2LV9A

Solution nmr structure of the phd domain of human mll5, northeast structural genomics consortium target hr6512a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
b'SEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase MLL5
publication title NMR solution structure of the human MLL5 PHD domain (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 80
sequence length 80
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lv9A00
2JMJA 1XWHA 2L5UA 4YATA 3SHBA 3DQVR 2YURA 3SOXA 1VD4A 4GNGA 4YBTA 4Q6FA 3MHHA 3N9OA 2G45A 4GB0A 4V3LC 1WEWA 2F6JA 3L1ZB 3GL6A 3N9NA 3RTRB 2JMDA 2KFTA 3RPGC 1JM7B 3SOWA 2KGGA 5H1UA 2CSYA 3ZVZB 1WENA 4X3GA 2L75A 2LQ6A 4I7DA 5DINA 5TDRA 3SOUA 2JMIA 1FP0A 2LXHC 4A49A 2L80A 2LRIC 1E4UA 3KV5A 3RPGB 4B86C 4WZ2A 5C11A 2E6RA 3O70A 1X4JA 4LADB 2MA5A 5J3XA 1V87A 3O37A 3QZVA 2VJEB 4ZDTA 5H1TA 3O7AA 2K1JA 1WGMA 2FUUA 2KWOA 2QJ0A 2VPEA 3LRQA 4UI9B 1VFYA 2QICA 3N9PA 3C6WA 2KWJA 3U5OA 3ZVYA 4S3OC 4AYCB 4AP4A 4BBQA 3PURA 2IDAA 3KQIA 4LJNA 2I50A 3HTKC 2ECTA 2FUIA 1LDJB 2G43A 5FB0A 1Z60A 4NN2A 3I2DA 3O35A 1HYJA 4R8PK 2ECNA 4WZ3B 2ECVA 5LCWB 4B7YC 1WEEA 2CKLA 1WIMA 2HDPA 2Y1NA 1DVPA 4R2YA 2VP7A 5D1MB 5H9MA 4CA1A 2XEUA 2F42A 4CCGX 3ASLA 2VNFA 2YHOA 4AVXA 1WEPA 4LLBA 2NAAA 2KYUA 4PPEA 2K4DA 4ZUXU 3U5PA 3EB6A 2YSMA 3M99A 2VJFA 2YSJA 3IHPA 4YADA 2KIZA 1WFKA 5B76A 1MM3A 5AITA 3O33A 2YQLA 2D8SA 4FO9A 4QF3A 2KR4A 2FSAA 3HCUA 2L43A 2K17A 3LQIA 1JOCA 3ZTGA 5TABA 4R7EA 2VJEA 5LKZA 1LDKC 4XI1A 2KREA 2LV9A 2XB1A 2E6SA 2L0BA 2PNXA 2H0DA 2MD7B 2KGIA 2LGGA 2M3HA 4TKPB 1RMDA 5C13A 4I7BA 3VK6A 2MUMA 1Z2QA 2ECIA 5G05B 2RSDA 4AYCA 3N9MA 2YYRA 3EB5A 2LGVA 2ZETC 2C2VS 2G6QA 5B75A 4YAXA 4V3KC 1Z6UA 2YW8A 4IC3A 2LGKA 3T7LA 3C5KA 4ZQLA 3M62A 2MIQA 3O34A 2F6NA 1WEQA 4IC2A 4L58A 3ZYQA 5KH9A 2EODA 5LKTA 2UZGA 4A4CA 2LDRA 3N9LA 3ZNIA 4FIPA 5FEYA 1MM2A 4F52B 3N9QA 1CHCA 3V43A 3LQHA 1WILA 3GV4A 2YU4A 2LN0A 4O64A 3L11A 4FJCA 3HCSA 5TBNA 4L7XA 5KH7A 5G04B 2YREA 2K16A 2M6MA 1T1HA 3L1XA 5JG6A 1JM7A 2EA6A 2ECGA 4UP5A 4P5OB 2OXQC 2KU3A 1N87A 1FBVA 2YT5A 5B8DA 5FB1A 5TDWA 2CKLB 4MVTA 3O36A 2Y1MA 3T6RA 4BHWA 2JRJA 2VPBA 1WEMA 2KWNA 4PTBA 3LQJA 2MT5A 2PUYA 2Y43A 4UP0A 3PUQA 4WA6A 3PHDA 4YC9A 4C9ZA 2LGLA 2CT2A 2VPGA 1U6GB 3MHSA 5D1KB 4LK9A 3ZPVE 4YABA 5LKXA 1VYXA 5KH3A 3NG2A 4WZ0A 2MNZA 1WE9A 2VJFB 5B78A 4N4FA 2MA6A 3M63A 3KNVA 4GNEA 5LKUA 1K2FA 2BAYA 3FL2A 2VPDA 2MD8C 2KE1A 4A0CD 4GNFA 1WESA 1BORA 1X4UA 4QF2A 5B77A 4MSXA 5AIUA 4YBMA 2KWKA 4YBSA 1X4IA 2H0DB 5I3LA 4AUQB 2M1RA 3HCTA 2C2LA 4LKAA 2YQMA 2EGPA 3KV6A 4FK5A 2DX8A 2RI7A 2YUCA 5D1LB 1WEUA 5FERA 1G25A 2HYED 5G0FA 4N3WA 3DPLR 1IYMA 2CSZA 4A4BA 5DKAA 5TRBA 2M85A 4S3OB 5H1VA 4W4UA 4GNDA 3U5NA 2AN6A 3ZPV1 2YHNA 4I7CA 3U5MA 1F62A 2LXPC 1WEOA 5B79A 1HYIA 1WEVA 5EYAF 2ECWA 1ZBDB 2MNYA 2ECJA 2QIZA
chains in the Genus database with same CATH superfamily
2JMJA 1XWHA 2L5UA 3DDTA 4YATA 3T9KA 3SHBA 3DQVR 2YURA 3SOXA 1VD4A 4GNGA 4YBTA 4Q6FA 3MHHA 3N9OA 2G45A 4GB0A 4V3LC 2FD4A 1WEWA 2F6JA 3L1ZB 3GL6A 3N9NA 3RTRB 2JM3A 2B0OE 2JMDA 2KFTA 3RPGC 1JM7B 3SOWA 3H7HA 3FM8C 2KGGA 5SVXA 5H1UA 2CSYA 3ZVZB 1WENA 2EGMA 4X3GA 2L75A 2LQ6A 4I7DA 5DINA 5TDRA 3O47A 3SOUA 2JMIA 2D8UA 1FP0A 3FANA 2LXHC 4A49A 2L80A 2LRIC 1E4UA 3KV5A 3RPGB 4B86C 4WZ2A 5C11A 2E6RA 3O70A 1X4JA 4OGCA 4LADB 2MA5A 5J3XA 1V87A 3O37A 3QZVA 2VJEB 4ZDTA 5H1TA 3O7AA 2K1JA 1WGMA 2FUUA 2KWOA 2QJ0A 2VPEA 2LAUA 3LRQA 4UI9B 1VFYA 2QICA 3N9PA 3C6WA 2KWJA 2MKEA 3U5OA 4OGEA 3ZVYA 4S3OC 4AYCB 3MDBC 4AP4A 3PLWA 4BBQA 3PURA 2IDAA 3KQIA 4LJNA 2I50A 3HTKC 2ECTA 2FUIA 1LDJB 2G43A 5FB0A 1Z60A 4NN2A 3I2DA 3O35A 2DSMA 1HYJA 4R8PK 2ECNA 4WZ3B 2ECVA 5LCWB 4B7YC 1WEEA 2CKLA 1WIMA 2HDPA 2Y1NA 1DVPA 4R2YA 4Z0RA 2VP7A 5D1MB 5H9MA 2KKXA 2XEUA 4CA1A 2F42A 3FAOA 4CCGX 3ASLA 2VNFA 2YHOA 4AVXA 1WEPA 3Q1DA 4LLBA 2NAAA 3KDEC 2KYUA 4PPEA 2K4DA 4ZUXU 2DJAA 3U5PA 3JUEA 3EB6A 2YSMA 3M99A 2VJFA 2YSJA 2OWAA 2XOZA 3IHPA 4YADA 2KIZA 1WFKA 5B76A 1MM3A 5AITA 3O33A 2YQLA 2D8SA 4FO9A 4QF3A 2KR4A 2FSAA 3HCUA 2L43A 2K17A 3LQIA 1JOCA 3ZTGA 5TABA 5SVYA 4R7EA 2VJEA 4F1PA 5LKZA 1LDKC 4XI1A 2KREA 2LV9A 2XB1A 2E6SA 2L0BA 2PNXA 2H0DA 2MD7B 3E2DA 2KGIA 2LGGA 2IQJA 2M3HA 4TKPB 1RMDA 5C13A 4I7BA 3VK6A 2YVRA 2MUMA 1Z2QA 2XOCA 2ECIA 5G05B 2RSDA 4AYCA 3N9MA 5SVIB 2YYRA 3EB5A 2JUNA 2LGVA 2ZETC 2C2VS 4QQ4A 2G6QA 5B75A 4YAXA 4V3KC 1Z6UA 2YW8A 4IC3A 2LGKA 3T7LA 3C5KA 4ZQLA 3M62A 2MIQA 3O34A 2F6NA 1WEQA 4IC2A 4L58A 3ZYQA 1MBMA 5KH9A 2EODA 5LKTA 2UZGA 4A4CA 5K3QA 2LDRA 3N9LA 3ZNIA 4FIPA 5FEYA 3M7KA 1MM2A 4F52B 3FJUB 3N9QA 1CHCA 2M13A 3V43A 3LQHA 1WILA 3GV4A 2YU4A 2L7PA 2LN0A 2RR4A 4O64A 3L11A 4FJCA 3HCSA 5TBNA 4L7XA 5KH7A 5G04B 2YREA 2K16A 2M6MA 1T1HA 3L1XA 5JG6A 1JM7A 2EA6A 2ECGA 3FEHA 4UP5A 4P5OB 2OXQC 2KU3A 1N87A 1FBVA 3SUBA 2YT5A 5B8DA 5FB1A 5TDWA 2CKLB 4MVTA 3O36A 2FFWA 2Y1MA 3T6RA 4BHWA 2JRJA 2VPBA 1DCQA 1WEMA 2KWNA 4PTBA 3LQJA 2MT5A 2PUYA 2P57A 2Y43A 4UP0A 3PUQA 4WA6A 3PHDA 2CSVA 4YC9A 4C9ZA 5SVIA 2LGLA 2CT2A 2VPGA 1U6GB 3DWDA 3MHSA 5D1KB 4LK9A 3ZPVE 4YABA 5LKXA 1VYXA 5KH3A 3NG2A 4WZ0A 2MNZA 1WE9A 2VJFB 5B78A 4N4FA 2MA6A 2CRRA 3M63A 4O62A 3KNVA 4GNEA 5LKUA 1K2FA 2BAYA 2EXUA 3FL2A 2VPDA 3LJUX 2MD8C 2KE1A 4A0CD 4GNFA 1WESA 1BORA 1X4UA 4QF2A 5B77A 4MSXA 5AIUA 4YBMA 2KWKA 4YBSA 1X4IA 2H0DB 5I3LA 4AUQB 2M1RA 3HCTA 2C2LA 2KKYA 4LKAA 2YQMA 2EGPA 3LVQE 3KV6A 4FK5A 2DX8A 2RI7A 2YUCA 2XP0A 5D1LB 1WEUA 5FERA 1G25A 2HYED 5G0FA 4N3WA 3DPLR 2XOYA 1IYMA 2CRWA 2CSZA 4A4BA 2CONA 5DKAA 5TRBA 2M85A 4S3OB 5H1VA 4W4UA 4GNDA 4Z0OA 4H9DA 3U5NA 2AN6A 3ZPV1 2YHNA 4I7CA 3U5MA 1F62A 2LXPC 3LDYA 1WEOA 2E61A 5B79A 1HYIA 1WEVA 3LVRE 5EYAF 2ECWA 1ZBDB 2MNYA 2ECJA 2QIZA
chains in the Genus database with same CATH topology
2JMJA 1XWHA 2L5UA 4YATA 3SHBA 3DQVR 2YURA 3SOXA 1VD4A 4GNGA 4YBTA 4Q6FA 3MHHA 3N9OA 2G45A 4GB0A 4V3LC 1WEWA 2F6JA 3L1ZB 3GL6A 3N9NA 3RTRB 2JMDA 2KFTA 3RPGC 1JM7B 3SOWA 2KGGA 5H1UA 2CSYA 3ZVZB 1WENA 4X3GA 2L75A 2LQ6A 4I7DA 5DINA 5TDRA 3SOUA 2JMIA 1FP0A 2LXHC 4A49A 2L80A 2LRIC 1E4UA 3KV5A 3RPGB 4B86C 4WZ2A 5C11A 2E6RA 3O70A 1X4JA 4LADB 2MA5A 5J3XA 1V87A 3O37A 3QZVA 2VJEB 4ZDTA 5H1TA 3O7AA 2K1JA 1WGMA 2FUUA 2KWOA 2QJ0A 2VPEA 3LRQA 4UI9B 1VFYA 2QICA 3N9PA 3C6WA 2KWJA 3U5OA 3ZVYA 4S3OC 4AYCB 4AP4A 4BBQA 3PURA 2IDAA 3KQIA 4LJNA 2I50A 3HTKC 2ECTA 2FUIA 1LDJB 2G43A 5FB0A 1Z60A 4NN2A 3I2DA 3O35A 1HYJA 4R8PK 2ECNA 4WZ3B 2ECVA 5LCWB 4B7YC 1WEEA 2CKLA 1WIMA 2HDPA 2Y1NA 1DVPA 4R2YA 2VP7A 5D1MB 5H9MA 4CA1A 2XEUA 2F42A 4CCGX 3ASLA 2VNFA 2YHOA 4AVXA 1WEPA 4LLBA 2NAAA 2KYUA 4PPEA 2K4DA 4ZUXU 3U5PA 3EB6A 2YSMA 3M99A 2VJFA 2YSJA 3IHPA 4YADA 2KIZA 1WFKA 5B76A 1MM3A 5AITA 3O33A 2YQLA 2D8SA 4FO9A 4QF3A 2KR4A 2FSAA 3HCUA 2L43A 2K17A 3LQIA 1JOCA 3ZTGA 5TABA 4R7EA 2VJEA 5LKZA 1LDKC 4XI1A 2KREA 2LV9A 2XB1A 2E6SA 2L0BA 2PNXA 2H0DA 2MD7B 2KGIA 2LGGA 2M3HA 4TKPB 1RMDA 5C13A 4I7BA 3VK6A 2MUMA 1Z2QA 2ECIA 5G05B 2RSDA 4AYCA 3N9MA 2YYRA 3EB5A 2LGVA 2ZETC 2C2VS 2G6QA 5B75A 4YAXA 4V3KC 1Z6UA 2YW8A 4IC3A 2LGKA 3T7LA 3C5KA 4ZQLA 3M62A 2MIQA 3O34A 2F6NA 1WEQA 4IC2A 4L58A 3ZYQA 5KH9A 2EODA 5LKTA 2UZGA 4A4CA 2LDRA 3N9LA 3ZNIA 4FIPA 5FEYA 1MM2A 4F52B 3N9QA 1CHCA 3V43A 3LQHA 1WILA 3GV4A 2YU4A 2LN0A 4O64A 3L11A 4FJCA 3HCSA 5TBNA 4L7XA 5KH7A 5G04B 2YREA 2K16A 2M6MA 1T1HA 3L1XA 5JG6A 1JM7A 2EA6A 2ECGA 4UP5A 4P5OB 2OXQC 2KU3A 1N87A 1FBVA 2YT5A 5B8DA 5FB1A 5TDWA 2CKLB 4MVTA 3O36A 2Y1MA 3T6RA 4BHWA 2JRJA 2VPBA 1WEMA 2KWNA 4PTBA 3LQJA 2MT5A 2PUYA 2Y43A 4UP0A 3PUQA 4WA6A 3PHDA 4YC9A 4C9ZA 2LGLA 2CT2A 2VPGA 1U6GB 3MHSA 5D1KB 4LK9A 3ZPVE 4YABA 5LKXA 1VYXA 5KH3A 3NG2A 4WZ0A 2MNZA 1WE9A 2VJFB 5B78A 4N4FA 2MA6A 3M63A 3KNVA 4GNEA 5LKUA 1K2FA 2BAYA 3FL2A 2VPDA 2MD8C 2KE1A 4A0CD 4GNFA 1WESA 1BORA 1X4UA 4QF2A 5B77A 4MSXA 5AIUA 4YBMA 2KWKA 4YBSA 1X4IA 2H0DB 5I3LA 4AUQB 2M1RA 3HCTA 2C2LA 4LKAA 2YQMA 2EGPA 3KV6A 4FK5A 2DX8A 2RI7A 2YUCA 5D1LB 1WEUA 5FERA 1G25A 2HYED 5G0FA 4N3WA 3DPLR 1IYMA 2CSZA 4A4BA 5DKAA 5TRBA 2M85A 4S3OB 5H1VA 4W4UA 4GNDA 3U5NA 2AN6A 3ZPV1 2YHNA 4I7CA 3U5MA 1F62A 2LXPC 1WEOA 5B79A 1HYIA 1WEVA 5EYAF 2ECWA 1ZBDB 2MNYA 2ECJA 2QIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMJ A;  1XWH A;  2L5U A;  4YAT A;  3SHB A;  3DQV R;  2YUR A;  3SOX A;  1VD4 A;  4GNG A;  4YBT A;  4Q6F A;  3MHH A;  3N9O A;  2G45 A;  4GB0 A;  4V3L C;  1WEW A;  2F6J A;  3L1Z B;  3GL6 A;  3N9N A;  3RTR B;  2JMD A;  2KFT A;  3RPG C;  1JM7 B;  3SOW A;  2KGG A;  5H1U A;  2CSY A;  3ZVZ B;  1WEN A;  4X3G A;  2L75 A;  2LQ6 A;  4I7D A;  5DIN A;  5TDR A;  3SOU A;  2JMI A;  1FP0 A;  2LXH C;  4A49 A;  2L80 A;  2LRI C;  1E4U A;  3KV5 A;  3RPG B;  4B86 C;  4WZ2 A;  5C11 A;  2E6R A;  3O70 A;  1X4J A;  4LAD B;  2MA5 A;  5J3X A;  1V87 A;  3O37 A;  3QZV A;  2VJE B;  4ZDT A;  5H1T A;  3O7A A;  2K1J A;  1WGM A;  2FUU A;  2KWO A;  2QJ0 A;  2VPE A;  3LRQ A;  4UI9 B;  1VFY A;  2QIC A;  3N9P A;  3C6W A;  2KWJ A;  3U5O A;  3ZVY A;  4S3O C;  4AYC B;  4AP4 A;  4BBQ A;  3PUR A;  2IDA A;  3KQI A;  4LJN A;  2I50 A;  3HTK C;  2ECT A;  2FUI A;  1LDJ B;  2G43 A;  5FB0 A;  1Z60 A;  4NN2 A;  3I2D A;  3O35 A;  1HYJ A;  4R8P K;  2ECN A;  4WZ3 B;  2ECV A;  5LCW B;  4B7Y C;  1WEE A;  2CKL A;  1WIM A;  2HDP A;  2Y1N A;  1DVP A;  4R2Y A;  2VP7 A;  5D1M B;  5H9M A;  4CA1 A;  2XEU A;  2F42 A;  4CCG X;  3ASL A;  2VNF A;  2YHO A;  4AVX A;  1WEP A;  4LLB A;  2NAA A;  2KYU A;  4PPE A;  2K4D A;  4ZUX U;  3U5P A;  3EB6 A;  2YSM A;  3M99 A;  2VJF A;  2YSJ A;  3IHP A;  4YAD A;  2KIZ A;  1WFK A;  5B76 A;  1MM3 A;  5AIT A;  3O33 A;  2YQL A;  2D8S A;  4FO9 A;  4QF3 A;  2KR4 A;  2FSA A;  3HCU A;  2L43 A;  2K17 A;  3LQI A;  1JOC A;  3ZTG A;  5TAB A;  4R7E A;  2VJE A;  5LKZ A;  1LDK C;  4XI1 A;  2KRE A;  2LV9 A;  2XB1 A;  2E6S A;  2L0B A;  2PNX A;  2H0D A;  2MD7 B;  2KGI A;  2LGG A;  2M3H A;  4TKP B;  1RMD A;  5C13 A;  4I7B A;  3VK6 A;  2MUM A;  1Z2Q A;  2ECI A;  5G05 B;  2RSD A;  4AYC A;  3N9M A;  2YYR A;  3EB5 A;  2LGV A;  2ZET C;  2C2V S;  2G6Q A;  5B75 A;  4YAX A;  4V3K C;  1Z6U A;  2YW8 A;  4IC3 A;  2LGK A;  3T7L A;  3C5K A;  4ZQL A;  3M62 A;  2MIQ A;  3O34 A;  2F6N A;  1WEQ A;  4IC2 A;  4L58 A;  3ZYQ A;  5KH9 A;  2EOD A;  5LKT A;  2UZG A;  4A4C A;  2LDR A;  3N9L A;  3ZNI A;  4FIP A;  5FEY A;  1MM2 A;  4F52 B;  3N9Q A;  1CHC A;  3V43 A;  3LQH A;  1WIL A;  3GV4 A;  2YU4 A;  2LN0 A;  4O64 A;  3L11 A;  4FJC A;  3HCS A;  5TBN A;  4L7X A;  5KH7 A;  5G04 B;  2YRE A;  2K16 A;  2M6M A;  1T1H A;  3L1X A;  5JG6 A;  1JM7 A;  2EA6 A;  2ECG A;  4UP5 A;  4P5O B;  2OXQ C;  2KU3 A;  1N87 A;  1FBV A;  2YT5 A;  5B8D A;  5FB1 A;  5TDW A;  2CKL B;  4MVT A;  3O36 A;  2Y1M A;  3T6R A;  4BHW A;  2JRJ A;  2VPB A;  1WEM A;  2KWN A;  4PTB A;  3LQJ A;  2MT5 A;  2PUY A;  2Y43 A;  4UP0 A;  3PUQ A;  4WA6 A;  3PHD A;  4YC9 A;  4C9Z A;  2LGL A;  2CT2 A;  2VPG A;  1U6G B;  3MHS A;  5D1K B;  4LK9 A;  3ZPV E;  4YAB A;  5LKX A;  1VYX A;  5KH3 A;  3NG2 A;  4WZ0 A;  2MNZ A;  1WE9 A;  2VJF B;  5B78 A;  4N4F A;  2MA6 A;  3M63 A;  3KNV A;  4GNE A;  5LKU A;  1K2F A;  2BAY A;  3FL2 A;  2VPD A;  2MD8 C;  2KE1 A;  4A0C D;  4GNF A;  1WES A;  1BOR A;  1X4U A;  4QF2 A;  5B77 A;  4MSX A;  5AIU A;  4YBM A;  2KWK A;  4YBS A;  1X4I A;  2H0D B;  5I3L A;  4AUQ B;  2M1R A;  3HCT A;  2C2L A;  4LKA A;  2YQM A;  2EGP A;  3KV6 A;  4FK5 A;  2DX8 A;  2RI7 A;  2YUC A;  5D1L B;  1WEU A;  5FER A;  1G25 A;  2HYE D;  5G0F A;  4N3W A;  3DPL R;  1IYM A;  2CSZ A;  4A4B A;  5DKA A;  5TRB A;  2M85 A;  4S3O B;  5H1V A;  4W4U A;  4GND A;  3U5N A;  2AN6 A;  3ZPV 1;  2YHN A;  4I7C A;  3U5M A;  1F62 A;  2LXP C;  1WEO A;  5B79 A;  1HYI A;  1WEV A;  5EYA F;  2ECW A;  1ZBD B;  2MNY A;  2ECJ A;  2QIZ A; 
#chains in the Genus database with same CATH topology
 2JMJ A;  1XWH A;  2L5U A;  3DDT A;  4YAT A;  3T9K A;  3SHB A;  3DQV R;  2YUR A;  3SOX A;  1VD4 A;  4GNG A;  4YBT A;  4Q6F A;  3MHH A;  3N9O A;  2G45 A;  4GB0 A;  4V3L C;  2FD4 A;  1WEW A;  2F6J A;  3L1Z B;  3GL6 A;  3N9N A;  3RTR B;  2JM3 A;  2B0O E;  2JMD A;  2KFT A;  3RPG C;  1JM7 B;  3SOW A;  3H7H A;  3FM8 C;  2KGG A;  5SVX A;  5H1U A;  2CSY A;  3ZVZ B;  1WEN A;  2EGM A;  4X3G A;  2L75 A;  2LQ6 A;  4I7D A;  5DIN A;  5TDR A;  3O47 A;  3SOU A;  2JMI A;  2D8U A;  1FP0 A;  3FAN A;  2LXH C;  4A49 A;  2L80 A;  2LRI C;  1E4U A;  3KV5 A;  3RPG B;  4B86 C;  4WZ2 A;  5C11 A;  2E6R A;  3O70 A;  1X4J A;  4OGC A;  4LAD B;  2MA5 A;  5J3X A;  1V87 A;  3O37 A;  3QZV A;  2VJE B;  4ZDT A;  5H1T A;  3O7A A;  2K1J A;  1WGM A;  2FUU A;  2KWO A;  2QJ0 A;  2VPE A;  2LAU A;  3LRQ A;  4UI9 B;  1VFY A;  2QIC A;  3N9P A;  3C6W A;  2KWJ A;  2MKE A;  3U5O A;  4OGE A;  3ZVY A;  4S3O C;  4AYC B;  3MDB C;  4AP4 A;  3PLW A;  4BBQ A;  3PUR A;  2IDA A;  3KQI A;  4LJN A;  2I50 A;  3HTK C;  2ECT A;  2FUI A;  1LDJ B;  2G43 A;  5FB0 A;  1Z60 A;  4NN2 A;  3I2D A;  3O35 A;  2DSM A;  1HYJ A;  4R8P K;  2ECN A;  4WZ3 B;  2ECV A;  5LCW B;  4B7Y C;  1WEE A;  2CKL A;  1WIM A;  2HDP A;  2Y1N A;  1DVP A;  4R2Y A;  4Z0R A;  2VP7 A;  5D1M B;  5H9M A;  2KKX A;  2XEU A;  4CA1 A;  2F42 A;  3FAO A;  4CCG X;  3ASL A;  2VNF A;  2YHO A;  4AVX A;  1WEP A;  3Q1D A;  4LLB A;  2NAA A;  3KDE C;  2KYU A;  4PPE A;  2K4D A;  4ZUX U;  2DJA A;  3U5P A;  3JUE A;  3EB6 A;  2YSM A;  3M99 A;  2VJF A;  2YSJ A;  2OWA A;  2XOZ A;  3IHP A;  4YAD A;  2KIZ A;  1WFK A;  5B76 A;  1MM3 A;  5AIT A;  3O33 A;  2YQL A;  2D8S A;  4FO9 A;  4QF3 A;  2KR4 A;  2FSA A;  3HCU A;  2L43 A;  2K17 A;  3LQI A;  1JOC A;  3ZTG A;  5TAB A;  5SVY A;  4R7E A;  2VJE A;  4F1P A;  5LKZ A;  1LDK C;  4XI1 A;  2KRE A;  2LV9 A;  2XB1 A;  2E6S A;  2L0B A;  2PNX A;  2H0D A;  2MD7 B;  3E2D A;  2KGI A;  2LGG A;  2IQJ A;  2M3H A;  4TKP B;  1RMD A;  5C13 A;  4I7B A;  3VK6 A;  2YVR A;  2MUM A;  1Z2Q A;  2XOC A;  2ECI A;  5G05 B;  2RSD A;  4AYC A;  3N9M A;  5SVI B;  2YYR A;  3EB5 A;  2JUN A;  2LGV A;  2ZET C;  2C2V S;  4QQ4 A;  2G6Q A;  5B75 A;  4YAX A;  4V3K C;  1Z6U A;  2YW8 A;  4IC3 A;  2LGK A;  3T7L A;  3C5K A;  4ZQL A;  3M62 A;  2MIQ A;  3O34 A;  2F6N A;  1WEQ A;  4IC2 A;  4L58 A;  3ZYQ A;  1MBM A;  5KH9 A;  2EOD A;  5LKT A;  2UZG A;  4A4C A;  5K3Q A;  2LDR A;  3N9L A;  3ZNI A;  4FIP A;  5FEY A;  3M7K A;  1MM2 A;  4F52 B;  3FJU B;  3N9Q A;  1CHC A;  2M13 A;  3V43 A;  3LQH A;  1WIL A;  3GV4 A;  2YU4 A;  2L7P A;  2LN0 A;  2RR4 A;  4O64 A;  3L11 A;  4FJC A;  3HCS A;  5TBN A;  4L7X A;  5KH7 A;  5G04 B;  2YRE A;  2K16 A;  2M6M A;  1T1H A;  3L1X A;  5JG6 A;  1JM7 A;  2EA6 A;  2ECG A;  3FEH A;  4UP5 A;  4P5O B;  2OXQ C;  2KU3 A;  1N87 A;  1FBV A;  3SUB A;  2YT5 A;  5B8D A;  5FB1 A;  5TDW A;  2CKL B;  4MVT A;  3O36 A;  2FFW A;  2Y1M A;  3T6R A;  4BHW A;  2JRJ A;  2VPB A;  1DCQ A;  1WEM A;  2KWN A;  4PTB A;  3LQJ A;  2MT5 A;  2PUY A;  2P57 A;  2Y43 A;  4UP0 A;  3PUQ A;  4WA6 A;  3PHD A;  2CSV A;  4YC9 A;  4C9Z A;  5SVI A;  2LGL A;  2CT2 A;  2VPG A;  1U6G B;  3DWD A;  3MHS A;  5D1K B;  4LK9 A;  3ZPV E;  4YAB A;  5LKX A;  1VYX A;  5KH3 A;  3NG2 A;  4WZ0 A;  2MNZ A;  1WE9 A;  2VJF B;  5B78 A;  4N4F A;  2MA6 A;  2CRR A;  3M63 A;  4O62 A;  3KNV A;  4GNE A;  5LKU A;  1K2F A;  2BAY A;  2EXU A;  3FL2 A;  2VPD A;  3LJU X;  2MD8 C;  2KE1 A;  4A0C D;  4GNF A;  1WES A;  1BOR A;  1X4U A;  4QF2 A;  5B77 A;  4MSX A;  5AIU A;  4YBM A;  2KWK A;  4YBS A;  1X4I A;  2H0D B;  5I3L A;  4AUQ B;  2M1R A;  3HCT A;  2C2L A;  2KKY A;  4LKA A;  2YQM A;  2EGP A;  3LVQ E;  3KV6 A;  4FK5 A;  2DX8 A;  2RI7 A;  2YUC A;  2XP0 A;  5D1L B;  1WEU A;  5FER A;  1G25 A;  2HYE D;  5G0F A;  4N3W A;  3DPL R;  2XOY A;  1IYM A;  2CRW A;  2CSZ A;  4A4B A;  2CON A;  5DKA A;  5TRB A;  2M85 A;  4S3O B;  5H1V A;  4W4U A;  4GND A;  4Z0O A;  4H9D A;  3U5N A;  2AN6 A;  3ZPV 1;  2YHN A;  4I7C A;  3U5M A;  1F62 A;  2LXP C;  3LDY A;  1WEO A;  2E61 A;  5B79 A;  1HYI A;  1WEV A;  3LVR E;  5EYA F;  2ECW A;  1ZBD B;  2MNY A;  2ECJ A;  2QIZ A; 
#chains in the Genus database with same CATH homology
 2JMJ A;  1XWH A;  2L5U A;  4YAT A;  3SHB A;  3DQV R;  2YUR A;  3SOX A;  1VD4 A;  4GNG A;  4YBT A;  4Q6F A;  3MHH A;  3N9O A;  2G45 A;  4GB0 A;  4V3L C;  1WEW A;  2F6J A;  3L1Z B;  3GL6 A;  3N9N A;  3RTR B;  2JMD A;  2KFT A;  3RPG C;  1JM7 B;  3SOW A;  2KGG A;  5H1U A;  2CSY A;  3ZVZ B;  1WEN A;  4X3G A;  2L75 A;  2LQ6 A;  4I7D A;  5DIN A;  5TDR A;  3SOU A;  2JMI A;  1FP0 A;  2LXH C;  4A49 A;  2L80 A;  2LRI C;  1E4U A;  3KV5 A;  3RPG B;  4B86 C;  4WZ2 A;  5C11 A;  2E6R A;  3O70 A;  1X4J A;  4LAD B;  2MA5 A;  5J3X A;  1V87 A;  3O37 A;  3QZV A;  2VJE B;  4ZDT A;  5H1T A;  3O7A A;  2K1J A;  1WGM A;  2FUU A;  2KWO A;  2QJ0 A;  2VPE A;  3LRQ A;  4UI9 B;  1VFY A;  2QIC A;  3N9P A;  3C6W A;  2KWJ A;  3U5O A;  3ZVY A;  4S3O C;  4AYC B;  4AP4 A;  4BBQ A;  3PUR A;  2IDA A;  3KQI A;  4LJN A;  2I50 A;  3HTK C;  2ECT A;  2FUI A;  1LDJ B;  2G43 A;  5FB0 A;  1Z60 A;  4NN2 A;  3I2D A;  3O35 A;  1HYJ A;  4R8P K;  2ECN A;  4WZ3 B;  2ECV A;  5LCW B;  4B7Y C;  1WEE A;  2CKL A;  1WIM A;  2HDP A;  2Y1N A;  1DVP A;  4R2Y A;  2VP7 A;  5D1M B;  5H9M A;  4CA1 A;  2XEU A;  2F42 A;  4CCG X;  3ASL A;  2VNF A;  2YHO A;  4AVX A;  1WEP A;  4LLB A;  2NAA A;  2KYU A;  4PPE A;  2K4D A;  4ZUX U;  3U5P A;  3EB6 A;  2YSM A;  3M99 A;  2VJF A;  2YSJ A;  3IHP A;  4YAD A;  2KIZ A;  1WFK A;  5B76 A;  1MM3 A;  5AIT A;  3O33 A;  2YQL A;  2D8S A;  4FO9 A;  4QF3 A;  2KR4 A;  2FSA A;  3HCU A;  2L43 A;  2K17 A;  3LQI A;  1JOC A;  3ZTG A;  5TAB A;  4R7E A;  2VJE A;  5LKZ A;  1LDK C;  4XI1 A;  2KRE A;  2LV9 A;  2XB1 A;  2E6S A;  2L0B A;  2PNX A;  2H0D A;  2MD7 B;  2KGI A;  2LGG A;  2M3H A;  4TKP B;  1RMD A;  5C13 A;  4I7B A;  3VK6 A;  2MUM A;  1Z2Q A;  2ECI A;  5G05 B;  2RSD A;  4AYC A;  3N9M A;  2YYR A;  3EB5 A;  2LGV A;  2ZET C;  2C2V S;  2G6Q A;  5B75 A;  4YAX A;  4V3K C;  1Z6U A;  2YW8 A;  4IC3 A;  2LGK A;  3T7L A;  3C5K A;  4ZQL A;  3M62 A;  2MIQ A;  3O34 A;  2F6N A;  1WEQ A;  4IC2 A;  4L58 A;  3ZYQ A;  5KH9 A;  2EOD A;  5LKT A;  2UZG A;  4A4C A;  2LDR A;  3N9L A;  3ZNI A;  4FIP A;  5FEY A;  1MM2 A;  4F52 B;  3N9Q A;  1CHC A;  3V43 A;  3LQH A;  1WIL A;  3GV4 A;  2YU4 A;  2LN0 A;  4O64 A;  3L11 A;  4FJC A;  3HCS A;  5TBN A;  4L7X A;  5KH7 A;  5G04 B;  2YRE A;  2K16 A;  2M6M A;  1T1H A;  3L1X A;  5JG6 A;  1JM7 A;  2EA6 A;  2ECG A;  4UP5 A;  4P5O B;  2OXQ C;  2KU3 A;  1N87 A;  1FBV A;  2YT5 A;  5B8D A;  5FB1 A;  5TDW A;  2CKL B;  4MVT A;  3O36 A;  2Y1M A;  3T6R A;  4BHW A;  2JRJ A;  2VPB A;  1WEM A;  2KWN A;  4PTB A;  3LQJ A;  2MT5 A;  2PUY A;  2Y43 A;  4UP0 A;  3PUQ A;  4WA6 A;  3PHD A;  4YC9 A;  4C9Z A;  2LGL A;  2CT2 A;  2VPG A;  1U6G B;  3MHS A;  5D1K B;  4LK9 A;  3ZPV E;  4YAB A;  5LKX A;  1VYX A;  5KH3 A;  3NG2 A;  4WZ0 A;  2MNZ A;  1WE9 A;  2VJF B;  5B78 A;  4N4F A;  2MA6 A;  3M63 A;  3KNV A;  4GNE A;  5LKU A;  1K2F A;  2BAY A;  3FL2 A;  2VPD A;  2MD8 C;  2KE1 A;  4A0C D;  4GNF A;  1WES A;  1BOR A;  1X4U A;  4QF2 A;  5B77 A;  4MSX A;  5AIU A;  4YBM A;  2KWK A;  4YBS A;  1X4I A;  2H0D B;  5I3L A;  4AUQ B;  2M1R A;  3HCT A;  2C2L A;  4LKA A;  2YQM A;  2EGP A;  3KV6 A;  4FK5 A;  2DX8 A;  2RI7 A;  2YUC A;  5D1L B;  1WEU A;  5FER A;  1G25 A;  2HYE D;  5G0F A;  4N3W A;  3DPL R;  1IYM A;  2CSZ A;  4A4B A;  5DKA A;  5TRB A;  2M85 A;  4S3O B;  5H1V A;  4W4U A;  4GND A;  3U5N A;  2AN6 A;  3ZPV 1;  2YHN A;  4I7C A;  3U5M A;  1F62 A;  2LXP C;  1WEO A;  5B79 A;  1HYI A;  1WEV A;  5EYA F;  2ECW A;  1ZBD B;  2MNY A;  2ECJ A;  2QIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...