2LV9A

Solution nmr structure of the phd domain of human mll5, northeast structural genomics consortium target hr6512a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
SEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase MLL5
publication title NMR solution structure of the human MLL5 PHD domain (CASP Target)
rcsb
source organism Homo sapiens
total genus 17
structure length 80
sequence length 80
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lv9A00
3KV5A 4C9ZA 3HCSA 5EYAF 1WIMA 2G43A 2C2VS 4FJCA 1RMDA 5B8DA 3RPGB 1WESA 2LXHC 2Y1NA 4LADB 2KU3A 2KYUA 4LLBA 2YREA 5H1VA 1VFYA 4R7EA 2CSZA 4WA6A 5TDWA 2PUYA 5KH3A 3L11A 3O7AA 3O35A 2JRJA 4LK9A 4B86C 2LRIC 2JMJA 2VJEB 5H9MA 4MSXA 5FB0A 4I7BA 2YHNA 4Q6FA 2KWJA 2LGLA 2QICA 1WEPA 2KREA 2VJFB 2YQLA 1WILA 3SOXA 4YABA 5LKUA 3M62A 5D1LB 2VNFA 2OXQC 5B76A 2LV9A 4PTBA 5TRBA 3ZYQA 3KNVA 2L0BA 4YBTA 2MNYA 5H1TA 5J3XA 2LGGA 4GNEA 5I3LA 4AVXA 2QJ0A 2L43A 2YQMA 4NN2A 4GNFA 4XI1A 1X4JA 2AN6A 4L7XA 5LKXA 2LDRA 5LKTA 2XB1A 2MUMA 1X4UA 2RI7A 1WEQA 5B75A 1Z2QA 2ECIA 3O33A 2VJEA 2E6SA 4L58A 2ECWA 2L75A 5B78A 1WEVA 2KWNA 4AP4A 2VJFA 3FL2A 2G6QA 3IHPA 3N9NA 4B7YC 3N9LA 2BAYA 3O37A 5KH7A 2YSJA 4W4UA 3N9OA 2KIZA 2MA5A 1WEMA 3SOWA 5AIUA 3RTRB 4S3OC 4AYCB 1K2FA 2KGIA 3T7LA 3LRQA 2F6JA 2LGVA 3ZPVE 5TABA 2CT2A 4WZ0A 3O36A 4FK5A 3I2DA 3ZNIA 4N4FA 3O70A 3M99A 1LDJB 2VPDA 5LCWB 1WFKA 4MVTA 3ZPV1 2ECJA 4QF3A 1WEOA 4LKAA 2E6RA 2YW8A 2YU4A 1F62A 3SHBA 4BBQA 4IC2A 2Y1MA 2L5UA 1WGMA 3L1ZB 3N9MA 3QZVA 3V43A 3LQJA 1WEEA 2HYED 4ZQLA 2KFTA 4QF2A 2MD8C 4R2YA 4FO9A 3MHHA 3N9QA 4IC3A 3ZTGA 2LGKA 4YADA 4O64A 1MM2A 5C11A 4FIPA 4V3KC 2KGGA 5G0FA 2G45A 4AYCA 4PPEA 1HYJA 1ZBDB 2EODA 2IDAA 2MD7B 2C2LA 3L1XA 2K17A 4GNDA 1E4UA 4YC9A 2RSDA 5TBNA 5D1KB 2EA6A 2JMDA 4S3OB 2FSAA 2D8SA 3M63A 2H0DB 5H1UA 3C5KA 2VPBA 1FP0A 2M3HA 3C6WA 3KQIA 2YURA 2ECVA 3ASLA 5FEYA 2LQ6A 4A4CA 4YBSA 1X4IA 5AITA 2M85A 4AUQB 5B79A 2F42A 5DKAA 2EGPA 2L80A 3EB6A 2M6MA 2KE1A 2VPGA 3PUQA 3HCUA 5JG6A 3N9PA 4R8PK 1Z6UA 4WZ3B 3U5OA 3HCTA 4V3LC 2FUUA 1WEUA 2QIZA 4TKPB 2YHOA 2MA6A 1WEWA 2VP7A 4UI9B 2MIQA 2Y43A 2K1JA 2NAAA 2H0DA 2FUIA 1V87A 3U5MA 5LKZA 2MNZA 2YYRA 2KWOA 4P5OB 4YATA 3KV6A 2K4DA 3GL6A 4N3WA 2CSYA 2VPEA 3GV4A 1JM7B 4A0CD 1U6GB 2CKLB 3ZVZB 4A4BA 4CCGX 2M1RA 1MM3A 2KR4A 2XEUA 1T1HA 1JOCA 3HTKC 2ECNA 3SOUA 2KWKA 4YBMA 2ZETC 3LQIA 3EB5A 4A49A 1N87A 1IYMA 3LQHA 4GNGA 5D1MB 4X3GA 3ZVYA 4CA1A 3T6RA 3RPGC 2YUCA 2JMIA 4ZUXU 3U5NA 2I50A 1VD4A 2DX8A 2YSMA 5KH9A 4YAXA 4UP0A 5DINA 1WE9A 4ZDTA 3DPLR 2ECTA 1VYXA 5C13A 2K16A 1BORA 4I7DA 3U5PA 1HYIA 2LN0A 4UP5A 1JM7A 3NG2A 1G25A 2CKLA 3VK6A 4LJNA 4BHWA 3PHDA 2UZGA 5FERA 3O34A 1LDKC 2MT5A 3PURA 2PNXA 4WZ2A 1XWHA 3DQVR 1DVPA 5B77A 2F6NA 1Z60A 4GB0A 4I7CA 2HDPA 5G05B 5FB1A 5TDRA 2ECGA 5G04B 1FBVA 1WENA 3MHSA 2LXPC 1CHCA 4F52B 2YT5A
chains in the Genus database with same CATH superfamily
3KV5A 4C9ZA 3HCSA 5EYAF 3LDYA 1WIMA 2G43A 2C2VS 4FJCA 1RMDA 5B8DA 3RPGB 1WESA 2DJAA 2LXHC 2Y1NA 2P57A 4LADB 2KU3A 2KYUA 4LLBA 2YREA 5H1VA 1VFYA 4R7EA 2CSZA 4WA6A 5TDWA 2PUYA 5KH3A 2CRWA 3L11A 3O7AA 3O35A 3O47A 2JRJA 4LK9A 4B86C 3LJUX 2LRIC 2JMJA 2VJEB 5H9MA 2CRRA 4MSXA 3SUBA 5FB0A 2E61A 4I7BA 2YHNA 4Q6FA 2KWJA 2LGLA 2QICA 2EGMA 1WEPA 2KREA 2VJFB 5SVXA 2YQLA 1WILA 3SOXA 4YABA 5LKUA 3M62A 2B0OE 5D1LB 2KKXA 2VNFA 2OXQC 5B76A 2LV9A 4PTBA 5TRBA 2JUNA 3ZYQA 3KNVA 3PLWA 2L0BA 4YBTA 2MNYA 5H1TA 5J3XA 2FD4A 3FEHA 2LGGA 4GNEA 5I3LA 4AVXA 2QJ0A 2L43A 3MDBC 2FFWA 2MKEA 2YQMA 4NN2A 4GNFA 4XI1A 1X4JA 2KKYA 2AN6A 4L7XA 5LKXA 2CONA 2LDRA 5LKTA 2XB1A 2MUMA 2LAUA 1X4UA 2RI7A 1WEQA 5B75A 1Z2QA 2ECIA 3O33A 2VJEA 2XOCA 2E6SA 4L58A 2ECWA 2L75A 5B78A 1WEVA 2KWNA 4AP4A 3FM8C 2VJFA 3FL2A 4H9DA 2G6QA 3IHPA 3N9NA 4B7YC 3N9LA 2BAYA 3O37A 5KH7A 2YSJA 4W4UA 3N9OA 2KIZA 2MA5A 2L7PA 1WEMA 3SOWA 5AIUA 3RTRB 5SVYA 4S3OC 4AYCB 1K2FA 2KGIA 3T7LA 3LRQA 2F6JA 2LGVA 3ZPVE 5SVIB 5TABA 2CT2A 4WZ0A 3O36A 2IQJA 3I2DA 4FK5A 3ZNIA 4N4FA 3O70A 3M99A 1LDJB 1MBMA 2VPDA 5LCWB 1WFKA 4MVTA 3ZPV1 2ECJA 4QF3A 1WEOA 4LKAA 2E6RA 2YW8A 2YU4A 1F62A 3SHBA 2XP0A 4BBQA 4IC2A 2Y1MA 2L5UA 1WGMA 3L1ZB 4OGEA 3N9MA 3QZVA 3V43A 3LQJA 1WEEA 2HYED 4ZQLA 2KFTA 4QF2A 4R2YA 2MD8C 4FO9A 3DWDA 3MHHA 3N9QA 4IC3A 3ZTGA 2LGKA 2RR4A 4YADA 4O64A 1MM2A 5C11A 4FIPA 4V3KC 2KGGA 5G0FA 2G45A 4AYCA 4PPEA 1HYJA 2EXUA 1ZBDB 2EODA 2IDAA 2MD7B 2YVRA 2C2LA 3L1XA 2K17A 4GNDA 1E4UA 4YC9A 1DCQA 2RSDA 2CSVA 5SVIA 5TBNA 5D1KB 2EA6A 2JMDA 4S3OB 2FSAA 2D8SA 3M63A 2H0DB 5H1UA 3C5KA 2VPBA 1FP0A 2M3HA 3C6WA 3KQIA 2YURA 2ECVA 3E2DA 2XOYA 3ASLA 5FEYA 2LQ6A 4A4CA 4YBSA 1X4IA 5AITA 4Z0OA 2M85A 4O62A 4AUQB 5B79A 2F42A 5DKAA 2EGPA 2L80A 3EB6A 2M6MA 2KE1A 2VPGA 3PUQA 3Q1DA 3HCUA 2JM3A 5JG6A 3N9PA 3LVQE 1Z6UA 4R8PK 4WZ3B 3U5OA 3HCTA 4V3LC 2FUUA 1WEUA 2QIZA 4TKPB 2OWAA 2YHOA 2MA6A 1WEWA 2VP7A 4UI9B 2DSMA 2MIQA 2Y43A 2K1JA 2NAAA 2H0DA 2FUIA 1V87A 3U5MA 5K3QA 5LKZA 2MNZA 2YYRA 2KWOA 4P5OB 4YATA 3KV6A 2K4DA 3GL6A 4N3WA 2CSYA 2VPEA 3GV4A 1JM7B 4A0CD 1U6GB 2D8UA 2CKLB 3ZVZB 4A4BA 4CCGX 3LVRE 3DDTA 4F1PA 2M1RA 1MM3A 3M7KA 2XOZA 3FJUB 2KR4A 2XEUA 1T1HA 1JOCA 3HTKC 3KDEC 2ECNA 3SOUA 2KWKA 4Z0RA 4YBMA 2ZETC 3LQIA 3EB5A 4A49A 1N87A 1IYMA 3LQHA 4GNGA 5D1MB 4OGCA 4X3GA 3ZVYA 4CA1A 3FAOA 3RPGC 2YUCA 2JMIA 3T6RA 4ZUXU 3H7HA 3U5NA 3FANA 2I50A 1VD4A 2DX8A 2YSMA 5KH9A 4YAXA 4UP0A 5DINA 1WE9A 4ZDTA 3DPLR 2ECTA 2M13A 1VYXA 5C13A 2K16A 1BORA 4I7DA 3U5PA 1HYIA 2LN0A 4UP5A 1JM7A 3NG2A 1G25A 2CKLA 3VK6A 4LJNA 4BHWA 3PHDA 2UZGA 5FERA 4QQ4A 3O34A 1LDKC 2MT5A 3PURA 2PNXA 4WZ2A 1XWHA 3DQVR 1DVPA 5B77A 2F6NA 1Z60A 4GB0A 4I7CA 2HDPA 3JUEA 5G05B 5FB1A 5TDRA 2ECGA 5G04B 1FBVA 1WENA 3MHSA 3T9KA 2LXPC 1CHCA 4F52B 2YT5A
chains in the Genus database with same CATH topology
3KV5A 4C9ZA 3HCSA 5EYAF 1WIMA 2G43A 2C2VS 4FJCA 1RMDA 5B8DA 3RPGB 1WESA 2LXHC 2Y1NA 4LADB 2KU3A 2KYUA 4LLBA 2YREA 5H1VA 1VFYA 4R7EA 2CSZA 4WA6A 5TDWA 2PUYA 5KH3A 3L11A 3O7AA 3O35A 2JRJA 4LK9A 4B86C 2LRIC 2JMJA 2VJEB 5H9MA 4MSXA 5FB0A 4I7BA 2YHNA 4Q6FA 2KWJA 2LGLA 2QICA 1WEPA 2KREA 2VJFB 2YQLA 1WILA 3SOXA 4YABA 5LKUA 3M62A 5D1LB 2VNFA 2OXQC 5B76A 2LV9A 4PTBA 5TRBA 3ZYQA 3KNVA 2L0BA 4YBTA 2MNYA 5H1TA 5J3XA 2LGGA 4GNEA 5I3LA 4AVXA 2QJ0A 2L43A 2YQMA 4NN2A 4GNFA 4XI1A 1X4JA 2AN6A 4L7XA 5LKXA 2LDRA 5LKTA 2XB1A 2MUMA 1X4UA 2RI7A 1WEQA 5B75A 1Z2QA 2ECIA 3O33A 2VJEA 2E6SA 4L58A 2ECWA 2L75A 5B78A 1WEVA 2KWNA 4AP4A 2VJFA 3FL2A 2G6QA 3IHPA 3N9NA 4B7YC 3N9LA 2BAYA 3O37A 5KH7A 2YSJA 4W4UA 3N9OA 2KIZA 2MA5A 1WEMA 3SOWA 5AIUA 3RTRB 4S3OC 4AYCB 1K2FA 2KGIA 3T7LA 3LRQA 2F6JA 2LGVA 3ZPVE 5TABA 2CT2A 4WZ0A 3O36A 4FK5A 3I2DA 3ZNIA 4N4FA 3O70A 3M99A 1LDJB 2VPDA 5LCWB 1WFKA 4MVTA 3ZPV1 2ECJA 4QF3A 1WEOA 4LKAA 2E6RA 2YW8A 2YU4A 1F62A 3SHBA 4BBQA 4IC2A 2Y1MA 2L5UA 1WGMA 3L1ZB 3N9MA 3QZVA 3V43A 3LQJA 1WEEA 2HYED 4ZQLA 2KFTA 4QF2A 2MD8C 4R2YA 4FO9A 3MHHA 3N9QA 4IC3A 3ZTGA 2LGKA 4YADA 4O64A 1MM2A 5C11A 4FIPA 4V3KC 2KGGA 5G0FA 2G45A 4AYCA 4PPEA 1HYJA 1ZBDB 2EODA 2IDAA 2MD7B 2C2LA 3L1XA 2K17A 4GNDA 1E4UA 4YC9A 2RSDA 5TBNA 5D1KB 2EA6A 2JMDA 4S3OB 2FSAA 2D8SA 3M63A 2H0DB 5H1UA 3C5KA 2VPBA 1FP0A 2M3HA 3C6WA 3KQIA 2YURA 2ECVA 3ASLA 5FEYA 2LQ6A 4A4CA 4YBSA 1X4IA 5AITA 2M85A 4AUQB 5B79A 2F42A 5DKAA 2EGPA 2L80A 3EB6A 2M6MA 2KE1A 2VPGA 3PUQA 3HCUA 5JG6A 3N9PA 4R8PK 1Z6UA 4WZ3B 3U5OA 3HCTA 4V3LC 2FUUA 1WEUA 2QIZA 4TKPB 2YHOA 2MA6A 1WEWA 2VP7A 4UI9B 2MIQA 2Y43A 2K1JA 2NAAA 2H0DA 2FUIA 1V87A 3U5MA 5LKZA 2MNZA 2YYRA 2KWOA 4P5OB 4YATA 3KV6A 2K4DA 3GL6A 4N3WA 2CSYA 2VPEA 3GV4A 1JM7B 4A0CD 1U6GB 2CKLB 3ZVZB 4A4BA 4CCGX 2M1RA 1MM3A 2KR4A 2XEUA 1T1HA 1JOCA 3HTKC 2ECNA 3SOUA 2KWKA 4YBMA 2ZETC 3LQIA 3EB5A 4A49A 1N87A 1IYMA 3LQHA 4GNGA 5D1MB 4X3GA 3ZVYA 4CA1A 3T6RA 3RPGC 2YUCA 2JMIA 4ZUXU 3U5NA 2I50A 1VD4A 2DX8A 2YSMA 5KH9A 4YAXA 4UP0A 5DINA 1WE9A 4ZDTA 3DPLR 2ECTA 1VYXA 5C13A 2K16A 1BORA 4I7DA 3U5PA 1HYIA 2LN0A 4UP5A 1JM7A 3NG2A 1G25A 2CKLA 3VK6A 4LJNA 4BHWA 3PHDA 2UZGA 5FERA 3O34A 1LDKC 2MT5A 3PURA 2PNXA 4WZ2A 1XWHA 3DQVR 1DVPA 5B77A 2F6NA 1Z60A 4GB0A 4I7CA 2HDPA 5G05B 5FB1A 5TDRA 2ECGA 5G04B 1FBVA 1WENA 3MHSA 2LXPC 1CHCA 4F52B 2YT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV5 A;  4C9Z A;  3HCS A;  5EYA F;  1WIM A;  2G43 A;  2C2V S;  4FJC A;  1RMD A;  5B8D A;  3RPG B;  1WES A;  2LXH C;  2Y1N A;  4LAD B;  2KU3 A;  2KYU A;  4LLB A;  2YRE A;  5H1V A;  1VFY A;  4R7E A;  2CSZ A;  4WA6 A;  5TDW A;  2PUY A;  5KH3 A;  3L11 A;  3O7A A;  3O35 A;  2JRJ A;  4LK9 A;  4B86 C;  2LRI C;  2JMJ A;  2VJE B;  5H9M A;  4MSX A;  5FB0 A;  4I7B A;  2YHN A;  4Q6F A;  2KWJ A;  2LGL A;  2QIC A;  1WEP A;  2KRE A;  2VJF B;  2YQL A;  1WIL A;  3SOX A;  4YAB A;  5LKU A;  3M62 A;  5D1L B;  2VNF A;  2OXQ C;  5B76 A;  2LV9 A;  4PTB A;  5TRB A;  3ZYQ A;  3KNV A;  2L0B A;  4YBT A;  2MNY A;  5H1T A;  5J3X A;  2LGG A;  4GNE A;  5I3L A;  4AVX A;  2QJ0 A;  2L43 A;  2YQM A;  4NN2 A;  4GNF A;  4XI1 A;  1X4J A;  2AN6 A;  4L7X A;  5LKX A;  2LDR A;  5LKT A;  2XB1 A;  2MUM A;  1X4U A;  2RI7 A;  1WEQ A;  5B75 A;  1Z2Q A;  2ECI A;  3O33 A;  2VJE A;  2E6S A;  4L58 A;  2ECW A;  2L75 A;  5B78 A;  1WEV A;  2KWN A;  4AP4 A;  2VJF A;  3FL2 A;  2G6Q A;  3IHP A;  3N9N A;  4B7Y C;  3N9L A;  2BAY A;  3O37 A;  5KH7 A;  2YSJ A;  4W4U A;  3N9O A;  2KIZ A;  2MA5 A;  1WEM A;  3SOW A;  5AIU A;  3RTR B;  4S3O C;  4AYC B;  1K2F A;  2KGI A;  3T7L A;  3LRQ A;  2F6J A;  2LGV A;  3ZPV E;  5TAB A;  2CT2 A;  4WZ0 A;  3O36 A;  4FK5 A;  3I2D A;  3ZNI A;  4N4F A;  3O70 A;  3M99 A;  1LDJ B;  2VPD A;  5LCW B;  1WFK A;  4MVT A;  3ZPV 1;  2ECJ A;  4QF3 A;  1WEO A;  4LKA A;  2E6R A;  2YW8 A;  2YU4 A;  1F62 A;  3SHB A;  4BBQ A;  4IC2 A;  2Y1M A;  2L5U A;  1WGM A;  3L1Z B;  3N9M A;  3QZV A;  3V43 A;  3LQJ A;  1WEE A;  2HYE D;  4ZQL A;  2KFT A;  4QF2 A;  2MD8 C;  4R2Y A;  4FO9 A;  3MHH A;  3N9Q A;  4IC3 A;  3ZTG A;  2LGK A;  4YAD A;  4O64 A;  1MM2 A;  5C11 A;  4FIP A;  4V3K C;  2KGG A;  5G0F A;  2G45 A;  4AYC A;  4PPE A;  1HYJ A;  1ZBD B;  2EOD A;  2IDA A;  2MD7 B;  2C2L A;  3L1X A;  2K17 A;  4GND A;  1E4U A;  4YC9 A;  2RSD A;  5TBN A;  5D1K B;  2EA6 A;  2JMD A;  4S3O B;  2FSA A;  2D8S A;  3M63 A;  2H0D B;  5H1U A;  3C5K A;  2VPB A;  1FP0 A;  2M3H A;  3C6W A;  3KQI A;  2YUR A;  2ECV A;  3ASL A;  5FEY A;  2LQ6 A;  4A4C A;  4YBS A;  1X4I A;  5AIT A;  2M85 A;  4AUQ B;  5B79 A;  2F42 A;  5DKA A;  2EGP A;  2L80 A;  3EB6 A;  2M6M A;  2KE1 A;  2VPG A;  3PUQ A;  3HCU A;  5JG6 A;  3N9P A;  4R8P K;  1Z6U A;  4WZ3 B;  3U5O A;  3HCT A;  4V3L C;  2FUU A;  1WEU A;  2QIZ A;  4TKP B;  2YHO A;  2MA6 A;  1WEW A;  2VP7 A;  4UI9 B;  2MIQ A;  2Y43 A;  2K1J A;  2NAA A;  2H0D A;  2FUI A;  1V87 A;  3U5M A;  5LKZ A;  2MNZ A;  2YYR A;  2KWO A;  4P5O B;  4YAT A;  3KV6 A;  2K4D A;  3GL6 A;  4N3W A;  2CSY A;  2VPE A;  3GV4 A;  1JM7 B;  4A0C D;  1U6G B;  2CKL B;  3ZVZ B;  4A4B A;  4CCG X;  2M1R A;  1MM3 A;  2KR4 A;  2XEU A;  1T1H A;  1JOC A;  3HTK C;  2ECN A;  3SOU A;  2KWK A;  4YBM A;  2ZET C;  3LQI A;  3EB5 A;  4A49 A;  1N87 A;  1IYM A;  3LQH A;  4GNG A;  5D1M B;  4X3G A;  3ZVY A;  4CA1 A;  3T6R A;  3RPG C;  2YUC A;  2JMI A;  4ZUX U;  3U5N A;  2I50 A;  1VD4 A;  2DX8 A;  2YSM A;  5KH9 A;  4YAX A;  4UP0 A;  5DIN A;  1WE9 A;  4ZDT A;  3DPL R;  2ECT A;  1VYX A;  5C13 A;  2K16 A;  1BOR A;  4I7D A;  3U5P A;  1HYI A;  2LN0 A;  4UP5 A;  1JM7 A;  3NG2 A;  1G25 A;  2CKL A;  3VK6 A;  4LJN A;  4BHW A;  3PHD A;  2UZG A;  5FER A;  3O34 A;  1LDK C;  2MT5 A;  3PUR A;  2PNX A;  4WZ2 A;  1XWH A;  3DQV R;  1DVP A;  5B77 A;  2F6N A;  1Z60 A;  4GB0 A;  4I7C A;  2HDP A;  5G05 B;  5FB1 A;  5TDR A;  2ECG A;  5G04 B;  1FBV A;  1WEN A;  3MHS A;  2LXP C;  1CHC A;  4F52 B;  2YT5 A; 
#chains in the Genus database with same CATH topology
 3KV5 A;  4C9Z A;  3HCS A;  5EYA F;  3LDY A;  1WIM A;  2G43 A;  2C2V S;  4FJC A;  1RMD A;  5B8D A;  3RPG B;  1WES A;  2DJA A;  2LXH C;  2Y1N A;  2P57 A;  4LAD B;  2KU3 A;  2KYU A;  4LLB A;  2YRE A;  5H1V A;  1VFY A;  4R7E A;  2CSZ A;  4WA6 A;  5TDW A;  2PUY A;  5KH3 A;  2CRW A;  3L11 A;  3O7A A;  3O35 A;  3O47 A;  2JRJ A;  4LK9 A;  4B86 C;  3LJU X;  2LRI C;  2JMJ A;  2VJE B;  5H9M A;  2CRR A;  4MSX A;  3SUB A;  5FB0 A;  2E61 A;  4I7B A;  2YHN A;  4Q6F A;  2KWJ A;  2LGL A;  2QIC A;  2EGM A;  1WEP A;  2KRE A;  2VJF B;  5SVX A;  2YQL A;  1WIL A;  3SOX A;  4YAB A;  5LKU A;  3M62 A;  2B0O E;  5D1L B;  2KKX A;  2VNF A;  2OXQ C;  5B76 A;  2LV9 A;  4PTB A;  5TRB A;  2JUN A;  3ZYQ A;  3KNV A;  3PLW A;  2L0B A;  4YBT A;  2MNY A;  5H1T A;  5J3X A;  2FD4 A;  3FEH A;  2LGG A;  4GNE A;  5I3L A;  4AVX A;  2QJ0 A;  2L43 A;  3MDB C;  2FFW A;  2MKE A;  2YQM A;  4NN2 A;  4GNF A;  4XI1 A;  1X4J A;  2KKY A;  2AN6 A;  4L7X A;  5LKX A;  2CON A;  2LDR A;  5LKT A;  2XB1 A;  2MUM A;  2LAU A;  1X4U A;  2RI7 A;  1WEQ A;  5B75 A;  1Z2Q A;  2ECI A;  3O33 A;  2VJE A;  2XOC A;  2E6S A;  4L58 A;  2ECW A;  2L75 A;  5B78 A;  1WEV A;  2KWN A;  4AP4 A;  3FM8 C;  2VJF A;  3FL2 A;  4H9D A;  2G6Q A;  3IHP A;  3N9N A;  4B7Y C;  3N9L A;  2BAY A;  3O37 A;  5KH7 A;  2YSJ A;  4W4U A;  3N9O A;  2KIZ A;  2MA5 A;  2L7P A;  1WEM A;  3SOW A;  5AIU A;  3RTR B;  5SVY A;  4S3O C;  4AYC B;  1K2F A;  2KGI A;  3T7L A;  3LRQ A;  2F6J A;  2LGV A;  3ZPV E;  5SVI B;  5TAB A;  2CT2 A;  4WZ0 A;  3O36 A;  2IQJ A;  3I2D A;  4FK5 A;  3ZNI A;  4N4F A;  3O70 A;  3M99 A;  1LDJ B;  1MBM A;  2VPD A;  5LCW B;  1WFK A;  4MVT A;  3ZPV 1;  2ECJ A;  4QF3 A;  1WEO A;  4LKA A;  2E6R A;  2YW8 A;  2YU4 A;  1F62 A;  3SHB A;  2XP0 A;  4BBQ A;  4IC2 A;  2Y1M A;  2L5U A;  1WGM A;  3L1Z B;  4OGE A;  3N9M A;  3QZV A;  3V43 A;  3LQJ A;  1WEE A;  2HYE D;  4ZQL A;  2KFT A;  4QF2 A;  4R2Y A;  2MD8 C;  4FO9 A;  3DWD A;  3MHH A;  3N9Q A;  4IC3 A;  3ZTG A;  2LGK A;  2RR4 A;  4YAD A;  4O64 A;  1MM2 A;  5C11 A;  4FIP A;  4V3K C;  2KGG A;  5G0F A;  2G45 A;  4AYC A;  4PPE A;  1HYJ A;  2EXU A;  1ZBD B;  2EOD A;  2IDA A;  2MD7 B;  2YVR A;  2C2L A;  3L1X A;  2K17 A;  4GND A;  1E4U A;  4YC9 A;  1DCQ A;  2RSD A;  2CSV A;  5SVI A;  5TBN A;  5D1K B;  2EA6 A;  2JMD A;  4S3O B;  2FSA A;  2D8S A;  3M63 A;  2H0D B;  5H1U A;  3C5K A;  2VPB A;  1FP0 A;  2M3H A;  3C6W A;  3KQI A;  2YUR A;  2ECV A;  3E2D A;  2XOY A;  3ASL A;  5FEY A;  2LQ6 A;  4A4C A;  4YBS A;  1X4I A;  5AIT A;  4Z0O A;  2M85 A;  4O62 A;  4AUQ B;  5B79 A;  2F42 A;  5DKA A;  2EGP A;  2L80 A;  3EB6 A;  2M6M A;  2KE1 A;  2VPG A;  3PUQ A;  3Q1D A;  3HCU A;  2JM3 A;  5JG6 A;  3N9P A;  3LVQ E;  1Z6U A;  4R8P K;  4WZ3 B;  3U5O A;  3HCT A;  4V3L C;  2FUU A;  1WEU A;  2QIZ A;  4TKP B;  2OWA A;  2YHO A;  2MA6 A;  1WEW A;  2VP7 A;  4UI9 B;  2DSM A;  2MIQ A;  2Y43 A;  2K1J A;  2NAA A;  2H0D A;  2FUI A;  1V87 A;  3U5M A;  5K3Q A;  5LKZ A;  2MNZ A;  2YYR A;  2KWO A;  4P5O B;  4YAT A;  3KV6 A;  2K4D A;  3GL6 A;  4N3W A;  2CSY A;  2VPE A;  3GV4 A;  1JM7 B;  4A0C D;  1U6G B;  2D8U A;  2CKL B;  3ZVZ B;  4A4B A;  4CCG X;  3LVR E;  3DDT A;  4F1P A;  2M1R A;  1MM3 A;  3M7K A;  2XOZ A;  3FJU B;  2KR4 A;  2XEU A;  1T1H A;  1JOC A;  3HTK C;  3KDE C;  2ECN A;  3SOU A;  2KWK A;  4Z0R A;  4YBM A;  2ZET C;  3LQI A;  3EB5 A;  4A49 A;  1N87 A;  1IYM A;  3LQH A;  4GNG A;  5D1M B;  4OGC A;  4X3G A;  3ZVY A;  4CA1 A;  3FAO A;  3RPG C;  2YUC A;  2JMI A;  3T6R A;  4ZUX U;  3H7H A;  3U5N A;  3FAN A;  2I50 A;  1VD4 A;  2DX8 A;  2YSM A;  5KH9 A;  4YAX A;  4UP0 A;  5DIN A;  1WE9 A;  4ZDT A;  3DPL R;  2ECT A;  2M13 A;  1VYX A;  5C13 A;  2K16 A;  1BOR A;  4I7D A;  3U5P A;  1HYI A;  2LN0 A;  4UP5 A;  1JM7 A;  3NG2 A;  1G25 A;  2CKL A;  3VK6 A;  4LJN A;  4BHW A;  3PHD A;  2UZG A;  5FER A;  4QQ4 A;  3O34 A;  1LDK C;  2MT5 A;  3PUR A;  2PNX A;  4WZ2 A;  1XWH A;  3DQV R;  1DVP A;  5B77 A;  2F6N A;  1Z60 A;  4GB0 A;  4I7C A;  2HDP A;  3JUE A;  5G05 B;  5FB1 A;  5TDR A;  2ECG A;  5G04 B;  1FBV A;  1WEN A;  3MHS A;  3T9K A;  2LXP C;  1CHC A;  4F52 B;  2YT5 A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  4C9Z A;  3HCS A;  5EYA F;  1WIM A;  2G43 A;  2C2V S;  4FJC A;  1RMD A;  5B8D A;  3RPG B;  1WES A;  2LXH C;  2Y1N A;  4LAD B;  2KU3 A;  2KYU A;  4LLB A;  2YRE A;  5H1V A;  1VFY A;  4R7E A;  2CSZ A;  4WA6 A;  5TDW A;  2PUY A;  5KH3 A;  3L11 A;  3O7A A;  3O35 A;  2JRJ A;  4LK9 A;  4B86 C;  2LRI C;  2JMJ A;  2VJE B;  5H9M A;  4MSX A;  5FB0 A;  4I7B A;  2YHN A;  4Q6F A;  2KWJ A;  2LGL A;  2QIC A;  1WEP A;  2KRE A;  2VJF B;  2YQL A;  1WIL A;  3SOX A;  4YAB A;  5LKU A;  3M62 A;  5D1L B;  2VNF A;  2OXQ C;  5B76 A;  2LV9 A;  4PTB A;  5TRB A;  3ZYQ A;  3KNV A;  2L0B A;  4YBT A;  2MNY A;  5H1T A;  5J3X A;  2LGG A;  4GNE A;  5I3L A;  4AVX A;  2QJ0 A;  2L43 A;  2YQM A;  4NN2 A;  4GNF A;  4XI1 A;  1X4J A;  2AN6 A;  4L7X A;  5LKX A;  2LDR A;  5LKT A;  2XB1 A;  2MUM A;  1X4U A;  2RI7 A;  1WEQ A;  5B75 A;  1Z2Q A;  2ECI A;  3O33 A;  2VJE A;  2E6S A;  4L58 A;  2ECW A;  2L75 A;  5B78 A;  1WEV A;  2KWN A;  4AP4 A;  2VJF A;  3FL2 A;  2G6Q A;  3IHP A;  3N9N A;  4B7Y C;  3N9L A;  2BAY A;  3O37 A;  5KH7 A;  2YSJ A;  4W4U A;  3N9O A;  2KIZ A;  2MA5 A;  1WEM A;  3SOW A;  5AIU A;  3RTR B;  4S3O C;  4AYC B;  1K2F A;  2KGI A;  3T7L A;  3LRQ A;  2F6J A;  2LGV A;  3ZPV E;  5TAB A;  2CT2 A;  4WZ0 A;  3O36 A;  4FK5 A;  3I2D A;  3ZNI A;  4N4F A;  3O70 A;  3M99 A;  1LDJ B;  2VPD A;  5LCW B;  1WFK A;  4MVT A;  3ZPV 1;  2ECJ A;  4QF3 A;  1WEO A;  4LKA A;  2E6R A;  2YW8 A;  2YU4 A;  1F62 A;  3SHB A;  4BBQ A;  4IC2 A;  2Y1M A;  2L5U A;  1WGM A;  3L1Z B;  3N9M A;  3QZV A;  3V43 A;  3LQJ A;  1WEE A;  2HYE D;  4ZQL A;  2KFT A;  4QF2 A;  2MD8 C;  4R2Y A;  4FO9 A;  3MHH A;  3N9Q A;  4IC3 A;  3ZTG A;  2LGK A;  4YAD A;  4O64 A;  1MM2 A;  5C11 A;  4FIP A;  4V3K C;  2KGG A;  5G0F A;  2G45 A;  4AYC A;  4PPE A;  1HYJ A;  1ZBD B;  2EOD A;  2IDA A;  2MD7 B;  2C2L A;  3L1X A;  2K17 A;  4GND A;  1E4U A;  4YC9 A;  2RSD A;  5TBN A;  5D1K B;  2EA6 A;  2JMD A;  4S3O B;  2FSA A;  2D8S A;  3M63 A;  2H0D B;  5H1U A;  3C5K A;  2VPB A;  1FP0 A;  2M3H A;  3C6W A;  3KQI A;  2YUR A;  2ECV A;  3ASL A;  5FEY A;  2LQ6 A;  4A4C A;  4YBS A;  1X4I A;  5AIT A;  2M85 A;  4AUQ B;  5B79 A;  2F42 A;  5DKA A;  2EGP A;  2L80 A;  3EB6 A;  2M6M A;  2KE1 A;  2VPG A;  3PUQ A;  3HCU A;  5JG6 A;  3N9P A;  4R8P K;  1Z6U A;  4WZ3 B;  3U5O A;  3HCT A;  4V3L C;  2FUU A;  1WEU A;  2QIZ A;  4TKP B;  2YHO A;  2MA6 A;  1WEW A;  2VP7 A;  4UI9 B;  2MIQ A;  2Y43 A;  2K1J A;  2NAA A;  2H0D A;  2FUI A;  1V87 A;  3U5M A;  5LKZ A;  2MNZ A;  2YYR A;  2KWO A;  4P5O B;  4YAT A;  3KV6 A;  2K4D A;  3GL6 A;  4N3W A;  2CSY A;  2VPE A;  3GV4 A;  1JM7 B;  4A0C D;  1U6G B;  2CKL B;  3ZVZ B;  4A4B A;  4CCG X;  2M1R A;  1MM3 A;  2KR4 A;  2XEU A;  1T1H A;  1JOC A;  3HTK C;  2ECN A;  3SOU A;  2KWK A;  4YBM A;  2ZET C;  3LQI A;  3EB5 A;  4A49 A;  1N87 A;  1IYM A;  3LQH A;  4GNG A;  5D1M B;  4X3G A;  3ZVY A;  4CA1 A;  3T6R A;  3RPG C;  2YUC A;  2JMI A;  4ZUX U;  3U5N A;  2I50 A;  1VD4 A;  2DX8 A;  2YSM A;  5KH9 A;  4YAX A;  4UP0 A;  5DIN A;  1WE9 A;  4ZDT A;  3DPL R;  2ECT A;  1VYX A;  5C13 A;  2K16 A;  1BOR A;  4I7D A;  3U5P A;  1HYI A;  2LN0 A;  4UP5 A;  1JM7 A;  3NG2 A;  1G25 A;  2CKL A;  3VK6 A;  4LJN A;  4BHW A;  3PHD A;  2UZG A;  5FER A;  3O34 A;  1LDK C;  2MT5 A;  3PUR A;  2PNX A;  4WZ2 A;  1XWH A;  3DQV R;  1DVP A;  5B77 A;  2F6N A;  1Z60 A;  4GB0 A;  4I7C A;  2HDP A;  5G05 B;  5FB1 A;  5TDR A;  2ECG A;  5G04 B;  1FBV A;  1WEN A;  3MHS A;  2LXP C;  1CHC A;  4F52 B;  2YT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...