2NAAA

Nsd1-phd_5-c5hch tandem domain structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
b'GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi
molecule tags Transcription
source organism Mus musculus
publication title Structural basis for PHDVC5HCHNSD1-C2HRNizp1 interaction: implications for Sotos syndrome.
pubmed doi rcsb
total genus 17
structure length 94
sequence length 94
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2naaA00
3PURA 3SOWA 2YQLA 4UI9B 4W4UA 2YURA 2CSYA 1WEOA 1WESA 5TABA 2HYED 2F6NA 2EA6A 2FSAA 2MNZA 4FIPA 5B75A 2F42A 2MD8C 3KNVA 2G43A 3T6RA 5DINA 1WIMA 1HYJA 4UP5A 4PTBA 4MSXA 2RSDA 2M6MA 4AUQB 2CKLA 5TRBA 2JMIA 2QJ0A 5J3XA 5G04B 4YBMA 3EB5A 3N9QA 2ECIA 5H1UA 2BAYA 5LKZA 2KR4A 3U5OA 1VYXA 2G45A 2LXHC 2YU4A 2LGLA 2ZETC 3C6WA 4YADA 4B86C 4B7YC 1X4JA 2E6RA 3DQVR 2MA5A 4BBQA 2LRIC 4O64A 5H1TA 2PUYA 2EGPA 2IDAA 3N9OA 2PNXA 5LKUA 2VJEA 1FBVA 2YUCA 2XB1A 1V87A 2YREA 2MNYA 1WGMA 2QIZA 4LADB 2KWKA 2QICA 4FO9A 2LV9A 2L0BA 1X4UA 3FL2A 4R8PK 2VPGA 1WEWA 2KFTA 5D1MB 2ECWA 5B76A 5D1LB 5FB0A 4F52B 2KIZA 3O34A 3O7AA 1BORA 1WEUA 3T7LA 3N9NA 3GL6A 2KU3A 5KH9A 2L80A 3N9MA 2HDPA 3L11A 2L75A 2KGGA 4L58A 4FK5A 4L7XA 4R2YA 5EYAF 3C5KA 3ZPV1 3RTRB 4CA1A 4A4BA 2EODA 4I7CA 3O36A 2YYRA 1K2FA 2VPDA 4V3LC 3N9LA 4LK9A 3MHHA 3PUQA 2F6JA 2MUMA 4TKPB 3N9PA 5FB1A 4YC9A 3RPGC 4BHWA 2Y1MA 2LDRA 3I2DA 3O33A 4LJNA 3LRQA 1JOCA 4GNFA 2KREA 3M62A 5B79A 5LKXA 3EB6A 3M99A 1JM7B 1MM2A 3L1XA 1FP0A 1U6GB 4Q6FA 2OXQC 4AYCB 5C13A 3U5NA 1WEVA 4A0CD 2K4DA 3LQHA 2FUIA 5H9MA 4N3WA 2H0DA 4GNEA 2YT5A 3DPLR 1VFYA 3KV5A 5I3LA 2ECGA 2XEUA 3SHBA 2DX8A 1WE9A 2K16A 3QZVA 4GNGA 5JG6A 1F62A 2NAAA 4IC2A 1VD4A 1MM3A 2G6QA 2KWOA 3HCUA 3MHSA 1E4UA 1RMDA 4A49A 4ZUXU 2CSZA 5AIUA 2L5UA 2I50A 5B78A 2ECTA 3HTKC 2YSMA 2K17A 4V3KC 1WEPA 2JRJA 2VJFA 2KE1A 4UP0A 3V43A 2VPBA 4QF3A 2LN0A 3VK6A 1IYMA 5AITA 4WA6A 5FEYA 1XWHA 2H0DB 1CHCA 4A4CA 3U5MA 3LQIA 3ZNIA 2ECJA 1HYIA 4FJCA 4YAXA 1X4IA 1T1HA 5DKAA 5FERA 4GNDA 1G25A 1WEQA 5B77A 1DVPA 4LLBA 4P5OB 4S3OB 4IC3A 2Y1NA 2KYUA 2KGIA 2E6SA 4YABA 3O37A 3ZVYA 3ZVZB 2M85A 2Y43A 2LGGA 4WZ0A 2L43A 4GB0A 3U5PA 2JMDA 3IHPA 2VJEB 2MD7B 3NG2A 5D1KB 3L1ZB 2UZGA 3O70A 1LDKC 4YATA 2VJFB 4C9ZA 3ASLA 2LXPC 5TDRA 3GV4A 2AN6A 2K1JA 3ZPVE 4YBSA 2MA6A 4S3OC 1ZBDB 5LCWB 2KWJA 4X3GA 3HCTA 1Z60A 4QF2A 4ZDTA 1N87A 2ECVA 3PHDA 3HCSA 1WFKA 4WZ2A 5H1VA 2FUUA 2VNFA 2CKLB 2YW8A 2LGKA 2KWNA 3RPGB 4AVXA 1WEEA 3O35A 4ZQLA 2C2VS 5LKTA 1WEMA 5C11A 2VP7A 3SOXA 2CT2A 5TDWA 1Z6UA 2C2LA 4CCGX 2YQMA 5TBNA 2M1RA 2M3HA 2D8SA 3KQIA 4YBTA 2MIQA 2VPEA 5G0FA 4N4FA 2ECNA 2LGVA 2YHNA 2MT5A 2RI7A 4R7EA 5KH7A 2LQ6A 1WENA 3KV6A 1Z2QA 4XI1A 3M63A 5KH3A 4AYCA 1JM7A 1LDJB 4WZ3B 2YHOA 2JMJA 3ZTGA 4MVTA 5B8DA 1WILA 4LKAA 3ZYQA 4PPEA 3LQJA 4NN2A 5G05B 3SOUA 2YSJA 4I7BA 4AP4A 4I7DA
chains in the Genus database with same CATH superfamily
3PURA 3SOWA 2YQLA 3MDBC 2OWAA 4UI9B 4W4UA 2YURA 2CSYA 1WEOA 1WESA 2JM3A 5TABA 2HYED 2F6NA 2EA6A 2FSAA 2MNZA 4FIPA 5B75A 2F42A 2MD8C 3KNVA 2G43A 3T6RA 5DINA 1WIMA 1HYJA 4UP5A 4PTBA 4MSXA 2RSDA 2M6MA 3LDYA 4AUQB 2CKLA 5TRBA 3FANA 2JMIA 2QJ0A 5J3XA 5G04B 4YBMA 3EB5A 3N9QA 2ECIA 3FM8C 3JUEA 5H1UA 2BAYA 5LKZA 2KR4A 3U5OA 1VYXA 2G45A 2LXHC 2CSVA 2YU4A 2LGLA 2ZETC 3C6WA 4YADA 4B86C 4F1PA 4B7YC 1X4JA 2E6RA 3DQVR 2MA5A 4BBQA 2LRIC 4O64A 5H1TA 2PUYA 2EGPA 2IDAA 3N9OA 2PNXA 5LKUA 2FFWA 2VJEA 2M13A 1FBVA 2YUCA 2XB1A 1V87A 2YREA 2MNYA 1WGMA 5K3QA 2QIZA 4LADB 2KWKA 2QICA 4FO9A 2DJAA 2LV9A 2L0BA 2B0OE 2RR4A 1X4UA 3FL2A 4R8PK 2VPGA 1WEWA 2KFTA 5D1MB 2ECWA 3M7KA 5B76A 5D1LB 5FB0A 2EGMA 2EXUA 2KKXA 4F52B 2KIZA 3O34A 2XOYA 3O7AA 1BORA 1WEUA 3T7LA 3N9NA 2XOCA 3GL6A 2KU3A 5KH9A 4OGEA 2L80A 3DWDA 3N9MA 2HDPA 3L11A 2L75A 2KGGA 4L58A 4FK5A 4L7XA 4R2YA 3FEHA 3C5KA 5EYAF 3ZPV1 3RTRB 4CA1A 4A4BA 5SVIB 2EODA 2L7PA 4I7CA 3O36A 2YYRA 1K2FA 2VPDA 4V3LC 3N9LA 4LK9A 3MHHA 3PUQA 2F6JA 2KKYA 2MUMA 4TKPB 4Z0OA 2JUNA 3N9PA 5FB1A 4YC9A 3RPGC 2Y1MA 4BHWA 2LDRA 3I2DA 3O33A 4LJNA 3LRQA 1JOCA 4Z0RA 4GNFA 2KREA 3M62A 5B79A 5LKXA 3EB6A 3M99A 1JM7B 1MM2A 3L1XA 1FP0A 1U6GB 4Q6FA 2OXQC 4AYCB 5C13A 3U5NA 1WEVA 4QQ4A 2CONA 4A0CD 2K4DA 3LQHA 2FUIA 5H9MA 4N3WA 2H0DA 2CRRA 4GNEA 2YT5A 3DPLR 1VFYA 3KV5A 5I3LA 4H9DA 2ECGA 2XEUA 3SHBA 2DX8A 1WE9A 5SVIA 3KDEC 2K16A 3QZVA 4GNGA 5JG6A 1F62A 2NAAA 4IC2A 1VD4A 1MM3A 3DDTA 2G6QA 2KWOA 3HCUA 3MHSA 1E4UA 1RMDA 4A49A 4ZUXU 2CSZA 5AIUA 2L5UA 2I50A 5B78A 3FAOA 2ECTA 3HTKC 2YSMA 2K17A 4V3KC 1WEPA 2JRJA 2VJFA 2KE1A 2FD4A 4UP0A 3V43A 2VPBA 4QF3A 2DSMA 2LN0A 3PLWA 4OGCA 2LAUA 5SVXA 3VK6A 1IYMA 5AITA 4WA6A 5FEYA 1XWHA 2H0DB 1CHCA 4A4CA 3E2DA 3U5MA 3LQIA 3ZNIA 2ECJA 5SVYA 1HYIA 4FJCA 4YAXA 1X4IA 1T1HA 2CRWA 5DKAA 4GNDA 5FERA 2XOZA 1G25A 1WEQA 5B77A 1DVPA 4P5OB 4LLBA 4S3OB 4IC3A 2Y1NA 2KYUA 3LJUX 2KGIA 2E6SA 4YABA 3O37A 3ZVYA 3ZVZB 2M85A 2Y43A 2LGGA 4WZ0A 2L43A 4GB0A 3U5PA 2JMDA 3IHPA 2VJEB 2MD7B 3H7HA 3FJUB 3NG2A 5D1KB 3L1ZB 2UZGA 3O70A 1LDKC 2MKEA 1MBMA 4YATA 2VJFB 4C9ZA 3ASLA 2LXPC 5TDRA 3GV4A 2AN6A 2YVRA 2K1JA 3ZPVE 4YBSA 2MA6A 1DCQA 4S3OC 1ZBDB 5LCWB 2KWJA 4X3GA 3HCTA 1Z60A 2IQJA 3SUBA 4QF2A 4ZDTA 1N87A 2E61A 2ECVA 3PHDA 3HCSA 1WFKA 4WZ2A 5H1VA 2FUUA 2VNFA 2CKLB 2YW8A 2LGKA 2KWNA 3RPGB 4O62A 4AVXA 1WEEA 3O35A 4ZQLA 2C2VS 5LKTA 1WEMA 5C11A 2VP7A 2XP0A 3SOXA 2CT2A 5TDWA 1Z6UA 2C2LA 4CCGX 2YQMA 5TBNA 2M1RA 2M3HA 2D8SA 3KQIA 4YBTA 2MIQA 3O47A 2VPEA 5G0FA 4N4FA 2ECNA 2LGVA 2YHNA 2MT5A 2RI7A 4R7EA 5KH7A 2LQ6A 1WENA 3KV6A 1Z2QA 4XI1A 3M63A 5KH3A 4AYCA 1JM7A 1LDJB 4WZ3B 2YHOA 3Q1DA 2JMJA 3ZTGA 4MVTA 5B8DA 1WILA 4LKAA 3ZYQA 4PPEA 3LQJA 4NN2A 5G05B 2P57A 3LVQE 2D8UA 3SOUA 2YSJA 4I7BA 3T9KA 4AP4A 3LVRE 4I7DA
chains in the Genus database with same CATH topology
3PURA 3SOWA 2YQLA 4UI9B 4W4UA 2YURA 2CSYA 1WEOA 1WESA 5TABA 2HYED 2F6NA 2EA6A 2FSAA 2MNZA 4FIPA 5B75A 2F42A 2MD8C 3KNVA 2G43A 3T6RA 5DINA 1WIMA 1HYJA 4UP5A 4PTBA 4MSXA 2RSDA 2M6MA 4AUQB 2CKLA 5TRBA 2JMIA 2QJ0A 5J3XA 5G04B 4YBMA 3EB5A 3N9QA 2ECIA 5H1UA 2BAYA 5LKZA 2KR4A 3U5OA 1VYXA 2G45A 2LXHC 2YU4A 2LGLA 2ZETC 3C6WA 4YADA 4B86C 4B7YC 1X4JA 2E6RA 3DQVR 2MA5A 4BBQA 2LRIC 4O64A 5H1TA 2PUYA 2EGPA 2IDAA 3N9OA 2PNXA 5LKUA 2VJEA 1FBVA 2YUCA 2XB1A 1V87A 2YREA 2MNYA 1WGMA 2QIZA 4LADB 2KWKA 2QICA 4FO9A 2LV9A 2L0BA 1X4UA 3FL2A 4R8PK 2VPGA 1WEWA 2KFTA 5D1MB 2ECWA 5B76A 5D1LB 5FB0A 4F52B 2KIZA 3O34A 3O7AA 1BORA 1WEUA 3T7LA 3N9NA 3GL6A 2KU3A 5KH9A 2L80A 3N9MA 2HDPA 3L11A 2L75A 2KGGA 4L58A 4FK5A 4L7XA 4R2YA 5EYAF 3C5KA 3ZPV1 3RTRB 4CA1A 4A4BA 2EODA 4I7CA 3O36A 2YYRA 1K2FA 2VPDA 4V3LC 3N9LA 4LK9A 3MHHA 3PUQA 2F6JA 2MUMA 4TKPB 3N9PA 5FB1A 4YC9A 3RPGC 4BHWA 2Y1MA 2LDRA 3I2DA 3O33A 4LJNA 3LRQA 1JOCA 4GNFA 2KREA 3M62A 5B79A 5LKXA 3EB6A 3M99A 1JM7B 1MM2A 3L1XA 1FP0A 1U6GB 4Q6FA 2OXQC 4AYCB 5C13A 3U5NA 1WEVA 4A0CD 2K4DA 3LQHA 2FUIA 5H9MA 4N3WA 2H0DA 4GNEA 2YT5A 3DPLR 1VFYA 3KV5A 5I3LA 2ECGA 2XEUA 3SHBA 2DX8A 1WE9A 2K16A 3QZVA 4GNGA 5JG6A 1F62A 2NAAA 4IC2A 1VD4A 1MM3A 2G6QA 2KWOA 3HCUA 3MHSA 1E4UA 1RMDA 4A49A 4ZUXU 2CSZA 5AIUA 2L5UA 2I50A 5B78A 2ECTA 3HTKC 2YSMA 2K17A 4V3KC 1WEPA 2JRJA 2VJFA 2KE1A 4UP0A 3V43A 2VPBA 4QF3A 2LN0A 3VK6A 1IYMA 5AITA 4WA6A 5FEYA 1XWHA 2H0DB 1CHCA 4A4CA 3U5MA 3LQIA 3ZNIA 2ECJA 1HYIA 4FJCA 4YAXA 1X4IA 1T1HA 5DKAA 5FERA 4GNDA 1G25A 1WEQA 5B77A 1DVPA 4LLBA 4P5OB 4S3OB 4IC3A 2Y1NA 2KYUA 2KGIA 2E6SA 4YABA 3O37A 3ZVYA 3ZVZB 2M85A 2Y43A 2LGGA 4WZ0A 2L43A 4GB0A 3U5PA 2JMDA 3IHPA 2VJEB 2MD7B 3NG2A 5D1KB 3L1ZB 2UZGA 3O70A 1LDKC 4YATA 2VJFB 4C9ZA 3ASLA 2LXPC 5TDRA 3GV4A 2AN6A 2K1JA 3ZPVE 4YBSA 2MA6A 4S3OC 1ZBDB 5LCWB 2KWJA 4X3GA 3HCTA 1Z60A 4QF2A 4ZDTA 1N87A 2ECVA 3PHDA 3HCSA 1WFKA 4WZ2A 5H1VA 2FUUA 2VNFA 2CKLB 2YW8A 2LGKA 2KWNA 3RPGB 4AVXA 1WEEA 3O35A 4ZQLA 2C2VS 5LKTA 1WEMA 5C11A 2VP7A 3SOXA 2CT2A 5TDWA 1Z6UA 2C2LA 4CCGX 2YQMA 5TBNA 2M1RA 2M3HA 2D8SA 3KQIA 4YBTA 2MIQA 2VPEA 5G0FA 4N4FA 2ECNA 2LGVA 2YHNA 2MT5A 2RI7A 4R7EA 5KH7A 2LQ6A 1WENA 3KV6A 1Z2QA 4XI1A 3M63A 5KH3A 4AYCA 1JM7A 1LDJB 4WZ3B 2YHOA 2JMJA 3ZTGA 4MVTA 5B8DA 1WILA 4LKAA 3ZYQA 4PPEA 3LQJA 4NN2A 5G05B 3SOUA 2YSJA 4I7BA 4AP4A 4I7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUR A;  3SOW A;  2YQL A;  4UI9 B;  4W4U A;  2YUR A;  2CSY A;  1WEO A;  1WES A;  5TAB A;  2HYE D;  2F6N A;  2EA6 A;  2FSA A;  2MNZ A;  4FIP A;  5B75 A;  2F42 A;  2MD8 C;  3KNV A;  2G43 A;  3T6R A;  5DIN A;  1WIM A;  1HYJ A;  4UP5 A;  4PTB A;  4MSX A;  2RSD A;  2M6M A;  4AUQ B;  2CKL A;  5TRB A;  2JMI A;  2QJ0 A;  5J3X A;  5G04 B;  4YBM A;  3EB5 A;  3N9Q A;  2ECI A;  5H1U A;  2BAY A;  5LKZ A;  2KR4 A;  3U5O A;  1VYX A;  2G45 A;  2LXH C;  2YU4 A;  2LGL A;  2ZET C;  3C6W A;  4YAD A;  4B86 C;  4B7Y C;  1X4J A;  2E6R A;  3DQV R;  2MA5 A;  4BBQ A;  2LRI C;  4O64 A;  5H1T A;  2PUY A;  2EGP A;  2IDA A;  3N9O A;  2PNX A;  5LKU A;  2VJE A;  1FBV A;  2YUC A;  2XB1 A;  1V87 A;  2YRE A;  2MNY A;  1WGM A;  2QIZ A;  4LAD B;  2KWK A;  2QIC A;  4FO9 A;  2LV9 A;  2L0B A;  1X4U A;  3FL2 A;  4R8P K;  2VPG A;  1WEW A;  2KFT A;  5D1M B;  2ECW A;  5B76 A;  5D1L B;  5FB0 A;  4F52 B;  2KIZ A;  3O34 A;  3O7A A;  1BOR A;  1WEU A;  3T7L A;  3N9N A;  3GL6 A;  2KU3 A;  5KH9 A;  2L80 A;  3N9M A;  2HDP A;  3L11 A;  2L75 A;  2KGG A;  4L58 A;  4FK5 A;  4L7X A;  4R2Y A;  5EYA F;  3C5K A;  3ZPV 1;  3RTR B;  4CA1 A;  4A4B A;  2EOD A;  4I7C A;  3O36 A;  2YYR A;  1K2F A;  2VPD A;  4V3L C;  3N9L A;  4LK9 A;  3MHH A;  3PUQ A;  2F6J A;  2MUM A;  4TKP B;  3N9P A;  5FB1 A;  4YC9 A;  3RPG C;  4BHW A;  2Y1M A;  2LDR A;  3I2D A;  3O33 A;  4LJN A;  3LRQ A;  1JOC A;  4GNF A;  2KRE A;  3M62 A;  5B79 A;  5LKX A;  3EB6 A;  3M99 A;  1JM7 B;  1MM2 A;  3L1X A;  1FP0 A;  1U6G B;  4Q6F A;  2OXQ C;  4AYC B;  5C13 A;  3U5N A;  1WEV A;  4A0C D;  2K4D A;  3LQH A;  2FUI A;  5H9M A;  4N3W A;  2H0D A;  4GNE A;  2YT5 A;  3DPL R;  1VFY A;  3KV5 A;  5I3L A;  2ECG A;  2XEU A;  3SHB A;  2DX8 A;  1WE9 A;  2K16 A;  3QZV A;  4GNG A;  5JG6 A;  1F62 A;  2NAA A;  4IC2 A;  1VD4 A;  1MM3 A;  2G6Q A;  2KWO A;  3HCU A;  3MHS A;  1E4U A;  1RMD A;  4A49 A;  4ZUX U;  2CSZ A;  5AIU A;  2L5U A;  2I50 A;  5B78 A;  2ECT A;  3HTK C;  2YSM A;  2K17 A;  4V3K C;  1WEP A;  2JRJ A;  2VJF A;  2KE1 A;  4UP0 A;  3V43 A;  2VPB A;  4QF3 A;  2LN0 A;  3VK6 A;  1IYM A;  5AIT A;  4WA6 A;  5FEY A;  1XWH A;  2H0D B;  1CHC A;  4A4C A;  3U5M A;  3LQI A;  3ZNI A;  2ECJ A;  1HYI A;  4FJC A;  4YAX A;  1X4I A;  1T1H A;  5DKA A;  5FER A;  4GND A;  1G25 A;  1WEQ A;  5B77 A;  1DVP A;  4LLB A;  4P5O B;  4S3O B;  4IC3 A;  2Y1N A;  2KYU A;  2KGI A;  2E6S A;  4YAB A;  3O37 A;  3ZVY A;  3ZVZ B;  2M85 A;  2Y43 A;  2LGG A;  4WZ0 A;  2L43 A;  4GB0 A;  3U5P A;  2JMD A;  3IHP A;  2VJE B;  2MD7 B;  3NG2 A;  5D1K B;  3L1Z B;  2UZG A;  3O70 A;  1LDK C;  4YAT A;  2VJF B;  4C9Z A;  3ASL A;  2LXP C;  5TDR A;  3GV4 A;  2AN6 A;  2K1J A;  3ZPV E;  4YBS A;  2MA6 A;  4S3O C;  1ZBD B;  5LCW B;  2KWJ A;  4X3G A;  3HCT A;  1Z60 A;  4QF2 A;  4ZDT A;  1N87 A;  2ECV A;  3PHD A;  3HCS A;  1WFK A;  4WZ2 A;  5H1V A;  2FUU A;  2VNF A;  2CKL B;  2YW8 A;  2LGK A;  2KWN A;  3RPG B;  4AVX A;  1WEE A;  3O35 A;  4ZQL A;  2C2V S;  5LKT A;  1WEM A;  5C11 A;  2VP7 A;  3SOX A;  2CT2 A;  5TDW A;  1Z6U A;  2C2L A;  4CCG X;  2YQM A;  5TBN A;  2M1R A;  2M3H A;  2D8S A;  3KQI A;  4YBT A;  2MIQ A;  2VPE A;  5G0F A;  4N4F A;  2ECN A;  2LGV A;  2YHN A;  2MT5 A;  2RI7 A;  4R7E A;  5KH7 A;  2LQ6 A;  1WEN A;  3KV6 A;  1Z2Q A;  4XI1 A;  3M63 A;  5KH3 A;  4AYC A;  1JM7 A;  1LDJ B;  4WZ3 B;  2YHO A;  2JMJ A;  3ZTG A;  4MVT A;  5B8D A;  1WIL A;  4LKA A;  3ZYQ A;  4PPE A;  3LQJ A;  4NN2 A;  5G05 B;  3SOU A;  2YSJ A;  4I7B A;  4AP4 A;  4I7D A; 
#chains in the Genus database with same CATH topology
 3PUR A;  3SOW A;  2YQL A;  3MDB C;  2OWA A;  4UI9 B;  4W4U A;  2YUR A;  2CSY A;  1WEO A;  1WES A;  2JM3 A;  5TAB A;  2HYE D;  2F6N A;  2EA6 A;  2FSA A;  2MNZ A;  4FIP A;  5B75 A;  2F42 A;  2MD8 C;  3KNV A;  2G43 A;  3T6R A;  5DIN A;  1WIM A;  1HYJ A;  4UP5 A;  4PTB A;  4MSX A;  2RSD A;  2M6M A;  3LDY A;  4AUQ B;  2CKL A;  5TRB A;  3FAN A;  2JMI A;  2QJ0 A;  5J3X A;  5G04 B;  4YBM A;  3EB5 A;  3N9Q A;  2ECI A;  3FM8 C;  3JUE A;  5H1U A;  2BAY A;  5LKZ A;  2KR4 A;  3U5O A;  1VYX A;  2G45 A;  2LXH C;  2CSV A;  2YU4 A;  2LGL A;  2ZET C;  3C6W A;  4YAD A;  4B86 C;  4F1P A;  4B7Y C;  1X4J A;  2E6R A;  3DQV R;  2MA5 A;  4BBQ A;  2LRI C;  4O64 A;  5H1T A;  2PUY A;  2EGP A;  2IDA A;  3N9O A;  2PNX A;  5LKU A;  2FFW A;  2VJE A;  2M13 A;  1FBV A;  2YUC A;  2XB1 A;  1V87 A;  2YRE A;  2MNY A;  1WGM A;  5K3Q A;  2QIZ A;  4LAD B;  2KWK A;  2QIC A;  4FO9 A;  2DJA A;  2LV9 A;  2L0B A;  2B0O E;  2RR4 A;  1X4U A;  3FL2 A;  4R8P K;  2VPG A;  1WEW A;  2KFT A;  5D1M B;  2ECW A;  3M7K A;  5B76 A;  5D1L B;  5FB0 A;  2EGM A;  2EXU A;  2KKX A;  4F52 B;  2KIZ A;  3O34 A;  2XOY A;  3O7A A;  1BOR A;  1WEU A;  3T7L A;  3N9N A;  2XOC A;  3GL6 A;  2KU3 A;  5KH9 A;  4OGE A;  2L80 A;  3DWD A;  3N9M A;  2HDP A;  3L11 A;  2L75 A;  2KGG A;  4L58 A;  4FK5 A;  4L7X A;  4R2Y A;  3FEH A;  3C5K A;  5EYA F;  3ZPV 1;  3RTR B;  4CA1 A;  4A4B A;  5SVI B;  2EOD A;  2L7P A;  4I7C A;  3O36 A;  2YYR A;  1K2F A;  2VPD A;  4V3L C;  3N9L A;  4LK9 A;  3MHH A;  3PUQ A;  2F6J A;  2KKY A;  2MUM A;  4TKP B;  4Z0O A;  2JUN A;  3N9P A;  5FB1 A;  4YC9 A;  3RPG C;  2Y1M A;  4BHW A;  2LDR A;  3I2D A;  3O33 A;  4LJN A;  3LRQ A;  1JOC A;  4Z0R A;  4GNF A;  2KRE A;  3M62 A;  5B79 A;  5LKX A;  3EB6 A;  3M99 A;  1JM7 B;  1MM2 A;  3L1X A;  1FP0 A;  1U6G B;  4Q6F A;  2OXQ C;  4AYC B;  5C13 A;  3U5N A;  1WEV A;  4QQ4 A;  2CON A;  4A0C D;  2K4D A;  3LQH A;  2FUI A;  5H9M A;  4N3W A;  2H0D A;  2CRR A;  4GNE A;  2YT5 A;  3DPL R;  1VFY A;  3KV5 A;  5I3L A;  4H9D A;  2ECG A;  2XEU A;  3SHB A;  2DX8 A;  1WE9 A;  5SVI A;  3KDE C;  2K16 A;  3QZV A;  4GNG A;  5JG6 A;  1F62 A;  2NAA A;  4IC2 A;  1VD4 A;  1MM3 A;  3DDT A;  2G6Q A;  2KWO A;  3HCU A;  3MHS A;  1E4U A;  1RMD A;  4A49 A;  4ZUX U;  2CSZ A;  5AIU A;  2L5U A;  2I50 A;  5B78 A;  3FAO A;  2ECT A;  3HTK C;  2YSM A;  2K17 A;  4V3K C;  1WEP A;  2JRJ A;  2VJF A;  2KE1 A;  2FD4 A;  4UP0 A;  3V43 A;  2VPB A;  4QF3 A;  2DSM A;  2LN0 A;  3PLW A;  4OGC A;  2LAU A;  5SVX A;  3VK6 A;  1IYM A;  5AIT A;  4WA6 A;  5FEY A;  1XWH A;  2H0D B;  1CHC A;  4A4C A;  3E2D A;  3U5M A;  3LQI A;  3ZNI A;  2ECJ A;  5SVY A;  1HYI A;  4FJC A;  4YAX A;  1X4I A;  1T1H A;  2CRW A;  5DKA A;  4GND A;  5FER A;  2XOZ A;  1G25 A;  1WEQ A;  5B77 A;  1DVP A;  4P5O B;  4LLB A;  4S3O B;  4IC3 A;  2Y1N A;  2KYU A;  3LJU X;  2KGI A;  2E6S A;  4YAB A;  3O37 A;  3ZVY A;  3ZVZ B;  2M85 A;  2Y43 A;  2LGG A;  4WZ0 A;  2L43 A;  4GB0 A;  3U5P A;  2JMD A;  3IHP A;  2VJE B;  2MD7 B;  3H7H A;  3FJU B;  3NG2 A;  5D1K B;  3L1Z B;  2UZG A;  3O70 A;  1LDK C;  2MKE A;  1MBM A;  4YAT A;  2VJF B;  4C9Z A;  3ASL A;  2LXP C;  5TDR A;  3GV4 A;  2AN6 A;  2YVR A;  2K1J A;  3ZPV E;  4YBS A;  2MA6 A;  1DCQ A;  4S3O C;  1ZBD B;  5LCW B;  2KWJ A;  4X3G A;  3HCT A;  1Z60 A;  2IQJ A;  3SUB A;  4QF2 A;  4ZDT A;  1N87 A;  2E61 A;  2ECV A;  3PHD A;  3HCS A;  1WFK A;  4WZ2 A;  5H1V A;  2FUU A;  2VNF A;  2CKL B;  2YW8 A;  2LGK A;  2KWN A;  3RPG B;  4O62 A;  4AVX A;  1WEE A;  3O35 A;  4ZQL A;  2C2V S;  5LKT A;  1WEM A;  5C11 A;  2VP7 A;  2XP0 A;  3SOX A;  2CT2 A;  5TDW A;  1Z6U A;  2C2L A;  4CCG X;  2YQM A;  5TBN A;  2M1R A;  2M3H A;  2D8S A;  3KQI A;  4YBT A;  2MIQ A;  3O47 A;  2VPE A;  5G0F A;  4N4F A;  2ECN A;  2LGV A;  2YHN A;  2MT5 A;  2RI7 A;  4R7E A;  5KH7 A;  2LQ6 A;  1WEN A;  3KV6 A;  1Z2Q A;  4XI1 A;  3M63 A;  5KH3 A;  4AYC A;  1JM7 A;  1LDJ B;  4WZ3 B;  2YHO A;  3Q1D A;  2JMJ A;  3ZTG A;  4MVT A;  5B8D A;  1WIL A;  4LKA A;  3ZYQ A;  4PPE A;  3LQJ A;  4NN2 A;  5G05 B;  2P57 A;  3LVQ E;  2D8U A;  3SOU A;  2YSJ A;  4I7B A;  3T9K A;  4AP4 A;  3LVR E;  4I7D A; 
#chains in the Genus database with same CATH homology
 3PUR A;  3SOW A;  2YQL A;  4UI9 B;  4W4U A;  2YUR A;  2CSY A;  1WEO A;  1WES A;  5TAB A;  2HYE D;  2F6N A;  2EA6 A;  2FSA A;  2MNZ A;  4FIP A;  5B75 A;  2F42 A;  2MD8 C;  3KNV A;  2G43 A;  3T6R A;  5DIN A;  1WIM A;  1HYJ A;  4UP5 A;  4PTB A;  4MSX A;  2RSD A;  2M6M A;  4AUQ B;  2CKL A;  5TRB A;  2JMI A;  2QJ0 A;  5J3X A;  5G04 B;  4YBM A;  3EB5 A;  3N9Q A;  2ECI A;  5H1U A;  2BAY A;  5LKZ A;  2KR4 A;  3U5O A;  1VYX A;  2G45 A;  2LXH C;  2YU4 A;  2LGL A;  2ZET C;  3C6W A;  4YAD A;  4B86 C;  4B7Y C;  1X4J A;  2E6R A;  3DQV R;  2MA5 A;  4BBQ A;  2LRI C;  4O64 A;  5H1T A;  2PUY A;  2EGP A;  2IDA A;  3N9O A;  2PNX A;  5LKU A;  2VJE A;  1FBV A;  2YUC A;  2XB1 A;  1V87 A;  2YRE A;  2MNY A;  1WGM A;  2QIZ A;  4LAD B;  2KWK A;  2QIC A;  4FO9 A;  2LV9 A;  2L0B A;  1X4U A;  3FL2 A;  4R8P K;  2VPG A;  1WEW A;  2KFT A;  5D1M B;  2ECW A;  5B76 A;  5D1L B;  5FB0 A;  4F52 B;  2KIZ A;  3O34 A;  3O7A A;  1BOR A;  1WEU A;  3T7L A;  3N9N A;  3GL6 A;  2KU3 A;  5KH9 A;  2L80 A;  3N9M A;  2HDP A;  3L11 A;  2L75 A;  2KGG A;  4L58 A;  4FK5 A;  4L7X A;  4R2Y A;  5EYA F;  3C5K A;  3ZPV 1;  3RTR B;  4CA1 A;  4A4B A;  2EOD A;  4I7C A;  3O36 A;  2YYR A;  1K2F A;  2VPD A;  4V3L C;  3N9L A;  4LK9 A;  3MHH A;  3PUQ A;  2F6J A;  2MUM A;  4TKP B;  3N9P A;  5FB1 A;  4YC9 A;  3RPG C;  4BHW A;  2Y1M A;  2LDR A;  3I2D A;  3O33 A;  4LJN A;  3LRQ A;  1JOC A;  4GNF A;  2KRE A;  3M62 A;  5B79 A;  5LKX A;  3EB6 A;  3M99 A;  1JM7 B;  1MM2 A;  3L1X A;  1FP0 A;  1U6G B;  4Q6F A;  2OXQ C;  4AYC B;  5C13 A;  3U5N A;  1WEV A;  4A0C D;  2K4D A;  3LQH A;  2FUI A;  5H9M A;  4N3W A;  2H0D A;  4GNE A;  2YT5 A;  3DPL R;  1VFY A;  3KV5 A;  5I3L A;  2ECG A;  2XEU A;  3SHB A;  2DX8 A;  1WE9 A;  2K16 A;  3QZV A;  4GNG A;  5JG6 A;  1F62 A;  2NAA A;  4IC2 A;  1VD4 A;  1MM3 A;  2G6Q A;  2KWO A;  3HCU A;  3MHS A;  1E4U A;  1RMD A;  4A49 A;  4ZUX U;  2CSZ A;  5AIU A;  2L5U A;  2I50 A;  5B78 A;  2ECT A;  3HTK C;  2YSM A;  2K17 A;  4V3K C;  1WEP A;  2JRJ A;  2VJF A;  2KE1 A;  4UP0 A;  3V43 A;  2VPB A;  4QF3 A;  2LN0 A;  3VK6 A;  1IYM A;  5AIT A;  4WA6 A;  5FEY A;  1XWH A;  2H0D B;  1CHC A;  4A4C A;  3U5M A;  3LQI A;  3ZNI A;  2ECJ A;  1HYI A;  4FJC A;  4YAX A;  1X4I A;  1T1H A;  5DKA A;  5FER A;  4GND A;  1G25 A;  1WEQ A;  5B77 A;  1DVP A;  4LLB A;  4P5O B;  4S3O B;  4IC3 A;  2Y1N A;  2KYU A;  2KGI A;  2E6S A;  4YAB A;  3O37 A;  3ZVY A;  3ZVZ B;  2M85 A;  2Y43 A;  2LGG A;  4WZ0 A;  2L43 A;  4GB0 A;  3U5P A;  2JMD A;  3IHP A;  2VJE B;  2MD7 B;  3NG2 A;  5D1K B;  3L1Z B;  2UZG A;  3O70 A;  1LDK C;  4YAT A;  2VJF B;  4C9Z A;  3ASL A;  2LXP C;  5TDR A;  3GV4 A;  2AN6 A;  2K1J A;  3ZPV E;  4YBS A;  2MA6 A;  4S3O C;  1ZBD B;  5LCW B;  2KWJ A;  4X3G A;  3HCT A;  1Z60 A;  4QF2 A;  4ZDT A;  1N87 A;  2ECV A;  3PHD A;  3HCS A;  1WFK A;  4WZ2 A;  5H1V A;  2FUU A;  2VNF A;  2CKL B;  2YW8 A;  2LGK A;  2KWN A;  3RPG B;  4AVX A;  1WEE A;  3O35 A;  4ZQL A;  2C2V S;  5LKT A;  1WEM A;  5C11 A;  2VP7 A;  3SOX A;  2CT2 A;  5TDW A;  1Z6U A;  2C2L A;  4CCG X;  2YQM A;  5TBN A;  2M1R A;  2M3H A;  2D8S A;  3KQI A;  4YBT A;  2MIQ A;  2VPE A;  5G0F A;  4N4F A;  2ECN A;  2LGV A;  2YHN A;  2MT5 A;  2RI7 A;  4R7E A;  5KH7 A;  2LQ6 A;  1WEN A;  3KV6 A;  1Z2Q A;  4XI1 A;  3M63 A;  5KH3 A;  4AYC A;  1JM7 A;  1LDJ B;  4WZ3 B;  2YHO A;  2JMJ A;  3ZTG A;  4MVT A;  5B8D A;  1WIL A;  4LKA A;  3ZYQ A;  4PPE A;  3LQJ A;  4NN2 A;  5G05 B;  3SOU A;  2YSJ A;  4I7B A;  4AP4 A;  4I7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...