 3KV6A 4V3KC 5J3XA 5C11A 2YHOA 3U5NA 2FUIA 5DINA 3KQIA 4CA1A 1JM7A 5KH7A 5H1UA 5B77A 5G0FA 3DQVR 3LRQA 5LKTA 2M85A 2YQLA 2LDRA 2IDAA 4C9ZA 1WEMA 4YBSA 2ZETC 5H9MA 2F42A 3SOUA 3C6WA 5D1KB 2BAYA 4IC2A 2MA5A 5EYAF 5B76A 2ECWA 5KH9A 4BBQA 3IHPA 2E6SA 2L43A 1HYJA 1T1HA 2I50A 4L58A 5FEYA
chains in the Genus database with same CATH superfamily
3LQIA 3N9LA 4XI1A 3EB5A 2LXHC 2C2LA 2LGLA 5TABA 5TDWA 2YSMA 2OXQC 1Z60A 2M6MA 2EODA 2M3HA 1LDJB 5SVXA 3O7AA 3NG2A 3PLWA 5K3QA 3L11A 2YUCA 3HCUA 1IYMA 2YW8A 3FL2A 5G05B 1FBVA 2G6QA 1VD4A 3C5KA 4R8PK 3U5MA 4GNFA 1MM2A 3N9OA 4O64A 4WA6A 2QICA 2MNYA 2KU3A 4UP0A 2FSAA 2KIZA 3HCTA 4NN2A 4R2YA 4Q6FA 3ZVYA 1HYIA 4GNDA 3GL6A 5KH3A 4W4UA 3Q1DA 2MKEA 2PUYA 4R7EA 4AYCB 2FUUA 2VJEB 1MBMA 2IQJA 2K16A 4YATA 5TRBA 2VJEA 3ZTGA 2QIZA 4AUQB 1WEVA 2HDPA 3T7LA 4ZDTA 1FP0A 4AP4A 4A49A 1WEUA 3O34A 4I7BA 2MIQA 3T9KA 3H7HA 2E6RA 1WILA 1WE9A 2CRRA 3FAOA 4LK9A 2EXUA 4BHWA 1LDKC 3U5PA 3U5OA 2VPGA 3DWDA 2Y1NA 4N3WA 3LJUX 2JUNA 3HTKC 2KGGA 4S3OB 4MSXA 4YBMA 3EB6A 3ZYQA 4GNEA 5D1MB 2MT5A 3VK6A 2KWJA 2LAUA 1WEPA 2F6JA 2KE1A 2YU4A 4UI9B 4V3LC 5G04B 3ZPVE 3PUQA 2FD4A 3SOXA 2L7PA 5B78A 1WEOA 2XOCA 2VPDA 3O70A 5TBNA 3MDBC 3JUEA 2RSDA 3M99A 4YABA 2YHNA 2Y43A 4FO9A 4LJNA 2CSZA 4TKPB 4LADB 2G43A 2YQMA 2XOYA 3ZPV1 5LKUA 2KYUA 2CKLA 2FFWA 1DVPA 2ECGA 2ECIA 4I7CA 2CKLB 2XP0A 3FEHA 2LGVA 2YYRA 4FIPA 5LKXA 4IC3A 2AN6A 2MD7B 1WFKA 3QZVA 3N9QA 4YC9A 2DX8A 2L5UA 3T6RA 2NAAA 2KKYA 2LGKA 2VJFA 1V87A 2CONA 2H0DB 2VJFB 3LVRE 3SHBA 4PTBA 4WZ2A 2LQ6A 5B8DA 2RI7A 3RPGB 4FK5A 4YAXA 3KDEC 3KNVA 4A4CA 2ECVA 2KR4A 2H0DA 1WIMA 4WZ0A 3PHDA 2DJAA 2CSVA 3LDYA 3O33A 5B75A 2MA6A 1X4IA 2VNFA 3LVQE 2B0OE 2KGIA 2L0BA 4MVTA 5H1VA 2MD8C 5FB1A 2K17A 1CHCA 3O35A 4ZQLA 2VPBA 4Z0OA 3RPGC 4S3OC 2JMDA 2EGPA 2KWNA 4AVXA 2KREA 5JG6A 3MHHA 4GB0A 1ZBDB 2ECNA 1K2FA 1WEEA 2LV9A 1VYXA 3M63A 5B79A 3GV4A 3N9MA 3PURA 1RMDA 2RR4A 2YSJA 3KV5A 2KWOA 3N9PA 2D8SA 2CSYA 5H1TA 1WENA 2LRIC 3O37A 4YADA 2JRJA 3DPLR 2ECTA 2XOZA 1N87A 1WEWA 2LGGA 4QQ4A 2MNZA 4WZ3B 1Z6UA 2XEUA 5DKAA 4I7DA 1U6GB 2Y1MA 2DSMA 2KWKA 2YURA 4YBTA 4F1PA 4B7YC 1X4JA 5SVYA 4F52B 2F6NA 3SOWA 2CT2A 5LCWB 3ASLA 3HCSA 1X4UA 5C13A 2MUMA 3V43A 2M1RA 1JOCA 2D8UA 2QJ0A 2JMJA 4A4BA 3SUBA 4L7XA 2K4DA 2YVRA 4N4FA 5I3LA 5TDRA 1XWHA 2OWAA 4OGEA 3ZVZB 2LN0A 2JMIA 4CCGX 2YREA 3M62A 5FERA 4QF3A 4ZUXU 3N9NA 2XB1A 2L80A 4B86C 4LLBA 1JM7B 2ECJA 2YT5A 4UP5A 1G25A 3E2DA 3L1XA 3LQHA 5FB0A 1MM3A 3L1ZB 5AIUA 4A0CD 4P5OB 2VP7A 1E4UA 5D1LB 3ZNIA 3DDTA 3MHSA 4AYCA 1F62A 5AITA 4Z0RA 2VPEA 1WEQA 2EGMA 4PPEA 1DCQA 2LXPC 1BORA 4LKAA 3RTRB 1Z2QA 3O36A 1VFYA 2PNXA 2G45A 2UZGA 2KKXA 2EA6A 2KFTA 3FM8C 3O47A 3I2DA 5LKZA 1WESA 1WGMA 2K1JA 2HYED 4FJCA 4QF2A 2L75A 3LQJA 3FANA 2C2VS 4GNGA 4X3GA 3KV6A 4V3KC 5J3XA 2P57A 2JM3A 5C11A 2YHOA 3U5NA 2FUIA 5DINA 2CRWA 3KQIA 4CA1A 1JM7A 5KH7A 5H1UA 4H9DA 5B77A 5G0FA 2M13A 3DQVR 3LRQA 5LKTA 2M85A 2YQLA 2LDRA 2IDAA 4C9ZA 2E61A 1WEMA 4YBSA 2ZETC 5H9MA 2F42A 3SOUA 4OGCA 3C6WA 5SVIB 5D1KB 2BAYA 4IC2A 2MA5A 5EYAF 5B76A 2ECWA 5KH9A 4BBQA 3FJUB 3IHPA 4O62A 2E6SA 2L43A 3M7KA 5SVIA 1HYJA 1T1HA 2I50A 4L58A 5FEYA
chains in the Genus database with same CATH topology
3LQIA 3N9LA 4XI1A 3EB5A 2LXHC 2C2LA 2LGLA 5TABA 5TDWA 2YSMA 2OXQC 1Z60A 2M6MA 2EODA 2M3HA 1LDJB 3O7AA 3NG2A 3L11A 2YUCA 3HCUA 1IYMA 2YW8A 3FL2A 5G05B 1FBVA 2G6QA 1VD4A 3C5KA 4R8PK 3U5MA 4GNFA 1MM2A 3N9OA 4O64A 4WA6A 2QICA 2MNYA 2KU3A 4UP0A 2FSAA 2KIZA 3HCTA 4NN2A 4R2YA 4Q6FA 3ZVYA 1HYIA 4GNDA 3GL6A 5KH3A 4W4UA 4R7EA 2PUYA 4AYCB 2FUUA 2VJEB 2K16A 4YATA 5TRBA 2VJEA 3ZTGA 2QIZA 4AUQB 1WEVA 2HDPA 3T7LA 4ZDTA 1FP0A 4AP4A 4A49A 1WEUA 3O34A 4I7BA 2MIQA 2E6RA 1WILA 1WE9A 4LK9A 4BHWA 1LDKC 3U5PA 3U5OA 2VPGA 2Y1NA 4N3WA 3HTKC 2KGGA 4S3OB 4MSXA 4YBMA 3EB6A 3ZYQA 4GNEA 5D1MB 2MT5A 3VK6A 2KWJA 1WEPA 2F6JA 2KE1A 2YU4A 4UI9B 4V3LC 5G04B 3ZPVE 3PUQA 3SOXA 5B78A 1WEOA 2VPDA 3O70A 5TBNA 2RSDA 3M99A 4YABA 2YHNA 2Y43A 4FO9A 4LJNA 2CSZA 4TKPB 4LADB 2G43A 2YQMA 3ZPV1 5LKUA 2KYUA 2CKLA 1DVPA 2ECGA 2ECIA 4I7CA 2CKLB 2LGVA 2YYRA 4FIPA 5LKXA 4IC3A 2AN6A 2MD7B 1WFKA 3QZVA 3N9QA 4YC9A 2DX8A 2L5UA 3T6RA 2NAAA 2LGKA 2VJFA 1V87A 2H0DB 2VJFB 3SHBA 4PTBA 4WZ2A 2LQ6A 5B8DA 2RI7A 3RPGB 4FK5A 4YAXA 3KNVA 4A4CA 2ECVA 2KR4A 2H0DA 1WIMA 4WZ0A 3PHDA 3O33A 5B75A 2MA6A 1X4IA 2VNFA 2KGIA 2L0BA 4MVTA 5H1VA 2MD8C 5FB1A 2K17A 1CHCA 3O35A 4ZQLA 2VPBA 3RPGC 4S3OC 2JMDA 2EGPA 2KWNA 4AVXA 2KREA 5JG6A 3MHHA 4GB0A 1ZBDB 2ECNA 1K2FA 1WEEA 2LV9A 1VYXA 3M63A 5B79A 3GV4A 3N9MA 3PURA 1RMDA 2YSJA 3KV5A 2KWOA 3N9PA 2D8SA 2CSYA 5H1TA 1WENA 2LRIC 3O37A 4YADA 2JRJA 3DPLR 2ECTA 1N87A 1WEWA 2LGGA 2MNZA 4WZ3B 1Z6UA 2XEUA 5DKAA 4I7DA 1U6GB 2Y1MA 2KWKA 2YURA 4YBTA 4B7YC 1X4JA 4F52B 2F6NA 3SOWA 2CT2A 5LCWB 3ASLA 3HCSA 1X4UA 5C13A 2MUMA 3V43A 2M1RA 1JOCA 2QJ0A 2JMJA 4A4BA 4L7XA 2K4DA 4N4FA 5I3LA 5TDRA 1XWHA 3ZVZB 2LN0A 2JMIA 4CCGX 2YREA 3M62A 5FERA 4QF3A 4ZUXU 3N9NA 2XB1A 2L80A 4B86C 4LLBA 1JM7B 2ECJA 2YT5A 4UP5A 1G25A 3L1XA 3LQHA 5FB0A 1MM3A 3L1ZB 5AIUA 4A0CD 4P5OB 2VP7A 1E4UA 5D1LB 3ZNIA 3MHSA 4AYCA 1F62A 5AITA 2VPEA 1WEQA 4PPEA 2LXPC 1BORA 4LKAA 3RTRB 1Z2QA 3O36A 1VFYA 2PNXA 2G45A 2UZGA 2EA6A 2KFTA 3I2DA 5LKZA 1WESA 1WGMA 2K1JA 2HYED 4FJCA 4QF2A 2L75A 3LQJA 2C2VS 4GNGA 4X3GA 3KV6A 4V3KC 5J3XA 5C11A 2YHOA 3U5NA 2FUIA 5DINA 3KQIA 4CA1A 1JM7A 5KH7A 5H1UA 5B77A 5G0FA 3DQVR 3LRQA 5LKTA 2M85A 2YQLA 2LDRA 2IDAA 4C9ZA 1WEMA 4YBSA 2ZETC 5H9MA 2F42A 3SOUA 3C6WA 5D1KB 2BAYA 4IC2A 2MA5A 5EYAF 5B76A 2ECWA 5KH9A 4BBQA 3IHPA 2E6SA 2L43A 1HYJA 1T1HA 2I50A 4L58A 5FEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQI A;  3N9L A;  4XI1 A;  3EB5 A;  2LXH C;  2C2L A;  2LGL A;  5TAB A;  5TDW A;  2YSM A;  2OXQ C;  1Z60 A;  2M6M A;  2EOD A;  2M3H A;  1LDJ B;  3O7A A;  3NG2 A;  3L11 A;  2YUC A;  3HCU A;  1IYM A;  2YW8 A;  3FL2 A;  5G05 B;  1FBV A;  2G6Q A;  1VD4 A;  3C5K A;  4R8P K;  3U5M A;  4GNF A;  1MM2 A;  3N9O A;  4O64 A;  4WA6 A;  2QIC A;  2MNY A;  2KU3 A;  4UP0 A;  2FSA A;  2KIZ A;  3HCT A;  4NN2 A;  4R2Y A;  4Q6F A;  3ZVY A;  1HYI A;  4GND A;  3GL6 A;  5KH3 A;  4W4U A;  4R7E A;  2PUY A;  4AYC B;  2FUU A;  2VJE B;  2K16 A;  4YAT A;  5TRB A;  2VJE A;  3ZTG A;  2QIZ A;  4AUQ B;  1WEV A;  2HDP A;  3T7L A;  4ZDT A;  1FP0 A;  4AP4 A;  4A49 A;  1WEU A;  3O34 A;  4I7B A;  2MIQ A;  2E6R A;  1WIL A;  1WE9 A;  4LK9 A;  4BHW A;  1LDK C;  3U5P A;  3U5O A;  2VPG A;  2Y1N A;  4N3W A;  3HTK C;  2KGG A;  4S3O B;  4MSX A;  4YBM A;  3EB6 A;  3ZYQ A;  4GNE A;  5D1M B;  2MT5 A;  3VK6 A;  2KWJ A;  1WEP A;  2F6J A;  2KE1 A;  2YU4 A;  4UI9 B;  4V3L C;  5G04 B;  3ZPV E;  3PUQ A;  3SOX A;  5B78 A;  1WEO A;  2VPD A;  3O70 A;  5TBN A;  2RSD A;  3M99 A;  4YAB A;  2YHN A;  2Y43 A;  4FO9 A;  4LJN A;  2CSZ A;  4TKP B;  4LAD B;  2G43 A;  2YQM A;  3ZPV 1;  5LKU A;  2KYU A;  2CKL A;  1DVP A;  2ECG A;  2ECI A;  4I7C A;  2CKL B;  2LGV A;  2YYR A;  4FIP A;  5LKX A;  4IC3 A;  2AN6 A;  2MD7 B;  1WFK A;  3QZV A;  3N9Q A;  4YC9 A;  2DX8 A;  2L5U A;  3T6R A;  2NAA A;  2LGK A;  2VJF A;  1V87 A;  2H0D B;  2VJF B;  3SHB A;  4PTB A;  4WZ2 A;  2LQ6 A;  5B8D A;  2RI7 A;  3RPG B;  4FK5 A;  4YAX A;  3KNV A;  4A4C A;  2ECV A;  2KR4 A;  2H0D A;  1WIM A;  4WZ0 A;  3PHD A;  3O33 A;  5B75 A;  2MA6 A;  1X4I A;  2VNF A;  2KGI A;  2L0B A;  4MVT A;  5H1V A;  2MD8 C;  5FB1 A;  2K17 A;  1CHC A;  3O35 A;  4ZQL A;  2VPB A;  3RPG C;  4S3O C;  2JMD A;  2EGP A;  2KWN A;  4AVX A;  2KRE A;  5JG6 A;  3MHH A;  4GB0 A;  1ZBD B;  2ECN A;  1K2F A;  1WEE A;  2LV9 A;  1VYX A;  3M63 A;  5B79 A;  3GV4 A;  3N9M A;  3PUR A;  1RMD A;  2YSJ A;  3KV5 A;  2KWO A;  3N9P A;  2D8S A;  2CSY A;  5H1T A;  1WEN A;  2LRI C;  3O37 A;  4YAD A;  2JRJ A;  3DPL R;  2ECT A;  1N87 A;  1WEW A;  2LGG A;  2MNZ A;  4WZ3 B;  1Z6U A;  2XEU A;  5DKA A;  4I7D A;  1U6G B;  2Y1M A;  2KWK A;  2YUR A;  4YBT A;  4B7Y C;  1X4J A;  4F52 B;  2F6N A;  3SOW A;  2CT2 A;  5LCW B;  3ASL A;  3HCS A;  1X4U A;  5C13 A;  2MUM A;  3V43 A;  2M1R A;  1JOC A;  2QJ0 A;  2JMJ A;  4A4B A;  4L7X A;  2K4D A;  4N4F A;  5I3L A;  5TDR A;  1XWH A;  3ZVZ B;  2LN0 A;  2JMI A;  4CCG X;  2YRE A;  3M62 A;  5FER A;  4QF3 A;  4ZUX U;  3N9N A;  2XB1 A;  2L80 A;  4B86 C;  4LLB A;  1JM7 B;  2ECJ A;  2YT5 A;  4UP5 A;  1G25 A;  3L1X A;  3LQH A;  5FB0 A;  1MM3 A;  3L1Z B;  5AIU A;  4A0C D;  4P5O B;  2VP7 A;  1E4U A;  5D1L B;  3ZNI A;  3MHS A;  4AYC A;  1F62 A;  5AIT A;  2VPE A;  1WEQ A;  4PPE A;  2LXP C;  1BOR A;  4LKA A;  3RTR B;  1Z2Q A;  3O36 A;  1VFY A;  2PNX A;  2G45 A;  2UZG A;  2EA6 A;  2KFT A;  3I2D A;  5LKZ A;  1WES A;  1WGM A;  2K1J A;  2HYE D;  4FJC A;  4QF2 A;  2L75 A;  3LQJ A;  2C2V S;  4GNG A;  4X3G A;  3KV6 A;  4V3K C;  5J3X A;  5C11 A;  2YHO A;  3U5N A;  2FUI A;  5DIN A;  3KQI A;  4CA1 A;  1JM7 A;  5KH7 A;  5H1U A;  5B77 A;  5G0F A;  3DQV R;  3LRQ A;  5LKT A;  2M85 A;  2YQL A;  2LDR A;  2IDA A;  4C9Z A;  1WEM A;  4YBS A;  2ZET C;  5H9M A;  2F42 A;  3SOU A;  3C6W A;  5D1K B;  2BAY A;  4IC2 A;  2MA5 A;  5EYA F;  5B76 A;  2ECW A;  5KH9 A;  4BBQ A;  3IHP A;  2E6S A;  2L43 A;  1HYJ A;  1T1H A;  2I50 A;  4L58 A;  5FEY A; 
#chains in the Genus database with same CATH topology
 3LQI A;  3N9L A;  4XI1 A;  3EB5 A;  2LXH C;  2C2L A;  2LGL A;  5TAB A;  5TDW A;  2YSM A;  2OXQ C;  1Z60 A;  2M6M A;  2EOD A;  2M3H A;  1LDJ B;  5SVX A;  3O7A A;  3NG2 A;  3PLW A;  5K3Q A;  3L11 A;  2YUC A;  3HCU A;  1IYM A;  2YW8 A;  3FL2 A;  5G05 B;  1FBV A;  2G6Q A;  1VD4 A;  3C5K A;  4R8P K;  3U5M A;  4GNF A;  1MM2 A;  3N9O A;  4O64 A;  4WA6 A;  2QIC A;  2MNY A;  2KU3 A;  4UP0 A;  2FSA A;  2KIZ A;  3HCT A;  4NN2 A;  4R2Y A;  4Q6F A;  3ZVY A;  1HYI A;  4GND A;  3GL6 A;  5KH3 A;  4W4U A;  3Q1D A;  2MKE A;  2PUY A;  4R7E A;  4AYC B;  2FUU A;  2VJE B;  1MBM A;  2IQJ A;  2K16 A;  4YAT A;  5TRB A;  2VJE A;  3ZTG A;  2QIZ A;  4AUQ B;  1WEV A;  2HDP A;  3T7L A;  4ZDT A;  1FP0 A;  4AP4 A;  4A49 A;  1WEU A;  3O34 A;  4I7B A;  2MIQ A;  3T9K A;  3H7H A;  2E6R A;  1WIL A;  1WE9 A;  2CRR A;  3FAO A;  4LK9 A;  2EXU A;  4BHW A;  1LDK C;  3U5P A;  3U5O A;  2VPG A;  3DWD A;  2Y1N A;  4N3W A;  3LJU X;  2JUN A;  3HTK C;  2KGG A;  4S3O B;  4MSX A;  4YBM A;  3EB6 A;  3ZYQ A;  4GNE A;  5D1M B;  2MT5 A;  3VK6 A;  2KWJ A;  2LAU A;  1WEP A;  2F6J A;  2KE1 A;  2YU4 A;  4UI9 B;  4V3L C;  5G04 B;  3ZPV E;  3PUQ A;  2FD4 A;  3SOX A;  2L7P A;  5B78 A;  1WEO A;  2XOC A;  2VPD A;  3O70 A;  5TBN A;  3MDB C;  3JUE A;  2RSD A;  3M99 A;  4YAB A;  2YHN A;  2Y43 A;  4FO9 A;  4LJN A;  2CSZ A;  4TKP B;  4LAD B;  2G43 A;  2YQM A;  2XOY A;  3ZPV 1;  5LKU A;  2KYU A;  2CKL A;  2FFW A;  1DVP A;  2ECG A;  2ECI A;  4I7C A;  2CKL B;  2XP0 A;  3FEH A;  2LGV A;  2YYR A;  4FIP A;  5LKX A;  4IC3 A;  2AN6 A;  2MD7 B;  1WFK A;  3QZV A;  3N9Q A;  4YC9 A;  2DX8 A;  2L5U A;  3T6R A;  2NAA A;  2KKY A;  2LGK A;  2VJF A;  1V87 A;  2CON A;  2H0D B;  2VJF B;  3LVR E;  3SHB A;  4PTB A;  4WZ2 A;  2LQ6 A;  5B8D A;  2RI7 A;  3RPG B;  4FK5 A;  4YAX A;  3KDE C;  3KNV A;  4A4C A;  2ECV A;  2KR4 A;  2H0D A;  1WIM A;  4WZ0 A;  3PHD A;  2DJA A;  2CSV A;  3LDY A;  3O33 A;  5B75 A;  2MA6 A;  1X4I A;  2VNF A;  3LVQ E;  2B0O E;  2KGI A;  2L0B A;  4MVT A;  5H1V A;  2MD8 C;  5FB1 A;  2K17 A;  1CHC A;  3O35 A;  4ZQL A;  2VPB A;  4Z0O A;  3RPG C;  4S3O C;  2JMD A;  2EGP A;  2KWN A;  4AVX A;  2KRE A;  5JG6 A;  3MHH A;  4GB0 A;  1ZBD B;  2ECN A;  1K2F A;  1WEE A;  2LV9 A;  1VYX A;  3M63 A;  5B79 A;  3GV4 A;  3N9M A;  3PUR A;  1RMD A;  2RR4 A;  2YSJ A;  3KV5 A;  2KWO A;  3N9P A;  2D8S A;  2CSY A;  5H1T A;  1WEN A;  2LRI C;  3O37 A;  4YAD A;  2JRJ A;  3DPL R;  2ECT A;  2XOZ A;  1N87 A;  1WEW A;  2LGG A;  4QQ4 A;  2MNZ A;  4WZ3 B;  1Z6U A;  2XEU A;  5DKA A;  4I7D A;  1U6G B;  2Y1M A;  2DSM A;  2KWK A;  2YUR A;  4YBT A;  4F1P A;  4B7Y C;  1X4J A;  5SVY A;  4F52 B;  2F6N A;  3SOW A;  2CT2 A;  5LCW B;  3ASL A;  3HCS A;  1X4U A;  5C13 A;  2MUM A;  3V43 A;  2M1R A;  1JOC A;  2D8U A;  2QJ0 A;  2JMJ A;  4A4B A;  3SUB A;  4L7X A;  2K4D A;  2YVR A;  4N4F A;  5I3L A;  5TDR A;  1XWH A;  2OWA A;  4OGE A;  3ZVZ B;  2LN0 A;  2JMI A;  4CCG X;  2YRE A;  3M62 A;  5FER A;  4QF3 A;  4ZUX U;  3N9N A;  2XB1 A;  2L80 A;  4B86 C;  4LLB A;  1JM7 B;  2ECJ A;  2YT5 A;  4UP5 A;  1G25 A;  3E2D A;  3L1X A;  3LQH A;  5FB0 A;  1MM3 A;  3L1Z B;  5AIU A;  4A0C D;  4P5O B;  2VP7 A;  1E4U A;  5D1L B;  3ZNI A;  3DDT A;  3MHS A;  4AYC A;  1F62 A;  5AIT A;  4Z0R A;  2VPE A;  1WEQ A;  2EGM A;  4PPE A;  1DCQ A;  2LXP C;  1BOR A;  4LKA A;  3RTR B;  1Z2Q A;  3O36 A;  1VFY A;  2PNX A;  2G45 A;  2UZG A;  2KKX A;  2EA6 A;  2KFT A;  3FM8 C;  3O47 A;  3I2D A;  5LKZ A;  1WES A;  1WGM A;  2K1J A;  2HYE D;  4FJC A;  4QF2 A;  2L75 A;  3LQJ A;  3FAN A;  2C2V S;  4GNG A;  4X3G A;  3KV6 A;  4V3K C;  5J3X A;  2P57 A;  2JM3 A;  5C11 A;  2YHO A;  3U5N A;  2FUI A;  5DIN A;  2CRW A;  3KQI A;  4CA1 A;  1JM7 A;  5KH7 A;  5H1U A;  4H9D A;  5B77 A;  5G0F A;  2M13 A;  3DQV R;  3LRQ A;  5LKT A;  2M85 A;  2YQL A;  2LDR A;  2IDA A;  4C9Z A;  2E61 A;  1WEM A;  4YBS A;  2ZET C;  5H9M A;  2F42 A;  3SOU A;  4OGC A;  3C6W A;  5SVI B;  5D1K B;  2BAY A;  4IC2 A;  2MA5 A;  5EYA F;  5B76 A;  2ECW A;  5KH9 A;  4BBQ A;  3FJU B;  3IHP A;  4O62 A;  2E6S A;  2L43 A;  3M7K A;  5SVI A;  1HYJ A;  1T1H A;  2I50 A;  4L58 A;  5FEY A; 
#chains in the Genus database with same CATH homology
 3LQI A;  3N9L A;  4XI1 A;  3EB5 A;  2LXH C;  2C2L A;  2LGL A;  5TAB A;  5TDW A;  2YSM A;  2OXQ C;  1Z60 A;  2M6M A;  2EOD A;  2M3H A;  1LDJ B;  3O7A A;  3NG2 A;  3L11 A;  2YUC A;  3HCU A;  1IYM A;  2YW8 A;  3FL2 A;  5G05 B;  1FBV A;  2G6Q A;  1VD4 A;  3C5K A;  4R8P K;  3U5M A;  4GNF A;  1MM2 A;  3N9O A;  4O64 A;  4WA6 A;  2QIC A;  2MNY A;  2KU3 A;  4UP0 A;  2FSA A;  2KIZ A;  3HCT A;  4NN2 A;  4R2Y A;  4Q6F A;  3ZVY A;  1HYI A;  4GND A;  3GL6 A;  5KH3 A;  4W4U A;  4R7E A;  2PUY A;  4AYC B;  2FUU A;  2VJE B;  2K16 A;  4YAT A;  5TRB A;  2VJE A;  3ZTG A;  2QIZ A;  4AUQ B;  1WEV A;  2HDP A;  3T7L A;  4ZDT A;  1FP0 A;  4AP4 A;  4A49 A;  1WEU A;  3O34 A;  4I7B A;  2MIQ A;  2E6R A;  1WIL A;  1WE9 A;  4LK9 A;  4BHW A;  1LDK C;  3U5P A;  3U5O A;  2VPG A;  2Y1N A;  4N3W A;  3HTK C;  2KGG A;  4S3O B;  4MSX A;  4YBM A;  3EB6 A;  3ZYQ A;  4GNE A;  5D1M B;  2MT5 A;  3VK6 A;  2KWJ A;  1WEP A;  2F6J A;  2KE1 A;  2YU4 A;  4UI9 B;  4V3L C;  5G04 B;  3ZPV E;  3PUQ A;  3SOX A;  5B78 A;  1WEO A;  2VPD A;  3O70 A;  5TBN A;  2RSD A;  3M99 A;  4YAB A;  2YHN A;  2Y43 A;  4FO9 A;  4LJN A;  2CSZ A;  4TKP B;  4LAD B;  2G43 A;  2YQM A;  3ZPV 1;  5LKU A;  2KYU A;  2CKL A;  1DVP A;  2ECG A;  2ECI A;  4I7C A;  2CKL B;  2LGV A;  2YYR A;  4FIP A;  5LKX A;  4IC3 A;  2AN6 A;  2MD7 B;  1WFK A;  3QZV A;  3N9Q A;  4YC9 A;  2DX8 A;  2L5U A;  3T6R A;  2NAA A;  2LGK A;  2VJF A;  1V87 A;  2H0D B;  2VJF B;  3SHB A;  4PTB A;  4WZ2 A;  2LQ6 A;  5B8D A;  2RI7 A;  3RPG B;  4FK5 A;  4YAX A;  3KNV A;  4A4C A;  2ECV A;  2KR4 A;  2H0D A;  1WIM A;  4WZ0 A;  3PHD A;  3O33 A;  5B75 A;  2MA6 A;  1X4I A;  2VNF A;  2KGI A;  2L0B A;  4MVT A;  5H1V A;  2MD8 C;  5FB1 A;  2K17 A;  1CHC A;  3O35 A;  4ZQL A;  2VPB A;  3RPG C;  4S3O C;  2JMD A;  2EGP A;  2KWN A;  4AVX A;  2KRE A;  5JG6 A;  3MHH A;  4GB0 A;  1ZBD B;  2ECN A;  1K2F A;  1WEE A;  2LV9 A;  1VYX A;  3M63 A;  5B79 A;  3GV4 A;  3N9M A;  3PUR A;  1RMD A;  2YSJ A;  3KV5 A;  2KWO A;  3N9P A;  2D8S A;  2CSY A;  5H1T A;  1WEN A;  2LRI C;  3O37 A;  4YAD A;  2JRJ A;  3DPL R;  2ECT A;  1N87 A;  1WEW A;  2LGG A;  2MNZ A;  4WZ3 B;  1Z6U A;  2XEU A;  5DKA A;  4I7D A;  1U6G B;  2Y1M A;  2KWK A;  2YUR A;  4YBT A;  4B7Y C;  1X4J A;  4F52 B;  2F6N A;  3SOW A;  2CT2 A;  5LCW B;  3ASL A;  3HCS A;  1X4U A;  5C13 A;  2MUM A;  3V43 A;  2M1R A;  1JOC A;  2QJ0 A;  2JMJ A;  4A4B A;  4L7X A;  2K4D A;  4N4F A;  5I3L A;  5TDR A;  1XWH A;  3ZVZ B;  2LN0 A;  2JMI A;  4CCG X;  2YRE A;  3M62 A;  5FER A;  4QF3 A;  4ZUX U;  3N9N A;  2XB1 A;  2L80 A;  4B86 C;  4LLB A;  1JM7 B;  2ECJ A;  2YT5 A;  4UP5 A;  1G25 A;  3L1X A;  3LQH A;  5FB0 A;  1MM3 A;  3L1Z B;  5AIU A;  4A0C D;  4P5O B;  2VP7 A;  1E4U A;  5D1L B;  3ZNI A;  3MHS A;  4AYC A;  1F62 A;  5AIT A;  2VPE A;  1WEQ A;  4PPE A;  2LXP C;  1BOR A;  4LKA A;  3RTR B;  1Z2Q A;  3O36 A;  1VFY A;  2PNX A;  2G45 A;  2UZG A;  2EA6 A;  2KFT A;  3I2D A;  5LKZ A;  1WES A;  1WGM A;  2K1J A;  2HYE D;  4FJC A;  4QF2 A;  2L75 A;  3LQJ A;  2C2V S;  4GNG A;  4X3G A;  3KV6 A;  4V3K C;  5J3X A;  5C11 A;  2YHO A;  3U5N A;  2FUI A;  5DIN A;  3KQI A;  4CA1 A;  1JM7 A;  5KH7 A;  5H1U A;  5B77 A;  5G0F A;  3DQV R;  3LRQ A;  5LKT A;  2M85 A;  2YQL A;  2LDR A;  2IDA A;  4C9Z A;  1WEM A;  4YBS A;  2ZET C;  5H9M A;  2F42 A;  3SOU A;  3C6W A;  5D1K B;  2BAY A;  4IC2 A;  2MA5 A;  5EYA F;  5B76 A;  2ECW A;  5KH9 A;  4BBQ A;  3IHP A;  2E6S A;  2L43 A;  1HYJ A;  1T1H A;  2I50 A;  4L58 A;  5FEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...