2LV9A

Solution nmr structure of the phd domain of human mll5, northeast structural genomics consortium target hr6512a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
b'SEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase MLL5
molecule tags Transferase
source organism Homo sapiens
publication title NMR solution structure of the human MLL5 PHD domain (CASP Target)
rcsb
total genus 17
structure length 80
sequence length 80
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lv9A00
1XWHA 2RSDA 2ECJA 4BBQA 3EB6A 2LGKA 2CKLB 2MNZA 2M6MA 5H9MA 1MM3A 4WZ2A 1WEWA 4QF2A 2RI7A 4YAXA 5H1UA 2YHOA 1VYXA 2KWOA 2VJEB 2XEUA 3O7AA 2Y43A 2YSMA 4GNEA 2C2LA 3U5PA 4AVXA 1WEOA 2ECVA 1JM7A 2KGGA 2KREA 1HYIA 2H0DB 4LK9A 2XB1A 4L7XA 1FBVA 4I7BA 3LQJA 3MHSA 3N9MA 4GNDA 2VPEA 2ZETC 3PUQA 3L11A 3MHHA 3L1XA 1RMDA 1WEVA 2FSAA 4LJNA 4UP5A 1Z2QA 4Q6FA 1T1HA 2VJFA 4O64A 3PURA 5H1TA 3LQIA 1FP0A 2YQMA 3SOWA 2YSJA 1U6GB 3T7LA 3LQHA 1CHCA 5LKTA 4R8PK 3ZNIA 5D1KB 4R2YA 4C9ZA 2EODA 5D1MB 4A4CA 4LKAA 3FL2A 2KR4A 4XI1A 3N9OA 2Y1MA 5AIUA 2YUCA 1VFYA 5G04B 3RTRB 4FIPA 3HCTA 2H0DA 3RPGC 3IHPA 1HYJA 5C13A 2YW8A 3V43A 5TBNA 2KFTA 2MD8C 3T6RA 4N3WA 2JMJA 3DPLR 2YU4A 3PHDA 2HYED 4GNFA 5H1VA 2CT2A 2M85A 4FO9A 3EB5A 3O70A 2KU3A 1WE9A 3KV5A 3N9NA 3M99A 5KH3A 2QJ0A 5G05B 4YBMA 2EA6A 2L0BA 1DVPA 3ZYQA 2E6SA 3ZTGA 3GV4A 4F52B 2KWNA 2PUYA 2LDRA 2G45A 1WENA 5KH7A 2NAAA 5B77A 2LXPC 1WGMA 4AYCB 1E4UA 4P5OB 2VJFB 3RPGB 2LGLA 2BAYA 2K16A 5LKXA 2JRJA 3N9PA 3QZVA 1VD4A 1WEEA 4PPEA 5FB1A 2YHNA 2YQLA 4LADB 2YYRA 2AN6A 2LV9A 4MVTA 4WZ0A 1G25A 4ZQLA 4R7EA 2FUUA 1WEPA 3N9LA 5EYAF 4BHWA 2OXQC 3KNVA 1ZBDB 2YREA 2CKLA 3O36A 4L58A 1Z6UA 5DINA 5TABA 3SOXA 4W4UA 2KYUA 2QIZA 2L75A 5B76A 3ASLA 5LKZA 1X4IA 4MSXA 5B8DA 2MT5A 1MM2A 3ZVYA 2YT5A 4B7YC 4IC2A 4I7DA 3DQVR 1V87A 4YABA 4V3LC 2VNFA 3ZPVE 2KWJA 2CSYA 4YBTA 3SHBA 3O34A 2QICA 4FJCA 4ZUXU 5DKAA 2ECIA 3ZVZB 2LGVA 2JMDA 3I2DA 4UI9B 2ECWA 1WESA 5G0FA 4ZDTA 1JOCA 2F6JA 2UZGA 3HCSA 2LGGA 2M1RA 4CA1A 3C5KA 2KWKA 3ZPV1 3M63A 2ECTA 4UP0A 4FK5A 1X4UA 2CSZA 4WZ3B 2MIQA 2K1JA 4GB0A 1IYMA 1LDKC 3VK6A 3KV6A 5FB0A 2MUMA 4NN2A 1WFKA 3L1ZB 5TDWA 2ECNA 4I7CA 4AP4A 5FEYA 3SOUA 2VP7A 2ECGA 2LN0A 4PTBA 3U5MA 4WA6A 5TDRA 2LXHC 2KGIA 3M62A 2VPGA 4YC9A 4YBSA 3GL6A 1N87A 4N4FA 4B86C 2MNYA 1F62A 2LRIC 4IC3A 4S3OC 2VPDA 3N9QA 3LRQA 3NG2A 2KE1A 2KIZA 3O37A 2Y1NA 2M3HA 4A49A 2DX8A 4CCGX 4QF3A 1WIMA 2VPBA 4LLBA 4X3GA 2MA5A 4V3KC 2EGPA 2G43A 2F6NA 1K2FA 2PNXA 4YATA 5AITA 4GNGA 5LCWB 4YADA 2D8SA 5KH9A 2K4DA 2YURA 5JG6A 2L80A 5I3LA 5LKUA 2G6QA 5FERA 3C6WA 1BORA 2LQ6A 4A4BA 3HCUA 1JM7B 2K17A 4AUQB 3KQIA 2L5UA 2JMIA 5C11A 5B79A 5B78A 5D1LB 5J3XA 1Z60A 2F42A 3O33A 1WEUA 2I50A 2VJEA 3U5NA 1WILA 2IDAA 2HDPA 2L43A 5B75A 2FUIA 1X4JA 2C2VS 4TKPB 5TRBA 3HTKC 1LDJB 2E6RA 4S3OB 1WEMA 1WEQA 2MA6A 3O35A 4AYCA 3U5OA 4A0CD 2MD7B
chains in the Genus database with same CATH superfamily
1XWHA 2RSDA 2ECJA 4BBQA 3EB6A 2LGKA 2CKLB 2MNZA 3KDEC 2EXUA 2M6MA 3LJUX 4OGEA 5H9MA 3FEHA 1MM3A 4WZ2A 1WEWA 4QF2A 2FD4A 3LDYA 3PLWA 2RI7A 4YAXA 5H1UA 2YHOA 1VYXA 5SVXA 2KWOA 2VJEB 2XEUA 3O7AA 2Y43A 2YSMA 2KKYA 4GNEA 2C2LA 4OGCA 3U5PA 4AVXA 2DJAA 1WEOA 2ECVA 1JM7A 2KGGA 1DCQA 2KREA 1HYIA 4LK9A 2H0DB 2XB1A 4L7XA 1FBVA 4I7BA 3M7KA 3LQJA 3MHSA 3N9MA 4GNDA 2VPEA 2ZETC 3PUQA 3SUBA 3L11A 3MHHA 3L1XA 1RMDA 1WEVA 2FSAA 4LJNA 4UP5A 1Z2QA 2L7PA 4Q6FA 1T1HA 2VJFA 4O64A 3PURA 5H1TA 3O47A 2RR4A 3LQIA 1FP0A 2YQMA 2M13A 3SOWA 2XOYA 2YSJA 1U6GB 5SVIB 2IQJA 1CHCA 3LQHA 3T7LA 5LKTA 4R8PK 3ZNIA 5D1KB 4R2YA 4C9ZA 2EODA 5D1MB 4A4CA 4LKAA 3FL2A 2KR4A 4XI1A 2P57A 3N9OA 2JUNA 2Y1MA 5AIUA 2YUCA 1VFYA 5G04B 3FM8C 3RTRB 4FIPA 3HCTA 2XP0A 2H0DA 3RPGC 2XOCA 3IHPA 1HYJA 5C13A 2YW8A 3V43A 5TBNA 2KFTA 2MD8C 3T6RA 4N3WA 2JMJA 3DPLR 2YU4A 3PHDA 2HYED 4GNFA 5H1VA 2CT2A 2YVRA 4F1PA 3T9KA 2M85A 4FO9A 3EB5A 3MDBC 3O70A 2KU3A 1WE9A 3KV5A 2LAUA 3N9NA 3M99A 5KH3A 2QJ0A 5G05B 4YBMA 4Z0RA 2EA6A 2L0BA 1DVPA 3LVQE 3ZYQA 2E6SA 3ZTGA 3DDTA 3GV4A 5K3QA 4F52B 2KWNA 2PUYA 2LDRA 2G45A 1WENA 5KH7A 2NAAA 5B77A 2LXPC 3DWDA 1WGMA 4AYCB 1E4UA 4P5OB 2VJFB 3RPGB 2LGLA 2BAYA 2K16A 5LKXA 2JRJA 3N9PA 3QZVA 1VD4A 1WEEA 4PPEA 5FB1A 2YHNA 2YQLA 4LADB 2YYRA 2AN6A 2LV9A 4MVTA 4WZ0A 1G25A 4ZQLA 4R7EA 2FUUA 1WEPA 3N9LA 5EYAF 4BHWA 2OXQC 3KNVA 1ZBDB 2YREA 2CKLA 3O36A 4L58A 1Z6UA 5DINA 5TABA 3SOXA 2EGMA 4W4UA 2XOZA 2KYUA 2QIZA 2L75A 5B76A 3ASLA 5LKZA 1X4IA 4MSXA 5B8DA 2B0OE 2MT5A 1MM2A 3ZVYA 2YT5A 4B7YC 4IC2A 4I7DA 3DQVR 2E61A 1V87A 4YABA 4V3LC 2VNFA 3ZPVE 2KWJA 2CSYA 4YBTA 3SHBA 3E2DA 3O34A 2QICA 4FJCA 5SVYA 4ZUXU 5DKAA 2CSVA 2ECIA 3ZVZB 3FJUB 4QQ4A 2LGVA 5SVIA 2JMDA 3I2DA 1MBMA 3JUEA 4UI9B 2ECWA 1WESA 5G0FA 4ZDTA 1JOCA 2F6JA 2UZGA 3HCSA 2LGGA 2M1RA 4CA1A 3C5KA 2KWKA 3ZPV1 2CRRA 3M63A 2ECTA 4UP0A 4FK5A 1X4UA 2CSZA 2MKEA 2CONA 4WZ3B 2MIQA 4O62A 2K1JA 4GB0A 1IYMA 1LDKC 3FAOA 3VK6A 3KV6A 5FB0A 2MUMA 4NN2A 1WFKA 3L1ZB 5TDWA 2ECNA 4I7CA 4AP4A 5FEYA 3SOUA 2VP7A 2ECGA 2LN0A 4PTBA 3U5MA 2FFWA 3LVRE 4WA6A 5TDRA 2KKXA 2LXHC 2KGIA 3M62A 3FANA 2VPGA 4YC9A 4YBSA 3GL6A 1N87A 4N4FA 4B86C 2MNYA 1F62A 2LRIC 4IC3A 4S3OC 2VPDA 3N9QA 3LRQA 3NG2A 2KE1A 2KIZA 3O37A 2OWAA 2Y1NA 2M3HA 4A49A 2DX8A 4CCGX 4QF3A 1WIMA 2VPBA 4LLBA 4X3GA 2MA5A 4V3KC 2EGPA 2G43A 2F6NA 1K2FA 2PNXA 4YATA 3H7HA 5AITA 4GNGA 5LCWB 4YADA 2D8SA 2DSMA 5KH9A 2K4DA 2YURA 2CRWA 5JG6A 2L80A 5I3LA 5LKUA 2G6QA 5FERA 3C6WA 1BORA 3Q1DA 2LQ6A 4A4BA 3HCUA 1JM7B 2K17A 4AUQB 3KQIA 2L5UA 2JMIA 5C11A 5B79A 5B78A 5D1LB 5J3XA 1Z60A 2F42A 3O33A 1WEUA 2I50A 2VJEA 3U5NA 1WILA 2IDAA 2HDPA 2L43A 5B75A 2FUIA 1X4JA 2C2VS 4TKPB 5TRBA 3HTKC 4H9DA 1LDJB 2E6RA 4S3OB 1WEMA 1WEQA 2MA6A 3O35A 4Z0OA 4AYCA 2D8UA 3U5OA 2JM3A 4A0CD 2MD7B
chains in the Genus database with same CATH topology
1XWHA 2RSDA 2ECJA 4BBQA 3EB6A 2LGKA 2CKLB 2MNZA 2M6MA 5H9MA 1MM3A 4WZ2A 1WEWA 4QF2A 2RI7A 4YAXA 5H1UA 2YHOA 1VYXA 2KWOA 2VJEB 2XEUA 3O7AA 2Y43A 2YSMA 4GNEA 2C2LA 3U5PA 4AVXA 1WEOA 2ECVA 1JM7A 2KGGA 2KREA 1HYIA 2H0DB 4LK9A 2XB1A 4L7XA 1FBVA 4I7BA 3LQJA 3MHSA 3N9MA 4GNDA 2VPEA 2ZETC 3PUQA 3L11A 3MHHA 3L1XA 1RMDA 1WEVA 2FSAA 4LJNA 4UP5A 1Z2QA 4Q6FA 1T1HA 2VJFA 4O64A 3PURA 5H1TA 3LQIA 1FP0A 2YQMA 3SOWA 2YSJA 1U6GB 3T7LA 3LQHA 1CHCA 5LKTA 4R8PK 3ZNIA 5D1KB 4R2YA 4C9ZA 2EODA 5D1MB 4A4CA 4LKAA 3FL2A 2KR4A 4XI1A 3N9OA 2Y1MA 5AIUA 2YUCA 1VFYA 5G04B 3RTRB 4FIPA 3HCTA 2H0DA 3RPGC 3IHPA 1HYJA 5C13A 2YW8A 3V43A 5TBNA 2KFTA 2MD8C 3T6RA 4N3WA 2JMJA 3DPLR 2YU4A 3PHDA 2HYED 4GNFA 5H1VA 2CT2A 2M85A 4FO9A 3EB5A 3O70A 2KU3A 1WE9A 3KV5A 3N9NA 3M99A 5KH3A 2QJ0A 5G05B 4YBMA 2EA6A 2L0BA 1DVPA 3ZYQA 2E6SA 3ZTGA 3GV4A 4F52B 2KWNA 2PUYA 2LDRA 2G45A 1WENA 5KH7A 2NAAA 5B77A 2LXPC 1WGMA 4AYCB 1E4UA 4P5OB 2VJFB 3RPGB 2LGLA 2BAYA 2K16A 5LKXA 2JRJA 3N9PA 3QZVA 1VD4A 1WEEA 4PPEA 5FB1A 2YHNA 2YQLA 4LADB 2YYRA 2AN6A 2LV9A 4MVTA 4WZ0A 1G25A 4ZQLA 4R7EA 2FUUA 1WEPA 3N9LA 5EYAF 4BHWA 2OXQC 3KNVA 1ZBDB 2YREA 2CKLA 3O36A 4L58A 1Z6UA 5DINA 5TABA 3SOXA 4W4UA 2KYUA 2QIZA 2L75A 5B76A 3ASLA 5LKZA 1X4IA 4MSXA 5B8DA 2MT5A 1MM2A 3ZVYA 2YT5A 4B7YC 4IC2A 4I7DA 3DQVR 1V87A 4YABA 4V3LC 2VNFA 3ZPVE 2KWJA 2CSYA 4YBTA 3SHBA 3O34A 2QICA 4FJCA 4ZUXU 5DKAA 2ECIA 3ZVZB 2LGVA 2JMDA 3I2DA 4UI9B 2ECWA 1WESA 5G0FA 4ZDTA 1JOCA 2F6JA 2UZGA 3HCSA 2LGGA 2M1RA 4CA1A 3C5KA 2KWKA 3ZPV1 3M63A 2ECTA 4UP0A 4FK5A 1X4UA 2CSZA 4WZ3B 2MIQA 2K1JA 4GB0A 1IYMA 1LDKC 3VK6A 3KV6A 5FB0A 2MUMA 4NN2A 1WFKA 3L1ZB 5TDWA 2ECNA 4I7CA 4AP4A 5FEYA 3SOUA 2VP7A 2ECGA 2LN0A 4PTBA 3U5MA 4WA6A 5TDRA 2LXHC 2KGIA 3M62A 2VPGA 4YC9A 4YBSA 3GL6A 1N87A 4N4FA 4B86C 2MNYA 1F62A 2LRIC 4IC3A 4S3OC 2VPDA 3N9QA 3LRQA 3NG2A 2KE1A 2KIZA 3O37A 2Y1NA 2M3HA 4A49A 2DX8A 4CCGX 4QF3A 1WIMA 2VPBA 4LLBA 4X3GA 2MA5A 4V3KC 2EGPA 2G43A 2F6NA 1K2FA 2PNXA 4YATA 5AITA 4GNGA 5LCWB 4YADA 2D8SA 5KH9A 2K4DA 2YURA 5JG6A 2L80A 5I3LA 5LKUA 2G6QA 5FERA 3C6WA 1BORA 2LQ6A 4A4BA 3HCUA 1JM7B 2K17A 4AUQB 3KQIA 2L5UA 2JMIA 5C11A 5B79A 5B78A 5D1LB 5J3XA 1Z60A 2F42A 3O33A 1WEUA 2I50A 2VJEA 3U5NA 1WILA 2IDAA 2HDPA 2L43A 5B75A 2FUIA 1X4JA 2C2VS 4TKPB 5TRBA 3HTKC 1LDJB 2E6RA 4S3OB 1WEMA 1WEQA 2MA6A 3O35A 4AYCA 3U5OA 4A0CD 2MD7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWH A;  2RSD A;  2ECJ A;  4BBQ A;  3EB6 A;  2LGK A;  2CKL B;  2MNZ A;  2M6M A;  5H9M A;  1MM3 A;  4WZ2 A;  1WEW A;  4QF2 A;  2RI7 A;  4YAX A;  5H1U A;  2YHO A;  1VYX A;  2KWO A;  2VJE B;  2XEU A;  3O7A A;  2Y43 A;  2YSM A;  4GNE A;  2C2L A;  3U5P A;  4AVX A;  1WEO A;  2ECV A;  1JM7 A;  2KGG A;  2KRE A;  1HYI A;  2H0D B;  4LK9 A;  2XB1 A;  4L7X A;  1FBV A;  4I7B A;  3LQJ A;  3MHS A;  3N9M A;  4GND A;  2VPE A;  2ZET C;  3PUQ A;  3L11 A;  3MHH A;  3L1X A;  1RMD A;  1WEV A;  2FSA A;  4LJN A;  4UP5 A;  1Z2Q A;  4Q6F A;  1T1H A;  2VJF A;  4O64 A;  3PUR A;  5H1T A;  3LQI A;  1FP0 A;  2YQM A;  3SOW A;  2YSJ A;  1U6G B;  3T7L A;  3LQH A;  1CHC A;  5LKT A;  4R8P K;  3ZNI A;  5D1K B;  4R2Y A;  4C9Z A;  2EOD A;  5D1M B;  4A4C A;  4LKA A;  3FL2 A;  2KR4 A;  4XI1 A;  3N9O A;  2Y1M A;  5AIU A;  2YUC A;  1VFY A;  5G04 B;  3RTR B;  4FIP A;  3HCT A;  2H0D A;  3RPG C;  3IHP A;  1HYJ A;  5C13 A;  2YW8 A;  3V43 A;  5TBN A;  2KFT A;  2MD8 C;  3T6R A;  4N3W A;  2JMJ A;  3DPL R;  2YU4 A;  3PHD A;  2HYE D;  4GNF A;  5H1V A;  2CT2 A;  2M85 A;  4FO9 A;  3EB5 A;  3O70 A;  2KU3 A;  1WE9 A;  3KV5 A;  3N9N A;  3M99 A;  5KH3 A;  2QJ0 A;  5G05 B;  4YBM A;  2EA6 A;  2L0B A;  1DVP A;  3ZYQ A;  2E6S A;  3ZTG A;  3GV4 A;  4F52 B;  2KWN A;  2PUY A;  2LDR A;  2G45 A;  1WEN A;  5KH7 A;  2NAA A;  5B77 A;  2LXP C;  1WGM A;  4AYC B;  1E4U A;  4P5O B;  2VJF B;  3RPG B;  2LGL A;  2BAY A;  2K16 A;  5LKX A;  2JRJ A;  3N9P A;  3QZV A;  1VD4 A;  1WEE A;  4PPE A;  5FB1 A;  2YHN A;  2YQL A;  4LAD B;  2YYR A;  2AN6 A;  2LV9 A;  4MVT A;  4WZ0 A;  1G25 A;  4ZQL A;  4R7E A;  2FUU A;  1WEP A;  3N9L A;  5EYA F;  4BHW A;  2OXQ C;  3KNV A;  1ZBD B;  2YRE A;  2CKL A;  3O36 A;  4L58 A;  1Z6U A;  5DIN A;  5TAB A;  3SOX A;  4W4U A;  2KYU A;  2QIZ A;  2L75 A;  5B76 A;  3ASL A;  5LKZ A;  1X4I A;  4MSX A;  5B8D A;  2MT5 A;  1MM2 A;  3ZVY A;  2YT5 A;  4B7Y C;  4IC2 A;  4I7D A;  3DQV R;  1V87 A;  4YAB A;  4V3L C;  2VNF A;  3ZPV E;  2KWJ A;  2CSY A;  4YBT A;  3SHB A;  3O34 A;  2QIC A;  4FJC A;  4ZUX U;  5DKA A;  2ECI A;  3ZVZ B;  2LGV A;  2JMD A;  3I2D A;  4UI9 B;  2ECW A;  1WES A;  5G0F A;  4ZDT A;  1JOC A;  2F6J A;  2UZG A;  3HCS A;  2LGG A;  2M1R A;  4CA1 A;  3C5K A;  2KWK A;  3ZPV 1;  3M63 A;  2ECT A;  4UP0 A;  4FK5 A;  1X4U A;  2CSZ A;  4WZ3 B;  2MIQ A;  2K1J A;  4GB0 A;  1IYM A;  1LDK C;  3VK6 A;  3KV6 A;  5FB0 A;  2MUM A;  4NN2 A;  1WFK A;  3L1Z B;  5TDW A;  2ECN A;  4I7C A;  4AP4 A;  5FEY A;  3SOU A;  2VP7 A;  2ECG A;  2LN0 A;  4PTB A;  3U5M A;  4WA6 A;  5TDR A;  2LXH C;  2KGI A;  3M62 A;  2VPG A;  4YC9 A;  4YBS A;  3GL6 A;  1N87 A;  4N4F A;  4B86 C;  2MNY A;  1F62 A;  2LRI C;  4IC3 A;  4S3O C;  2VPD A;  3N9Q A;  3LRQ A;  3NG2 A;  2KE1 A;  2KIZ A;  3O37 A;  2Y1N A;  2M3H A;  4A49 A;  2DX8 A;  4CCG X;  4QF3 A;  1WIM A;  2VPB A;  4LLB A;  4X3G A;  2MA5 A;  4V3K C;  2EGP A;  2G43 A;  2F6N A;  1K2F A;  2PNX A;  4YAT A;  5AIT A;  4GNG A;  5LCW B;  4YAD A;  2D8S A;  5KH9 A;  2K4D A;  2YUR A;  5JG6 A;  2L80 A;  5I3L A;  5LKU A;  2G6Q A;  5FER A;  3C6W A;  1BOR A;  2LQ6 A;  4A4B A;  3HCU A;  1JM7 B;  2K17 A;  4AUQ B;  3KQI A;  2L5U A;  2JMI A;  5C11 A;  5B79 A;  5B78 A;  5D1L B;  5J3X A;  1Z60 A;  2F42 A;  3O33 A;  1WEU A;  2I50 A;  2VJE A;  3U5N A;  1WIL A;  2IDA A;  2HDP A;  2L43 A;  5B75 A;  2FUI A;  1X4J A;  2C2V S;  4TKP B;  5TRB A;  3HTK C;  1LDJ B;  2E6R A;  4S3O B;  1WEM A;  1WEQ A;  2MA6 A;  3O35 A;  4AYC A;  3U5O A;  4A0C D;  2MD7 B; 
#chains in the Genus database with same CATH topology
 1XWH A;  2RSD A;  2ECJ A;  4BBQ A;  3EB6 A;  2LGK A;  2CKL B;  2MNZ A;  3KDE C;  2EXU A;  2M6M A;  3LJU X;  4OGE A;  5H9M A;  3FEH A;  1MM3 A;  4WZ2 A;  1WEW A;  4QF2 A;  2FD4 A;  3LDY A;  3PLW A;  2RI7 A;  4YAX A;  5H1U A;  2YHO A;  1VYX A;  5SVX A;  2KWO A;  2VJE B;  2XEU A;  3O7A A;  2Y43 A;  2YSM A;  2KKY A;  4GNE A;  2C2L A;  4OGC A;  3U5P A;  4AVX A;  2DJA A;  1WEO A;  2ECV A;  1JM7 A;  2KGG A;  1DCQ A;  2KRE A;  1HYI A;  4LK9 A;  2H0D B;  2XB1 A;  4L7X A;  1FBV A;  4I7B A;  3M7K A;  3LQJ A;  3MHS A;  3N9M A;  4GND A;  2VPE A;  2ZET C;  3PUQ A;  3SUB A;  3L11 A;  3MHH A;  3L1X A;  1RMD A;  1WEV A;  2FSA A;  4LJN A;  4UP5 A;  1Z2Q A;  2L7P A;  4Q6F A;  1T1H A;  2VJF A;  4O64 A;  3PUR A;  5H1T A;  3O47 A;  2RR4 A;  3LQI A;  1FP0 A;  2YQM A;  2M13 A;  3SOW A;  2XOY A;  2YSJ A;  1U6G B;  5SVI B;  2IQJ A;  1CHC A;  3LQH A;  3T7L A;  5LKT A;  4R8P K;  3ZNI A;  5D1K B;  4R2Y A;  4C9Z A;  2EOD A;  5D1M B;  4A4C A;  4LKA A;  3FL2 A;  2KR4 A;  4XI1 A;  2P57 A;  3N9O A;  2JUN A;  2Y1M A;  5AIU A;  2YUC A;  1VFY A;  5G04 B;  3FM8 C;  3RTR B;  4FIP A;  3HCT A;  2XP0 A;  2H0D A;  3RPG C;  2XOC A;  3IHP A;  1HYJ A;  5C13 A;  2YW8 A;  3V43 A;  5TBN A;  2KFT A;  2MD8 C;  3T6R A;  4N3W A;  2JMJ A;  3DPL R;  2YU4 A;  3PHD A;  2HYE D;  4GNF A;  5H1V A;  2CT2 A;  2YVR A;  4F1P A;  3T9K A;  2M85 A;  4FO9 A;  3EB5 A;  3MDB C;  3O70 A;  2KU3 A;  1WE9 A;  3KV5 A;  2LAU A;  3N9N A;  3M99 A;  5KH3 A;  2QJ0 A;  5G05 B;  4YBM A;  4Z0R A;  2EA6 A;  2L0B A;  1DVP A;  3LVQ E;  3ZYQ A;  2E6S A;  3ZTG A;  3DDT A;  3GV4 A;  5K3Q A;  4F52 B;  2KWN A;  2PUY A;  2LDR A;  2G45 A;  1WEN A;  5KH7 A;  2NAA A;  5B77 A;  2LXP C;  3DWD A;  1WGM A;  4AYC B;  1E4U A;  4P5O B;  2VJF B;  3RPG B;  2LGL A;  2BAY A;  2K16 A;  5LKX A;  2JRJ A;  3N9P A;  3QZV A;  1VD4 A;  1WEE A;  4PPE A;  5FB1 A;  2YHN A;  2YQL A;  4LAD B;  2YYR A;  2AN6 A;  2LV9 A;  4MVT A;  4WZ0 A;  1G25 A;  4ZQL A;  4R7E A;  2FUU A;  1WEP A;  3N9L A;  5EYA F;  4BHW A;  2OXQ C;  3KNV A;  1ZBD B;  2YRE A;  2CKL A;  3O36 A;  4L58 A;  1Z6U A;  5DIN A;  5TAB A;  3SOX A;  2EGM A;  4W4U A;  2XOZ A;  2KYU A;  2QIZ A;  2L75 A;  5B76 A;  3ASL A;  5LKZ A;  1X4I A;  4MSX A;  5B8D A;  2B0O E;  2MT5 A;  1MM2 A;  3ZVY A;  2YT5 A;  4B7Y C;  4IC2 A;  4I7D A;  3DQV R;  2E61 A;  1V87 A;  4YAB A;  4V3L C;  2VNF A;  3ZPV E;  2KWJ A;  2CSY A;  4YBT A;  3SHB A;  3E2D A;  3O34 A;  2QIC A;  4FJC A;  5SVY A;  4ZUX U;  5DKA A;  2CSV A;  2ECI A;  3ZVZ B;  3FJU B;  4QQ4 A;  2LGV A;  5SVI A;  2JMD A;  3I2D A;  1MBM A;  3JUE A;  4UI9 B;  2ECW A;  1WES A;  5G0F A;  4ZDT A;  1JOC A;  2F6J A;  2UZG A;  3HCS A;  2LGG A;  2M1R A;  4CA1 A;  3C5K A;  2KWK A;  3ZPV 1;  2CRR A;  3M63 A;  2ECT A;  4UP0 A;  4FK5 A;  1X4U A;  2CSZ A;  2MKE A;  2CON A;  4WZ3 B;  2MIQ A;  4O62 A;  2K1J A;  4GB0 A;  1IYM A;  1LDK C;  3FAO A;  3VK6 A;  3KV6 A;  5FB0 A;  2MUM A;  4NN2 A;  1WFK A;  3L1Z B;  5TDW A;  2ECN A;  4I7C A;  4AP4 A;  5FEY A;  3SOU A;  2VP7 A;  2ECG A;  2LN0 A;  4PTB A;  3U5M A;  2FFW A;  3LVR E;  4WA6 A;  5TDR A;  2KKX A;  2LXH C;  2KGI A;  3M62 A;  3FAN A;  2VPG A;  4YC9 A;  4YBS A;  3GL6 A;  1N87 A;  4N4F A;  4B86 C;  2MNY A;  1F62 A;  2LRI C;  4IC3 A;  4S3O C;  2VPD A;  3N9Q A;  3LRQ A;  3NG2 A;  2KE1 A;  2KIZ A;  3O37 A;  2OWA A;  2Y1N A;  2M3H A;  4A49 A;  2DX8 A;  4CCG X;  4QF3 A;  1WIM A;  2VPB A;  4LLB A;  4X3G A;  2MA5 A;  4V3K C;  2EGP A;  2G43 A;  2F6N A;  1K2F A;  2PNX A;  4YAT A;  3H7H A;  5AIT A;  4GNG A;  5LCW B;  4YAD A;  2D8S A;  2DSM A;  5KH9 A;  2K4D A;  2YUR A;  2CRW A;  5JG6 A;  2L80 A;  5I3L A;  5LKU A;  2G6Q A;  5FER A;  3C6W A;  1BOR A;  3Q1D A;  2LQ6 A;  4A4B A;  3HCU A;  1JM7 B;  2K17 A;  4AUQ B;  3KQI A;  2L5U A;  2JMI A;  5C11 A;  5B79 A;  5B78 A;  5D1L B;  5J3X A;  1Z60 A;  2F42 A;  3O33 A;  1WEU A;  2I50 A;  2VJE A;  3U5N A;  1WIL A;  2IDA A;  2HDP A;  2L43 A;  5B75 A;  2FUI A;  1X4J A;  2C2V S;  4TKP B;  5TRB A;  3HTK C;  4H9D A;  1LDJ B;  2E6R A;  4S3O B;  1WEM A;  1WEQ A;  2MA6 A;  3O35 A;  4Z0O A;  4AYC A;  2D8U A;  3U5O A;  2JM3 A;  4A0C D;  2MD7 B; 
#chains in the Genus database with same CATH homology
 1XWH A;  2RSD A;  2ECJ A;  4BBQ A;  3EB6 A;  2LGK A;  2CKL B;  2MNZ A;  2M6M A;  5H9M A;  1MM3 A;  4WZ2 A;  1WEW A;  4QF2 A;  2RI7 A;  4YAX A;  5H1U A;  2YHO A;  1VYX A;  2KWO A;  2VJE B;  2XEU A;  3O7A A;  2Y43 A;  2YSM A;  4GNE A;  2C2L A;  3U5P A;  4AVX A;  1WEO A;  2ECV A;  1JM7 A;  2KGG A;  2KRE A;  1HYI A;  2H0D B;  4LK9 A;  2XB1 A;  4L7X A;  1FBV A;  4I7B A;  3LQJ A;  3MHS A;  3N9M A;  4GND A;  2VPE A;  2ZET C;  3PUQ A;  3L11 A;  3MHH A;  3L1X A;  1RMD A;  1WEV A;  2FSA A;  4LJN A;  4UP5 A;  1Z2Q A;  4Q6F A;  1T1H A;  2VJF A;  4O64 A;  3PUR A;  5H1T A;  3LQI A;  1FP0 A;  2YQM A;  3SOW A;  2YSJ A;  1U6G B;  3T7L A;  3LQH A;  1CHC A;  5LKT A;  4R8P K;  3ZNI A;  5D1K B;  4R2Y A;  4C9Z A;  2EOD A;  5D1M B;  4A4C A;  4LKA A;  3FL2 A;  2KR4 A;  4XI1 A;  3N9O A;  2Y1M A;  5AIU A;  2YUC A;  1VFY A;  5G04 B;  3RTR B;  4FIP A;  3HCT A;  2H0D A;  3RPG C;  3IHP A;  1HYJ A;  5C13 A;  2YW8 A;  3V43 A;  5TBN A;  2KFT A;  2MD8 C;  3T6R A;  4N3W A;  2JMJ A;  3DPL R;  2YU4 A;  3PHD A;  2HYE D;  4GNF A;  5H1V A;  2CT2 A;  2M85 A;  4FO9 A;  3EB5 A;  3O70 A;  2KU3 A;  1WE9 A;  3KV5 A;  3N9N A;  3M99 A;  5KH3 A;  2QJ0 A;  5G05 B;  4YBM A;  2EA6 A;  2L0B A;  1DVP A;  3ZYQ A;  2E6S A;  3ZTG A;  3GV4 A;  4F52 B;  2KWN A;  2PUY A;  2LDR A;  2G45 A;  1WEN A;  5KH7 A;  2NAA A;  5B77 A;  2LXP C;  1WGM A;  4AYC B;  1E4U A;  4P5O B;  2VJF B;  3RPG B;  2LGL A;  2BAY A;  2K16 A;  5LKX A;  2JRJ A;  3N9P A;  3QZV A;  1VD4 A;  1WEE A;  4PPE A;  5FB1 A;  2YHN A;  2YQL A;  4LAD B;  2YYR A;  2AN6 A;  2LV9 A;  4MVT A;  4WZ0 A;  1G25 A;  4ZQL A;  4R7E A;  2FUU A;  1WEP A;  3N9L A;  5EYA F;  4BHW A;  2OXQ C;  3KNV A;  1ZBD B;  2YRE A;  2CKL A;  3O36 A;  4L58 A;  1Z6U A;  5DIN A;  5TAB A;  3SOX A;  4W4U A;  2KYU A;  2QIZ A;  2L75 A;  5B76 A;  3ASL A;  5LKZ A;  1X4I A;  4MSX A;  5B8D A;  2MT5 A;  1MM2 A;  3ZVY A;  2YT5 A;  4B7Y C;  4IC2 A;  4I7D A;  3DQV R;  1V87 A;  4YAB A;  4V3L C;  2VNF A;  3ZPV E;  2KWJ A;  2CSY A;  4YBT A;  3SHB A;  3O34 A;  2QIC A;  4FJC A;  4ZUX U;  5DKA A;  2ECI A;  3ZVZ B;  2LGV A;  2JMD A;  3I2D A;  4UI9 B;  2ECW A;  1WES A;  5G0F A;  4ZDT A;  1JOC A;  2F6J A;  2UZG A;  3HCS A;  2LGG A;  2M1R A;  4CA1 A;  3C5K A;  2KWK A;  3ZPV 1;  3M63 A;  2ECT A;  4UP0 A;  4FK5 A;  1X4U A;  2CSZ A;  4WZ3 B;  2MIQ A;  2K1J A;  4GB0 A;  1IYM A;  1LDK C;  3VK6 A;  3KV6 A;  5FB0 A;  2MUM A;  4NN2 A;  1WFK A;  3L1Z B;  5TDW A;  2ECN A;  4I7C A;  4AP4 A;  5FEY A;  3SOU A;  2VP7 A;  2ECG A;  2LN0 A;  4PTB A;  3U5M A;  4WA6 A;  5TDR A;  2LXH C;  2KGI A;  3M62 A;  2VPG A;  4YC9 A;  4YBS A;  3GL6 A;  1N87 A;  4N4F A;  4B86 C;  2MNY A;  1F62 A;  2LRI C;  4IC3 A;  4S3O C;  2VPD A;  3N9Q A;  3LRQ A;  3NG2 A;  2KE1 A;  2KIZ A;  3O37 A;  2Y1N A;  2M3H A;  4A49 A;  2DX8 A;  4CCG X;  4QF3 A;  1WIM A;  2VPB A;  4LLB A;  4X3G A;  2MA5 A;  4V3K C;  2EGP A;  2G43 A;  2F6N A;  1K2F A;  2PNX A;  4YAT A;  5AIT A;  4GNG A;  5LCW B;  4YAD A;  2D8S A;  5KH9 A;  2K4D A;  2YUR A;  5JG6 A;  2L80 A;  5I3L A;  5LKU A;  2G6Q A;  5FER A;  3C6W A;  1BOR A;  2LQ6 A;  4A4B A;  3HCU A;  1JM7 B;  2K17 A;  4AUQ B;  3KQI A;  2L5U A;  2JMI A;  5C11 A;  5B79 A;  5B78 A;  5D1L B;  5J3X A;  1Z60 A;  2F42 A;  3O33 A;  1WEU A;  2I50 A;  2VJE A;  3U5N A;  1WIL A;  2IDA A;  2HDP A;  2L43 A;  5B75 A;  2FUI A;  1X4J A;  2C2V S;  4TKP B;  5TRB A;  3HTK C;  1LDJ B;  2E6R A;  4S3O B;  1WEM A;  1WEQ A;  2MA6 A;  3O35 A;  4AYC A;  3U5O A;  4A0C D;  2MD7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...