2NAAA

Nsd1-phd_5-c5hch tandem domain structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for PHDVC5HCHNSD1-C2HRNizp1 interaction: implications for Sotos syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi
total genus 17
structure length 94
sequence length 94
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2naaA00
4ZDTA 3GV4A 3RTRB 2ECJA 4WZ3B 5D1MB 3M62A 2M85A 2KGIA 3O34A 3N9PA 1HYIA 5DKAA 2LGKA 4QF2A 2YUCA 5H1UA 1JM7A 2H0DB 4YADA 5J3XA 2MA6A 5FB0A 4R8PK 5TDRA 3HCTA 3O35A 5TABA 2F6JA 2ECWA 2CT2A 3ZPV1 2ECVA 4S3OB 2EGPA 1T1HA 3FL2A 2ECIA 1VYXA 5B79A 3NG2A 3O33A 4GNEA 3SOXA 3HCUA 4LADB 5TBNA 3EB5A 2C2LA 3O37A 2VP7A 2YREA 4WZ2A 4A4CA 4W4UA 3RPGC 4AYCB 2FUIA 3HTKC 2CSZA 4N4FA 3N9OA 2MT5A 1F62A 1CHCA 1WEPA 2EODA 2CKLA 2L80A 4ZUXU 3SOWA 5LKZA 1X4UA 3LQJA 5H1VA 2M3HA 5D1KB 1WEWA 2YURA 2MIQA 2C2VS 5H9MA 3M99A 2YW8A 2KREA 4YBTA 4UI9B 4UP0A 2MNZA 2K1JA 1X4IA 4MSXA 5B77A 1Z60A 2I50A 5B78A 5LKXA 1WEMA 2NAAA 2LQ6A 2MNYA 2E6RA 1WEVA 2L75A 2VJEA 3ASLA 3C6WA 2MA5A 3T7LA 4UP5A 3PURA 4YC9A 2JMIA 2KR4A 2HYED 4V3KC 4R7EA 4AVXA 2Y43A 3RPGB 4O64A 4NN2A 1DVPA 2UZGA 2LXPC 5I3LA 4A4BA 5G04B 2QJ0A 2H0DA 3N9MA 1WEOA 4LJNA 3ZTGA 5G05B 5TDWA 4S3OC 2LV9A 2YU4A 2YSMA 5KH7A 2JMJA 4GNDA 3LRQA 3O7AA 1G25A 2BAYA 2QICA 4P5OB 5FB1A 3U5PA 5KH9A 2YSJA 2KWNA 1JM7B 2XB1A 3O70A 4LKAA 2VPBA 4YATA 4A0CD 2HDPA 3VK6A 2VJFA 4BHWA 2Y1NA 2OXQC 2AN6A 1V87A 2KIZA 5D1LB 5B76A 4YAXA 5FEYA 5TRBA 1JOCA 1WENA 2VPGA 4AP4A 1WESA 2CKLB 1WE9A 2K4DA 4WZ0A 5C11A 2ZETC 4FIPA 2KWKA 2KE1A 2G45A 3ZVZB 4PPEA 4R2YA 3C5KA 5EYAF 2DX8A 1WGMA 3KV5A 2JRJA 2LGLA 3KV6A 5LKTA 4FK5A 5B75A 1N87A 4IC3A 1WFKA 3KNVA 3DPLR 4YBMA 5AITA 3M63A 3ZYQA 2LGGA 3PHDA 3DQVR 1HYJA 2FUUA 4I7BA 1VD4A 2CSYA 4N3WA 1XWHA 4B7YC 2YHNA 2KWJA 2K17A 5G0FA 2F6NA 5LKUA 5JG6A 4QF3A 2YQLA 3SOUA 2RSDA 4GNFA 1ZBDB 4GNGA 2F42A 2ECNA 4ZQLA 2YT5A 2LN0A 3N9LA 5FERA 2LGVA 2L43A 1U6GB 2QIZA 3PUQA 2KGGA 3HCSA 4AYCA 5C13A 1E4UA 3L1ZB 3ZVYA 2EA6A 3U5OA 4FJCA 5KH3A 2D8SA 2L0BA 2KYUA 3U5NA 1Z6UA 3ZNIA 2G6QA 2YYRA 3O36A 3N9QA 1MM2A 1WILA 4F52B 3L1XA 3IHPA 2RI7A 4C9ZA 1X4JA 2LXHC 3L11A 4I7CA 4TKPB 1VFYA 1FP0A 3T6RA 3KQIA 3EB6A 2KWOA 2VPEA 4V3LC 2KFTA 3LQHA 4YABA 3U5MA 2L5UA 3LQIA 4IC2A 2IDAA 1FBVA 5B8DA 2PUYA 2PNXA 4LLBA 1WEEA 1WEUA 2KU3A 2G43A 4BBQA 4GB0A 4A49A 1LDKC 5DINA 4YBSA 2Y1MA 4MVTA 2ECTA 2MD8C 2MUMA 1MM3A 3SHBA 4PTBA 5AIUA 4FO9A 4XI1A 3ZPVE 2VPDA 4L7XA 4CA1A 2ECGA 2XEUA 5H1TA 2MD7B 1IYMA 2JMDA 2YHOA 1K2FA 3MHSA 2VNFA 4CCGX 4I7DA 3V43A 3GL6A 1WEQA 5LCWB 2LDRA 2VJEB 4B86C 3MHHA 4LK9A 2YQMA 1WIMA 4WA6A 2M6MA 4Q6FA 2E6SA 3N9NA 4AUQB 2K16A 1LDJB 1RMDA 2VJFB 2LRIC 2FSAA 4L58A 3QZVA 1BORA 2M1RA 4X3GA 1Z2QA 3I2DA
chains in the Genus database with same CATH superfamily
4ZDTA 3GV4A 3RTRB 2ECJA 4WZ3B 5D1MB 3FEHA 3M62A 2M85A 2KGIA 3O34A 3N9PA 1HYIA 5DKAA 2LGKA 4QF2A 2YUCA 5H1UA 1JM7A 2H0DB 4YADA 5J3XA 2MA6A 5FB0A 4R8PK 3SUBA 5K3QA 5TDRA 3HCTA 3O35A 5TABA 2F6JA 2ECWA 2E61A 2CT2A 3ZPV1 2ECVA 4S3OB 2EGPA 1T1HA 3FL2A 2ECIA 2KKXA 1VYXA 5B79A 3NG2A 3O33A 4GNEA 3SOXA 3HCUA 4LADB 5SVIA 5TBNA 3EB5A 2C2LA 3O37A 2VP7A 2YREA 4WZ2A 2LAUA 4A4CA 4W4UA 3RPGC 4AYCB 2FUIA 3HTKC 3DDTA 2CSZA 4N4FA 3N9OA 2MT5A 1F62A 1CHCA 1WEPA 2EODA 2CKLA 2L80A 4ZUXU 3SOWA 5LKZA 1X4UA 3LQJA 5H1VA 2M3HA 5D1KB 2D8UA 1WEWA 2YURA 2B0OE 2MIQA 2C2VS 5H9MA 3M99A 2YW8A 2KREA 4YBTA 4UI9B 4UP0A 2MNZA 2K1JA 1X4IA 4MSXA 5B77A 1Z60A 2I50A 5B78A 5LKXA 1WEMA 2NAAA 2LQ6A 2MNYA 2E6RA 1WEVA 2L75A 2VJEA 3ASLA 3C6WA 2MA5A 3T7LA 4UP5A 3PURA 2IQJA 4YC9A 2JMIA 2KR4A 2HYED 4V3KC 4R7EA 4AVXA 1DCQA 2CONA 2Y43A 3RPGB 4O64A 3LDYA 4NN2A 1DVPA 2UZGA 2LXPC 5I3LA 4A4BA 5G04B 2QJ0A 2H0DA 3N9MA 1WEOA 4LJNA 2DSMA 3ZTGA 3DWDA 5G05B 5TDWA 4S3OC 2LV9A 2YU4A 2YSMA 5KH7A 4O62A 2JMJA 4GNDA 3LRQA 3E2DA 2XP0A 3O7AA 1G25A 2BAYA 3O47A 3PLWA 2QICA 4P5OB 5FB1A 3U5PA 5KH9A 2YSJA 2KWNA 1JM7B 2XB1A 3O70A 4LKAA 2VPBA 4YATA 4A0CD 2HDPA 3H7HA 2VJFA 3VK6A 2Y1NA 2OXQC 4BHWA 2AN6A 1V87A 2KIZA 5D1LB 5B76A 4YAXA 5FEYA 5TRBA 3KDEC 1JOCA 1WENA 2VPGA 4AP4A 2CRRA 1WESA 2CKLB 1WE9A 2K4DA 4F1PA 2EXUA 5SVIB 4WZ0A 5C11A 2ZETC 4FIPA 2KWKA 2KE1A 4QQ4A 2G45A 3ZVZB 4PPEA 4R2YA 3C5KA 5EYAF 2DX8A 1WGMA 2KKYA 3KV5A 2JRJA 2LGLA 3KV6A 5LKTA 4FK5A 2XOZA 5B75A 1N87A 4IC3A 1WFKA 3KNVA 3DPLR 4YBMA 5AITA 3M63A 3ZYQA 2LGGA 3FM8C 3PHDA 3DQVR 4OGCA 1HYJA 2FD4A 3T9KA 2FUUA 4I7BA 2OWAA 1VD4A 2CSYA 4N3WA 1XWHA 4B7YC 2YHNA 2KWJA 2K17A 2XOCA 5G0FA 2F6NA 5LKUA 5JG6A 4QF3A 3LJUX 2YQLA 3FANA 3SOUA 2RSDA 4GNFA 1ZBDB 4GNGA 2F42A 2ECNA 4ZQLA 2YT5A 2LN0A 3N9LA 5FERA 2LGVA 2L43A 1U6GB 2QIZA 3PUQA 2CRWA 3FJUB 2KGGA 3LVQE 3HCSA 3M7KA 2DJAA 3FAOA 4AYCA 5C13A 1E4UA 3L1ZB 3ZVYA 4H9DA 2EA6A 3U5OA 4FJCA 5KH3A 2D8SA 2L0BA 2EGMA 2KYUA 3U5NA 3Q1DA 2JUNA 1Z6UA 3ZNIA 2G6QA 2YYRA 2P57A 3O36A 3N9QA 1MM2A 1WILA 4F52B 5SVXA 2YVRA 3L1XA 2RR4A 3IHPA 2RI7A 4C9ZA 1X4JA 2LXHC 3L11A 2MKEA 4I7CA 4TKPB 1VFYA 1FP0A 3T6RA 3KQIA 2M13A 3EB6A 2KWOA 2VPEA 4V3LC 2KFTA 3LQHA 4YABA 3U5MA 2L5UA 3LQIA 4IC2A 2IDAA 4Z0OA 1FBVA 5B8DA 2PUYA 2PNXA 4LLBA 1WEEA 1WEUA 2KU3A 2G43A 4BBQA 2XOYA 4GB0A 4A49A 1LDKC 5DINA 4YBSA 2Y1MA 4MVTA 2ECTA 2MD8C 2MUMA 1MM3A 3SHBA 3JUEA 1MBMA 4PTBA 4FO9A 5AIUA 4XI1A 5SVYA 3ZPVE 4OGEA 2VPDA 4L7XA 4CA1A 2ECGA 2XEUA 5H1TA 2MD7B 1IYMA 2JMDA 2YHOA 1K2FA 3MHSA 2VNFA 2CSVA 3MDBC 3LVRE 4CCGX 4I7DA 3V43A 3GL6A 1WEQA 5LCWB 2LDRA 2VJEB 4B86C 3MHHA 4LK9A 2YQMA 2L7PA 1WIMA 4WA6A 2M6MA 2JM3A 2FFWA 4Q6FA 4Z0RA 2E6SA 3N9NA 4AUQB 2K16A 1LDJB 1RMDA 2VJFB 2LRIC 2FSAA 4L58A 3QZVA 1BORA 2M1RA 4X3GA 1Z2QA 3I2DA
chains in the Genus database with same CATH topology
4ZDTA 3GV4A 3RTRB 2ECJA 4WZ3B 5D1MB 3M62A 2M85A 2KGIA 3O34A 3N9PA 1HYIA 5DKAA 2LGKA 4QF2A 2YUCA 5H1UA 1JM7A 2H0DB 4YADA 5J3XA 2MA6A 5FB0A 4R8PK 5TDRA 3HCTA 3O35A 5TABA 2F6JA 2ECWA 2CT2A 3ZPV1 2ECVA 4S3OB 2EGPA 1T1HA 3FL2A 2ECIA 1VYXA 5B79A 3NG2A 3O33A 4GNEA 3SOXA 3HCUA 4LADB 5TBNA 3EB5A 2C2LA 3O37A 2VP7A 2YREA 4WZ2A 4A4CA 4W4UA 3RPGC 4AYCB 2FUIA 3HTKC 2CSZA 4N4FA 3N9OA 2MT5A 1F62A 1CHCA 1WEPA 2EODA 2CKLA 2L80A 4ZUXU 3SOWA 5LKZA 1X4UA 3LQJA 5H1VA 2M3HA 5D1KB 1WEWA 2YURA 2MIQA 2C2VS 5H9MA 3M99A 2YW8A 2KREA 4YBTA 4UI9B 4UP0A 2MNZA 2K1JA 1X4IA 4MSXA 5B77A 1Z60A 2I50A 5B78A 5LKXA 1WEMA 2NAAA 2LQ6A 2MNYA 2E6RA 1WEVA 2L75A 2VJEA 3ASLA 3C6WA 2MA5A 3T7LA 4UP5A 3PURA 4YC9A 2JMIA 2KR4A 2HYED 4V3KC 4R7EA 4AVXA 2Y43A 3RPGB 4O64A 4NN2A 1DVPA 2UZGA 2LXPC 5I3LA 4A4BA 5G04B 2QJ0A 2H0DA 3N9MA 1WEOA 4LJNA 3ZTGA 5G05B 5TDWA 4S3OC 2LV9A 2YU4A 2YSMA 5KH7A 2JMJA 4GNDA 3LRQA 3O7AA 1G25A 2BAYA 2QICA 4P5OB 5FB1A 3U5PA 5KH9A 2YSJA 2KWNA 1JM7B 2XB1A 3O70A 4LKAA 2VPBA 4YATA 4A0CD 2HDPA 3VK6A 2VJFA 4BHWA 2Y1NA 2OXQC 2AN6A 1V87A 2KIZA 5D1LB 5B76A 4YAXA 5FEYA 5TRBA 1JOCA 1WENA 2VPGA 4AP4A 1WESA 2CKLB 1WE9A 2K4DA 4WZ0A 5C11A 2ZETC 4FIPA 2KWKA 2KE1A 2G45A 3ZVZB 4PPEA 4R2YA 3C5KA 5EYAF 2DX8A 1WGMA 3KV5A 2JRJA 2LGLA 3KV6A 5LKTA 4FK5A 5B75A 1N87A 4IC3A 1WFKA 3KNVA 3DPLR 4YBMA 5AITA 3M63A 3ZYQA 2LGGA 3PHDA 3DQVR 1HYJA 2FUUA 4I7BA 1VD4A 2CSYA 4N3WA 1XWHA 4B7YC 2YHNA 2KWJA 2K17A 5G0FA 2F6NA 5LKUA 5JG6A 4QF3A 2YQLA 3SOUA 2RSDA 4GNFA 1ZBDB 4GNGA 2F42A 2ECNA 4ZQLA 2YT5A 2LN0A 3N9LA 5FERA 2LGVA 2L43A 1U6GB 2QIZA 3PUQA 2KGGA 3HCSA 4AYCA 5C13A 1E4UA 3L1ZB 3ZVYA 2EA6A 3U5OA 4FJCA 5KH3A 2D8SA 2L0BA 2KYUA 3U5NA 1Z6UA 3ZNIA 2G6QA 2YYRA 3O36A 3N9QA 1MM2A 1WILA 4F52B 3L1XA 3IHPA 2RI7A 4C9ZA 1X4JA 2LXHC 3L11A 4I7CA 4TKPB 1VFYA 1FP0A 3T6RA 3KQIA 3EB6A 2KWOA 2VPEA 4V3LC 2KFTA 3LQHA 4YABA 3U5MA 2L5UA 3LQIA 4IC2A 2IDAA 1FBVA 5B8DA 2PUYA 2PNXA 4LLBA 1WEEA 1WEUA 2KU3A 2G43A 4BBQA 4GB0A 4A49A 1LDKC 5DINA 4YBSA 2Y1MA 4MVTA 2ECTA 2MD8C 2MUMA 1MM3A 3SHBA 4PTBA 5AIUA 4FO9A 4XI1A 3ZPVE 2VPDA 4L7XA 4CA1A 2ECGA 2XEUA 5H1TA 2MD7B 1IYMA 2JMDA 2YHOA 1K2FA 3MHSA 2VNFA 4CCGX 4I7DA 3V43A 3GL6A 1WEQA 5LCWB 2LDRA 2VJEB 4B86C 3MHHA 4LK9A 2YQMA 1WIMA 4WA6A 2M6MA 4Q6FA 2E6SA 3N9NA 4AUQB 2K16A 1LDJB 1RMDA 2VJFB 2LRIC 2FSAA 4L58A 3QZVA 1BORA 2M1RA 4X3GA 1Z2QA 3I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDT A;  3GV4 A;  3RTR B;  2ECJ A;  4WZ3 B;  5D1M B;  3M62 A;  2M85 A;  2KGI A;  3O34 A;  3N9P A;  1HYI A;  5DKA A;  2LGK A;  4QF2 A;  2YUC A;  5H1U A;  1JM7 A;  2H0D B;  4YAD A;  5J3X A;  2MA6 A;  5FB0 A;  4R8P K;  5TDR A;  3HCT A;  3O35 A;  5TAB A;  2F6J A;  2ECW A;  2CT2 A;  3ZPV 1;  2ECV A;  4S3O B;  2EGP A;  1T1H A;  3FL2 A;  2ECI A;  1VYX A;  5B79 A;  3NG2 A;  3O33 A;  4GNE A;  3SOX A;  3HCU A;  4LAD B;  5TBN A;  3EB5 A;  2C2L A;  3O37 A;  2VP7 A;  2YRE A;  4WZ2 A;  4A4C A;  4W4U A;  3RPG C;  4AYC B;  2FUI A;  3HTK C;  2CSZ A;  4N4F A;  3N9O A;  2MT5 A;  1F62 A;  1CHC A;  1WEP A;  2EOD A;  2CKL A;  2L80 A;  4ZUX U;  3SOW A;  5LKZ A;  1X4U A;  3LQJ A;  5H1V A;  2M3H A;  5D1K B;  1WEW A;  2YUR A;  2MIQ A;  2C2V S;  5H9M A;  3M99 A;  2YW8 A;  2KRE A;  4YBT A;  4UI9 B;  4UP0 A;  2MNZ A;  2K1J A;  1X4I A;  4MSX A;  5B77 A;  1Z60 A;  2I50 A;  5B78 A;  5LKX A;  1WEM A;  2NAA A;  2LQ6 A;  2MNY A;  2E6R A;  1WEV A;  2L75 A;  2VJE A;  3ASL A;  3C6W A;  2MA5 A;  3T7L A;  4UP5 A;  3PUR A;  4YC9 A;  2JMI A;  2KR4 A;  2HYE D;  4V3K C;  4R7E A;  4AVX A;  2Y43 A;  3RPG B;  4O64 A;  4NN2 A;  1DVP A;  2UZG A;  2LXP C;  5I3L A;  4A4B A;  5G04 B;  2QJ0 A;  2H0D A;  3N9M A;  1WEO A;  4LJN A;  3ZTG A;  5G05 B;  5TDW A;  4S3O C;  2LV9 A;  2YU4 A;  2YSM A;  5KH7 A;  2JMJ A;  4GND A;  3LRQ A;  3O7A A;  1G25 A;  2BAY A;  2QIC A;  4P5O B;  5FB1 A;  3U5P A;  5KH9 A;  2YSJ A;  2KWN A;  1JM7 B;  2XB1 A;  3O70 A;  4LKA A;  2VPB A;  4YAT A;  4A0C D;  2HDP A;  3VK6 A;  2VJF A;  4BHW A;  2Y1N A;  2OXQ C;  2AN6 A;  1V87 A;  2KIZ A;  5D1L B;  5B76 A;  4YAX A;  5FEY A;  5TRB A;  1JOC A;  1WEN A;  2VPG A;  4AP4 A;  1WES A;  2CKL B;  1WE9 A;  2K4D A;  4WZ0 A;  5C11 A;  2ZET C;  4FIP A;  2KWK A;  2KE1 A;  2G45 A;  3ZVZ B;  4PPE A;  4R2Y A;  3C5K A;  5EYA F;  2DX8 A;  1WGM A;  3KV5 A;  2JRJ A;  2LGL A;  3KV6 A;  5LKT A;  4FK5 A;  5B75 A;  1N87 A;  4IC3 A;  1WFK A;  3KNV A;  3DPL R;  4YBM A;  5AIT A;  3M63 A;  3ZYQ A;  2LGG A;  3PHD A;  3DQV R;  1HYJ A;  2FUU A;  4I7B A;  1VD4 A;  2CSY A;  4N3W A;  1XWH A;  4B7Y C;  2YHN A;  2KWJ A;  2K17 A;  5G0F A;  2F6N A;  5LKU A;  5JG6 A;  4QF3 A;  2YQL A;  3SOU A;  2RSD A;  4GNF A;  1ZBD B;  4GNG A;  2F42 A;  2ECN A;  4ZQL A;  2YT5 A;  2LN0 A;  3N9L A;  5FER A;  2LGV A;  2L43 A;  1U6G B;  2QIZ A;  3PUQ A;  2KGG A;  3HCS A;  4AYC A;  5C13 A;  1E4U A;  3L1Z B;  3ZVY A;  2EA6 A;  3U5O A;  4FJC A;  5KH3 A;  2D8S A;  2L0B A;  2KYU A;  3U5N A;  1Z6U A;  3ZNI A;  2G6Q A;  2YYR A;  3O36 A;  3N9Q A;  1MM2 A;  1WIL A;  4F52 B;  3L1X A;  3IHP A;  2RI7 A;  4C9Z A;  1X4J A;  2LXH C;  3L11 A;  4I7C A;  4TKP B;  1VFY A;  1FP0 A;  3T6R A;  3KQI A;  3EB6 A;  2KWO A;  2VPE A;  4V3L C;  2KFT A;  3LQH A;  4YAB A;  3U5M A;  2L5U A;  3LQI A;  4IC2 A;  2IDA A;  1FBV A;  5B8D A;  2PUY A;  2PNX A;  4LLB A;  1WEE A;  1WEU A;  2KU3 A;  2G43 A;  4BBQ A;  4GB0 A;  4A49 A;  1LDK C;  5DIN A;  4YBS A;  2Y1M A;  4MVT A;  2ECT A;  2MD8 C;  2MUM A;  1MM3 A;  3SHB A;  4PTB A;  5AIU A;  4FO9 A;  4XI1 A;  3ZPV E;  2VPD A;  4L7X A;  4CA1 A;  2ECG A;  2XEU A;  5H1T A;  2MD7 B;  1IYM A;  2JMD A;  2YHO A;  1K2F A;  3MHS A;  2VNF A;  4CCG X;  4I7D A;  3V43 A;  3GL6 A;  1WEQ A;  5LCW B;  2LDR A;  2VJE B;  4B86 C;  3MHH A;  4LK9 A;  2YQM A;  1WIM A;  4WA6 A;  2M6M A;  4Q6F A;  2E6S A;  3N9N A;  4AUQ B;  2K16 A;  1LDJ B;  1RMD A;  2VJF B;  2LRI C;  2FSA A;  4L58 A;  3QZV A;  1BOR A;  2M1R A;  4X3G A;  1Z2Q A;  3I2D A; 
#chains in the Genus database with same CATH topology
 4ZDT A;  3GV4 A;  3RTR B;  2ECJ A;  4WZ3 B;  5D1M B;  3FEH A;  3M62 A;  2M85 A;  2KGI A;  3O34 A;  3N9P A;  1HYI A;  5DKA A;  2LGK A;  4QF2 A;  2YUC A;  5H1U A;  1JM7 A;  2H0D B;  4YAD A;  5J3X A;  2MA6 A;  5FB0 A;  4R8P K;  3SUB A;  5K3Q A;  5TDR A;  3HCT A;  3O35 A;  5TAB A;  2F6J A;  2ECW A;  2E61 A;  2CT2 A;  3ZPV 1;  2ECV A;  4S3O B;  2EGP A;  1T1H A;  3FL2 A;  2ECI A;  2KKX A;  1VYX A;  5B79 A;  3NG2 A;  3O33 A;  4GNE A;  3SOX A;  3HCU A;  4LAD B;  5SVI A;  5TBN A;  3EB5 A;  2C2L A;  3O37 A;  2VP7 A;  2YRE A;  4WZ2 A;  2LAU A;  4A4C A;  4W4U A;  3RPG C;  4AYC B;  2FUI A;  3HTK C;  3DDT A;  2CSZ A;  4N4F A;  3N9O A;  2MT5 A;  1F62 A;  1CHC A;  1WEP A;  2EOD A;  2CKL A;  2L80 A;  4ZUX U;  3SOW A;  5LKZ A;  1X4U A;  3LQJ A;  5H1V A;  2M3H A;  5D1K B;  2D8U A;  1WEW A;  2YUR A;  2B0O E;  2MIQ A;  2C2V S;  5H9M A;  3M99 A;  2YW8 A;  2KRE A;  4YBT A;  4UI9 B;  4UP0 A;  2MNZ A;  2K1J A;  1X4I A;  4MSX A;  5B77 A;  1Z60 A;  2I50 A;  5B78 A;  5LKX A;  1WEM A;  2NAA A;  2LQ6 A;  2MNY A;  2E6R A;  1WEV A;  2L75 A;  2VJE A;  3ASL A;  3C6W A;  2MA5 A;  3T7L A;  4UP5 A;  3PUR A;  2IQJ A;  4YC9 A;  2JMI A;  2KR4 A;  2HYE D;  4V3K C;  4R7E A;  4AVX A;  1DCQ A;  2CON A;  2Y43 A;  3RPG B;  4O64 A;  3LDY A;  4NN2 A;  1DVP A;  2UZG A;  2LXP C;  5I3L A;  4A4B A;  5G04 B;  2QJ0 A;  2H0D A;  3N9M A;  1WEO A;  4LJN A;  2DSM A;  3ZTG A;  3DWD A;  5G05 B;  5TDW A;  4S3O C;  2LV9 A;  2YU4 A;  2YSM A;  5KH7 A;  4O62 A;  2JMJ A;  4GND A;  3LRQ A;  3E2D A;  2XP0 A;  3O7A A;  1G25 A;  2BAY A;  3O47 A;  3PLW A;  2QIC A;  4P5O B;  5FB1 A;  3U5P A;  5KH9 A;  2YSJ A;  2KWN A;  1JM7 B;  2XB1 A;  3O70 A;  4LKA A;  2VPB A;  4YAT A;  4A0C D;  2HDP A;  3H7H A;  2VJF A;  3VK6 A;  2Y1N A;  2OXQ C;  4BHW A;  2AN6 A;  1V87 A;  2KIZ A;  5D1L B;  5B76 A;  4YAX A;  5FEY A;  5TRB A;  3KDE C;  1JOC A;  1WEN A;  2VPG A;  4AP4 A;  2CRR A;  1WES A;  2CKL B;  1WE9 A;  2K4D A;  4F1P A;  2EXU A;  5SVI B;  4WZ0 A;  5C11 A;  2ZET C;  4FIP A;  2KWK A;  2KE1 A;  4QQ4 A;  2G45 A;  3ZVZ B;  4PPE A;  4R2Y A;  3C5K A;  5EYA F;  2DX8 A;  1WGM A;  2KKY A;  3KV5 A;  2JRJ A;  2LGL A;  3KV6 A;  5LKT A;  4FK5 A;  2XOZ A;  5B75 A;  1N87 A;  4IC3 A;  1WFK A;  3KNV A;  3DPL R;  4YBM A;  5AIT A;  3M63 A;  3ZYQ A;  2LGG A;  3FM8 C;  3PHD A;  3DQV R;  4OGC A;  1HYJ A;  2FD4 A;  3T9K A;  2FUU A;  4I7B A;  2OWA A;  1VD4 A;  2CSY A;  4N3W A;  1XWH A;  4B7Y C;  2YHN A;  2KWJ A;  2K17 A;  2XOC A;  5G0F A;  2F6N A;  5LKU A;  5JG6 A;  4QF3 A;  3LJU X;  2YQL A;  3FAN A;  3SOU A;  2RSD A;  4GNF A;  1ZBD B;  4GNG A;  2F42 A;  2ECN A;  4ZQL A;  2YT5 A;  2LN0 A;  3N9L A;  5FER A;  2LGV A;  2L43 A;  1U6G B;  2QIZ A;  3PUQ A;  2CRW A;  3FJU B;  2KGG A;  3LVQ E;  3HCS A;  3M7K A;  2DJA A;  3FAO A;  4AYC A;  5C13 A;  1E4U A;  3L1Z B;  3ZVY A;  4H9D A;  2EA6 A;  3U5O A;  4FJC A;  5KH3 A;  2D8S A;  2L0B A;  2EGM A;  2KYU A;  3U5N A;  3Q1D A;  2JUN A;  1Z6U A;  3ZNI A;  2G6Q A;  2YYR A;  2P57 A;  3O36 A;  3N9Q A;  1MM2 A;  1WIL A;  4F52 B;  5SVX A;  2YVR A;  3L1X A;  2RR4 A;  3IHP A;  2RI7 A;  4C9Z A;  1X4J A;  2LXH C;  3L11 A;  2MKE A;  4I7C A;  4TKP B;  1VFY A;  1FP0 A;  3T6R A;  3KQI A;  2M13 A;  3EB6 A;  2KWO A;  2VPE A;  4V3L C;  2KFT A;  3LQH A;  4YAB A;  3U5M A;  2L5U A;  3LQI A;  4IC2 A;  2IDA A;  4Z0O A;  1FBV A;  5B8D A;  2PUY A;  2PNX A;  4LLB A;  1WEE A;  1WEU A;  2KU3 A;  2G43 A;  4BBQ A;  2XOY A;  4GB0 A;  4A49 A;  1LDK C;  5DIN A;  4YBS A;  2Y1M A;  4MVT A;  2ECT A;  2MD8 C;  2MUM A;  1MM3 A;  3SHB A;  3JUE A;  1MBM A;  4PTB A;  4FO9 A;  5AIU A;  4XI1 A;  5SVY A;  3ZPV E;  4OGE A;  2VPD A;  4L7X A;  4CA1 A;  2ECG A;  2XEU A;  5H1T A;  2MD7 B;  1IYM A;  2JMD A;  2YHO A;  1K2F A;  3MHS A;  2VNF A;  2CSV A;  3MDB C;  3LVR E;  4CCG X;  4I7D A;  3V43 A;  3GL6 A;  1WEQ A;  5LCW B;  2LDR A;  2VJE B;  4B86 C;  3MHH A;  4LK9 A;  2YQM A;  2L7P A;  1WIM A;  4WA6 A;  2M6M A;  2JM3 A;  2FFW A;  4Q6F A;  4Z0R A;  2E6S A;  3N9N A;  4AUQ B;  2K16 A;  1LDJ B;  1RMD A;  2VJF B;  2LRI C;  2FSA A;  4L58 A;  3QZV A;  1BOR A;  2M1R A;  4X3G A;  1Z2Q A;  3I2D A; 
#chains in the Genus database with same CATH homology
 4ZDT A;  3GV4 A;  3RTR B;  2ECJ A;  4WZ3 B;  5D1M B;  3M62 A;  2M85 A;  2KGI A;  3O34 A;  3N9P A;  1HYI A;  5DKA A;  2LGK A;  4QF2 A;  2YUC A;  5H1U A;  1JM7 A;  2H0D B;  4YAD A;  5J3X A;  2MA6 A;  5FB0 A;  4R8P K;  5TDR A;  3HCT A;  3O35 A;  5TAB A;  2F6J A;  2ECW A;  2CT2 A;  3ZPV 1;  2ECV A;  4S3O B;  2EGP A;  1T1H A;  3FL2 A;  2ECI A;  1VYX A;  5B79 A;  3NG2 A;  3O33 A;  4GNE A;  3SOX A;  3HCU A;  4LAD B;  5TBN A;  3EB5 A;  2C2L A;  3O37 A;  2VP7 A;  2YRE A;  4WZ2 A;  4A4C A;  4W4U A;  3RPG C;  4AYC B;  2FUI A;  3HTK C;  2CSZ A;  4N4F A;  3N9O A;  2MT5 A;  1F62 A;  1CHC A;  1WEP A;  2EOD A;  2CKL A;  2L80 A;  4ZUX U;  3SOW A;  5LKZ A;  1X4U A;  3LQJ A;  5H1V A;  2M3H A;  5D1K B;  1WEW A;  2YUR A;  2MIQ A;  2C2V S;  5H9M A;  3M99 A;  2YW8 A;  2KRE A;  4YBT A;  4UI9 B;  4UP0 A;  2MNZ A;  2K1J A;  1X4I A;  4MSX A;  5B77 A;  1Z60 A;  2I50 A;  5B78 A;  5LKX A;  1WEM A;  2NAA A;  2LQ6 A;  2MNY A;  2E6R A;  1WEV A;  2L75 A;  2VJE A;  3ASL A;  3C6W A;  2MA5 A;  3T7L A;  4UP5 A;  3PUR A;  4YC9 A;  2JMI A;  2KR4 A;  2HYE D;  4V3K C;  4R7E A;  4AVX A;  2Y43 A;  3RPG B;  4O64 A;  4NN2 A;  1DVP A;  2UZG A;  2LXP C;  5I3L A;  4A4B A;  5G04 B;  2QJ0 A;  2H0D A;  3N9M A;  1WEO A;  4LJN A;  3ZTG A;  5G05 B;  5TDW A;  4S3O C;  2LV9 A;  2YU4 A;  2YSM A;  5KH7 A;  2JMJ A;  4GND A;  3LRQ A;  3O7A A;  1G25 A;  2BAY A;  2QIC A;  4P5O B;  5FB1 A;  3U5P A;  5KH9 A;  2YSJ A;  2KWN A;  1JM7 B;  2XB1 A;  3O70 A;  4LKA A;  2VPB A;  4YAT A;  4A0C D;  2HDP A;  3VK6 A;  2VJF A;  4BHW A;  2Y1N A;  2OXQ C;  2AN6 A;  1V87 A;  2KIZ A;  5D1L B;  5B76 A;  4YAX A;  5FEY A;  5TRB A;  1JOC A;  1WEN A;  2VPG A;  4AP4 A;  1WES A;  2CKL B;  1WE9 A;  2K4D A;  4WZ0 A;  5C11 A;  2ZET C;  4FIP A;  2KWK A;  2KE1 A;  2G45 A;  3ZVZ B;  4PPE A;  4R2Y A;  3C5K A;  5EYA F;  2DX8 A;  1WGM A;  3KV5 A;  2JRJ A;  2LGL A;  3KV6 A;  5LKT A;  4FK5 A;  5B75 A;  1N87 A;  4IC3 A;  1WFK A;  3KNV A;  3DPL R;  4YBM A;  5AIT A;  3M63 A;  3ZYQ A;  2LGG A;  3PHD A;  3DQV R;  1HYJ A;  2FUU A;  4I7B A;  1VD4 A;  2CSY A;  4N3W A;  1XWH A;  4B7Y C;  2YHN A;  2KWJ A;  2K17 A;  5G0F A;  2F6N A;  5LKU A;  5JG6 A;  4QF3 A;  2YQL A;  3SOU A;  2RSD A;  4GNF A;  1ZBD B;  4GNG A;  2F42 A;  2ECN A;  4ZQL A;  2YT5 A;  2LN0 A;  3N9L A;  5FER A;  2LGV A;  2L43 A;  1U6G B;  2QIZ A;  3PUQ A;  2KGG A;  3HCS A;  4AYC A;  5C13 A;  1E4U A;  3L1Z B;  3ZVY A;  2EA6 A;  3U5O A;  4FJC A;  5KH3 A;  2D8S A;  2L0B A;  2KYU A;  3U5N A;  1Z6U A;  3ZNI A;  2G6Q A;  2YYR A;  3O36 A;  3N9Q A;  1MM2 A;  1WIL A;  4F52 B;  3L1X A;  3IHP A;  2RI7 A;  4C9Z A;  1X4J A;  2LXH C;  3L11 A;  4I7C A;  4TKP B;  1VFY A;  1FP0 A;  3T6R A;  3KQI A;  3EB6 A;  2KWO A;  2VPE A;  4V3L C;  2KFT A;  3LQH A;  4YAB A;  3U5M A;  2L5U A;  3LQI A;  4IC2 A;  2IDA A;  1FBV A;  5B8D A;  2PUY A;  2PNX A;  4LLB A;  1WEE A;  1WEU A;  2KU3 A;  2G43 A;  4BBQ A;  4GB0 A;  4A49 A;  1LDK C;  5DIN A;  4YBS A;  2Y1M A;  4MVT A;  2ECT A;  2MD8 C;  2MUM A;  1MM3 A;  3SHB A;  4PTB A;  5AIU A;  4FO9 A;  4XI1 A;  3ZPV E;  2VPD A;  4L7X A;  4CA1 A;  2ECG A;  2XEU A;  5H1T A;  2MD7 B;  1IYM A;  2JMD A;  2YHO A;  1K2F A;  3MHS A;  2VNF A;  4CCG X;  4I7D A;  3V43 A;  3GL6 A;  1WEQ A;  5LCW B;  2LDR A;  2VJE B;  4B86 C;  3MHH A;  4LK9 A;  2YQM A;  1WIM A;  4WA6 A;  2M6M A;  4Q6F A;  2E6S A;  3N9N A;  4AUQ B;  2K16 A;  1LDJ B;  1RMD A;  2VJF B;  2LRI C;  2FSA A;  4L58 A;  3QZV A;  1BOR A;  2M1R A;  4X3G A;  1Z2Q A;  3I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...