2LV9A

Solution nmr structure of the phd domain of human mll5, northeast structural genomics consortium target hr6512a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
SEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase MLL5
publication title NMR solution structure of the human MLL5 PHD domain (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 80
sequence length 80
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lv9A00
2KIZA 3SHBA 1WEPA 1X4JA 1WEWA 5I3LA 2E6SA 3ZPVE 4B86C 2ECNA 1DVPA 2KYUA 4ZDTA 3PURA 2MD8C 3N9LA 2CKLB 1WEUA 2KWNA 4YATA 3HTKC 5B76A 2YSMA 3O35A 4AYCB 1VYXA 4O64A 2L43A 4MVTA 2CSZA 3MHHA 4FIPA 2VNFA 4PPEA 2H0DB 1JM7A 3C5KA 2G43A 5TABA 4CA1A 4V3LC 4YBMA 2ECVA 3DQVR 2OXQC 1N87A 2Y1NA 4IC2A 4L58A 4C9ZA 1VFYA 5FB1A 2M85A 2VPEA 4I7DA 2YHOA 4UP0A 2VPDA 3ASLA 4LADB 4FO9A 4NN2A 1WGMA 4A0CD 3KV5A 4A49A 3GV4A 4TKPB 2MA6A 5DKAA 2LXHC 1CHCA 1ZBDB 1Z2QA 1VD4A 1E4UA 3FL2A 3KNVA 3EB5A 4AUQB 4N4FA 3KV6A 5J3XA 2RI7A 5C13A 2VJFA 2C2LA 2KR4A 4LKAA 2G45A 2PNXA 2D8SA 2L0BA 2L5UA 4YBSA 2F6JA 4ZQLA 2VPGA 4IC3A 3L1XA 5FB0A 3ZYQA 3N9PA 3DPLR 1FBVA 4XI1A 2JMIA 2CKLA 2FUIA 4BBQA 4AYCA 5FERA 3HCUA 2M6MA 1X4IA 5LCWB 2M3HA 2F42A 3GL6A 3U5PA 4R7EA 2I50A 4ZUXU 2YHNA 2XB1A 2MNZA 2JRJA 3T6RA 4BHWA 1U6GB 2KGGA 5H1UA 2YW8A 2H0DA 2KREA 3I2DA 2HYED 5KH7A 1WILA 2YQLA 2EA6A 3LQJA 2KFTA 4YBTA 5LKZA 2CSYA 3PUQA 4WZ0A 1MM2A 2G6QA 5B75A 4WZ3B 5TDRA 2KU3A 1WEMA 3O37A 5EYAF 4YABA 5B78A 3L11A 3M62A 3KQIA 4QF2A 2YURA 1K2FA 4QF3A 4WA6A 4FJCA 3RPGB 2L75A 1WIMA 3O70A 4F52B 3T7LA 2YSJA 4PTBA 2F6NA 3O34A 4LJNA 2LRIC 4GNGA 3ZVZB 2Y43A 2VJEB 4W4UA 1WFKA 1WEOA 2NAAA 3RTRB 3SOXA 5G05B 2Y1MA 1WEEA 2HDPA 2ECWA 4YADA 2YT5A 1WENA 1T1HA 4YC9A 1HYIA 1BORA 3N9OA 1JM7B 1X4UA 1MM3A 2C2VS 2XEUA 2LDRA 2FUUA 4R8PK 3NG2A 2ECTA 4A4CA 2LGVA 2ZETC 2ECGA 4GNDA 5JG6A 1Z60A 2MIQA 4V3KC 5DINA 3IHPA 5TBNA 2YQMA 2LV9A 3SOWA 5D1MB 3ZTGA 1WEVA 3PHDA 2AN6A 1RMDA 4S3OB 1WEQA 5KH9A 2BAYA 2EGPA 3MHSA 5FEYA 2DX8A 4AP4A 4YAXA 4UP5A 5B77A 5C11A 5LKUA 5LKTA 5KH3A 3RPGC 2LGGA 2IDAA 4P5OB 2VJFB 2KWJA 3SOUA 2KWKA 1Z6UA 4I7BA 3U5MA 2MT5A 5H1VA 3LQHA 2VPBA 5G0FA 2JMJA 2LXPC 4GB0A 4FK5A 2PUYA 1F62A 2KWOA 3EB6A 4R2YA 4N3WA 5AIUA 4X3GA 2VJEA 2LN0A 3V43A 2LGLA 2YYRA 1IYMA 4Q6FA 2E6RA 4CCGX 5H9MA 3HCTA 3O36A 2MUMA 2UZGA 4MSXA 2MA5A 3M63A 2RSDA 2ECIA 3N9NA 5D1KB 2K1JA 5B8DA 3U5NA 2QIZA 3LQIA 5G04B 3LRQA 1HYJA 4LLBA 2L80A 3O7AA 4S3OC 3M99A 2EODA 1FP0A 2MD7B 5TRBA 4L7XA 2QJ0A 2FSAA 3HCSA 4UI9B 1V87A 2KE1A 2CT2A 2ECJA 4WZ2A 4B7YC 1JOCA 2VP7A 2LGKA 3QZVA 3ZPV1 2M1RA 2K4DA 3VK6A 2K17A 2MNYA 2JMDA 2KGIA 3O33A 5AITA 5TDWA 5D1LB 3ZVYA 3ZNIA 4I7CA 4AVXA 1LDJB 3L1ZB 4GNEA 2YU4A 5B79A 3N9QA 4A4BA 1G25A 1LDKC 1WE9A 3U5OA 4GNFA 2YREA 3N9MA 2QICA 1WESA 2K16A 5H1TA 3C6WA 2YUCA 4LK9A 1XWHA 2LQ6A 5LKXA
chains in the Genus database with same CATH superfamily
2KIZA 3SHBA 1WEPA 1X4JA 1WEWA 5I3LA 2E6SA 3LVRE 3ZPVE 4B86C 2ECNA 1DVPA 2KYUA 4ZDTA 2EGMA 3PURA 2MD8C 3N9LA 2CKLB 1WEUA 4OGCA 2KWNA 4YATA 3HTKC 5B76A 2YSMA 2IQJA 3O35A 4AYCB 1VYXA 4O64A 2L43A 4MVTA 3M7KA 2CSZA 3MHHA 2XP0A 4FIPA 4QQ4A 2VNFA 4PPEA 2H0DB 1JM7A 3C5KA 2G43A 5TABA 4CA1A 4V3LC 3E2DA 4YBMA 2ECVA 3DQVR 2OXQC 3SUBA 1N87A 2Y1NA 3LJUX 4IC2A 4L58A 3DWDA 2OWAA 3FEHA 4H9DA 4C9ZA 1VFYA 5FB1A 2M85A 5SVXA 2VPEA 4I7DA 2YHOA 4UP0A 2VPDA 3ASLA 4LADB 4F1PA 4FO9A 4NN2A 1WGMA 5K3QA 4A0CD 3KV5A 4A49A 3GV4A 4TKPB 2MA6A 5DKAA 2LXHC 1CHCA 1ZBDB 1Z2QA 1VD4A 1E4UA 3FL2A 3KNVA 2MKEA 3EB5A 4AUQB 2YVRA 4N4FA 2RR4A 2FD4A 3KV6A 5SVIA 3DDTA 5J3XA 2RI7A 5C13A 2VJFA 2C2LA 2KR4A 4LKAA 2G45A 2PNXA 2D8SA 2L0BA 2L5UA 4YBSA 2F6JA 4ZQLA 2VPGA 4IC3A 3L1XA 5FB0A 2XOZA 3ZYQA 3N9PA 3DPLR 1FBVA 2P57A 4XI1A 2JMIA 2CKLA 2FUIA 4BBQA 4AYCA 5FERA 3HCUA 2M6MA 1X4IA 5LCWB 2M3HA 3O47A 3LDYA 2F42A 3GL6A 3U5PA 4R7EA 2I50A 4ZUXU 2YHNA 2XB1A 2MNZA 3MDBC 2JRJA 3T6RA 4BHWA 1U6GB 2KGGA 5H1UA 3Q1DA 2YW8A 2H0DA 2KREA 3FJUB 2HYED 3I2DA 5KH7A 2KKXA 1WILA 2M13A 4Z0OA 2YQLA 2EA6A 3LQJA 2JM3A 2KFTA 2D8UA 4YBTA 5LKZA 2CSYA 3PUQA 4WZ0A 5SVYA 1MM2A 2G6QA 5B75A 3FANA 4WZ3B 5TDRA 2KU3A 1WEMA 3O37A 5EYAF 4YABA 5B78A 3L11A 2FFWA 3M62A 3KQIA 4QF2A 2JUNA 2YURA 1K2FA 4QF3A 2CRRA 4WA6A 3H7HA 4FJCA 3RPGB 2B0OE 2L75A 2DJAA 1WIMA 3O70A 4F52B 3FAOA 3T7LA 2YSJA 4PTBA 2F6NA 3O34A 4LJNA 2LRIC 4GNGA 3ZVZB 2Y43A 2VJEB 4W4UA 3LVQE 1WFKA 1WEOA 2NAAA 3RTRB 3SOXA 5G05B 2Y1MA 1WEEA 2HDPA 2ECWA 3JUEA 4YADA 2YT5A 1WENA 1T1HA 4YC9A 1HYIA 4Z0RA 1BORA 3N9OA 1JM7B 1X4UA 1MM3A 2C2VS 2XEUA 2LDRA 2FUUA 4R8PK 3NG2A 2ECTA 4A4CA 2LGVA 2ZETC 2ECGA 4GNDA 5JG6A 1Z60A 2MIQA 4V3KC 5DINA 2LAUA 3IHPA 5TBNA 2YQMA 2LV9A 3SOWA 5D1MB 3ZTGA 1WEVA 3PHDA 2AN6A 1RMDA 4S3OB 1WEQA 5KH9A 2BAYA 2EGPA 3MHSA 5FEYA 2DX8A 4AP4A 3KDEC 4YAXA 4UP5A 5B77A 5C11A 5LKUA 2E61A 5LKTA 5KH3A 5SVIB 3RPGC 2CRWA 2LGGA 2IDAA 4P5OB 2VJFB 2KWJA 3SOUA 2KWKA 1Z6UA 4I7BA 3U5MA 2MT5A 5H1VA 3PLWA 3LQHA 2VPBA 5G0FA 2JMJA 2LXPC 4GB0A 4FK5A 2PUYA 1F62A 2KWOA 3EB6A 4R2YA 4N3WA 5AIUA 4X3GA 3T9KA 2XOCA 2VJEA 2LN0A 3V43A 2LGLA 2YYRA 1IYMA 2XOYA 4Q6FA 2E6RA 4CCGX 5H9MA 2EXUA 1MBMA 3HCTA 3O36A 2MUMA 2UZGA 4MSXA 2MA5A 3M63A 2RSDA 2ECIA 3N9NA 5D1KB 2K1JA 5B8DA 3U5NA 2QIZA 4OGEA 3LQIA 5G04B 3LRQA 2L7PA 1HYJA 4LLBA 2L80A 3O7AA 4S3OC 3M99A 2EODA 1FP0A 2KKYA 2MD7B 5TRBA 4L7XA 2CONA 2QJ0A 2FSAA 3HCSA 4UI9B 1V87A 2KE1A 2CT2A 4O62A 2ECJA 4WZ2A 4B7YC 1JOCA 2VP7A 2LGKA 3QZVA 3ZPV1 2M1RA 2K4DA 3VK6A 2K17A 2MNYA 2JMDA 2KGIA 3O33A 5AITA 5TDWA 5D1LB 3ZVYA 3ZNIA 4I7CA 4AVXA 1LDJB 3L1ZB 4GNEA 2YU4A 3FM8C 5B79A 3N9QA 4A4BA 1G25A 1LDKC 1WE9A 3U5OA 4GNFA 2YREA 3N9MA 1DCQA 2DSMA 2QICA 1WESA 2CSVA 2K16A 5H1TA 3C6WA 2YUCA 4LK9A 1XWHA 2LQ6A 5LKXA
chains in the Genus database with same CATH topology
2KIZA 3SHBA 1WEPA 1X4JA 1WEWA 5I3LA 2E6SA 3ZPVE 4B86C 2ECNA 1DVPA 2KYUA 4ZDTA 3PURA 2MD8C 3N9LA 2CKLB 1WEUA 2KWNA 4YATA 3HTKC 5B76A 2YSMA 3O35A 4AYCB 1VYXA 4O64A 2L43A 4MVTA 2CSZA 3MHHA 4FIPA 2VNFA 4PPEA 2H0DB 1JM7A 3C5KA 2G43A 5TABA 4CA1A 4V3LC 4YBMA 2ECVA 3DQVR 2OXQC 1N87A 2Y1NA 4IC2A 4L58A 4C9ZA 1VFYA 5FB1A 2M85A 2VPEA 4I7DA 2YHOA 4UP0A 2VPDA 3ASLA 4LADB 4FO9A 4NN2A 1WGMA 4A0CD 3KV5A 4A49A 3GV4A 4TKPB 2MA6A 5DKAA 2LXHC 1CHCA 1ZBDB 1Z2QA 1VD4A 1E4UA 3FL2A 3KNVA 3EB5A 4AUQB 4N4FA 3KV6A 5J3XA 2RI7A 5C13A 2VJFA 2C2LA 2KR4A 4LKAA 2G45A 2PNXA 2D8SA 2L0BA 2L5UA 4YBSA 2F6JA 4ZQLA 2VPGA 4IC3A 3L1XA 5FB0A 3ZYQA 3N9PA 3DPLR 1FBVA 4XI1A 2JMIA 2CKLA 2FUIA 4BBQA 4AYCA 5FERA 3HCUA 2M6MA 1X4IA 5LCWB 2M3HA 2F42A 3GL6A 3U5PA 4R7EA 2I50A 4ZUXU 2YHNA 2XB1A 2MNZA 2JRJA 3T6RA 4BHWA 1U6GB 2KGGA 5H1UA 2YW8A 2H0DA 2KREA 3I2DA 2HYED 5KH7A 1WILA 2YQLA 2EA6A 3LQJA 2KFTA 4YBTA 5LKZA 2CSYA 3PUQA 4WZ0A 1MM2A 2G6QA 5B75A 4WZ3B 5TDRA 2KU3A 1WEMA 3O37A 5EYAF 4YABA 5B78A 3L11A 3M62A 3KQIA 4QF2A 2YURA 1K2FA 4QF3A 4WA6A 4FJCA 3RPGB 2L75A 1WIMA 3O70A 4F52B 3T7LA 2YSJA 4PTBA 2F6NA 3O34A 4LJNA 2LRIC 4GNGA 3ZVZB 2Y43A 2VJEB 4W4UA 1WFKA 1WEOA 2NAAA 3RTRB 3SOXA 5G05B 2Y1MA 1WEEA 2HDPA 2ECWA 4YADA 2YT5A 1WENA 1T1HA 4YC9A 1HYIA 1BORA 3N9OA 1JM7B 1X4UA 1MM3A 2C2VS 2XEUA 2LDRA 2FUUA 4R8PK 3NG2A 2ECTA 4A4CA 2LGVA 2ZETC 2ECGA 4GNDA 5JG6A 1Z60A 2MIQA 4V3KC 5DINA 3IHPA 5TBNA 2YQMA 2LV9A 3SOWA 5D1MB 3ZTGA 1WEVA 3PHDA 2AN6A 1RMDA 4S3OB 1WEQA 5KH9A 2BAYA 2EGPA 3MHSA 5FEYA 2DX8A 4AP4A 4YAXA 4UP5A 5B77A 5C11A 5LKUA 5LKTA 5KH3A 3RPGC 2LGGA 2IDAA 4P5OB 2VJFB 2KWJA 3SOUA 2KWKA 1Z6UA 4I7BA 3U5MA 2MT5A 5H1VA 3LQHA 2VPBA 5G0FA 2JMJA 2LXPC 4GB0A 4FK5A 2PUYA 1F62A 2KWOA 3EB6A 4R2YA 4N3WA 5AIUA 4X3GA 2VJEA 2LN0A 3V43A 2LGLA 2YYRA 1IYMA 4Q6FA 2E6RA 4CCGX 5H9MA 3HCTA 3O36A 2MUMA 2UZGA 4MSXA 2MA5A 3M63A 2RSDA 2ECIA 3N9NA 5D1KB 2K1JA 5B8DA 3U5NA 2QIZA 3LQIA 5G04B 3LRQA 1HYJA 4LLBA 2L80A 3O7AA 4S3OC 3M99A 2EODA 1FP0A 2MD7B 5TRBA 4L7XA 2QJ0A 2FSAA 3HCSA 4UI9B 1V87A 2KE1A 2CT2A 2ECJA 4WZ2A 4B7YC 1JOCA 2VP7A 2LGKA 3QZVA 3ZPV1 2M1RA 2K4DA 3VK6A 2K17A 2MNYA 2JMDA 2KGIA 3O33A 5AITA 5TDWA 5D1LB 3ZVYA 3ZNIA 4I7CA 4AVXA 1LDJB 3L1ZB 4GNEA 2YU4A 5B79A 3N9QA 4A4BA 1G25A 1LDKC 1WE9A 3U5OA 4GNFA 2YREA 3N9MA 2QICA 1WESA 2K16A 5H1TA 3C6WA 2YUCA 4LK9A 1XWHA 2LQ6A 5LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIZ A;  3SHB A;  1WEP A;  1X4J A;  1WEW A;  5I3L A;  2E6S A;  3ZPV E;  4B86 C;  2ECN A;  1DVP A;  2KYU A;  4ZDT A;  3PUR A;  2MD8 C;  3N9L A;  2CKL B;  1WEU A;  2KWN A;  4YAT A;  3HTK C;  5B76 A;  2YSM A;  3O35 A;  4AYC B;  1VYX A;  4O64 A;  2L43 A;  4MVT A;  2CSZ A;  3MHH A;  4FIP A;  2VNF A;  4PPE A;  2H0D B;  1JM7 A;  3C5K A;  2G43 A;  5TAB A;  4CA1 A;  4V3L C;  4YBM A;  2ECV A;  3DQV R;  2OXQ C;  1N87 A;  2Y1N A;  4IC2 A;  4L58 A;  4C9Z A;  1VFY A;  5FB1 A;  2M85 A;  2VPE A;  4I7D A;  2YHO A;  4UP0 A;  2VPD A;  3ASL A;  4LAD B;  4FO9 A;  4NN2 A;  1WGM A;  4A0C D;  3KV5 A;  4A49 A;  3GV4 A;  4TKP B;  2MA6 A;  5DKA A;  2LXH C;  1CHC A;  1ZBD B;  1Z2Q A;  1VD4 A;  1E4U A;  3FL2 A;  3KNV A;  3EB5 A;  4AUQ B;  4N4F A;  3KV6 A;  5J3X A;  2RI7 A;  5C13 A;  2VJF A;  2C2L A;  2KR4 A;  4LKA A;  2G45 A;  2PNX A;  2D8S A;  2L0B A;  2L5U A;  4YBS A;  2F6J A;  4ZQL A;  2VPG A;  4IC3 A;  3L1X A;  5FB0 A;  3ZYQ A;  3N9P A;  3DPL R;  1FBV A;  4XI1 A;  2JMI A;  2CKL A;  2FUI A;  4BBQ A;  4AYC A;  5FER A;  3HCU A;  2M6M A;  1X4I A;  5LCW B;  2M3H A;  2F42 A;  3GL6 A;  3U5P A;  4R7E A;  2I50 A;  4ZUX U;  2YHN A;  2XB1 A;  2MNZ A;  2JRJ A;  3T6R A;  4BHW A;  1U6G B;  2KGG A;  5H1U A;  2YW8 A;  2H0D A;  2KRE A;  3I2D A;  2HYE D;  5KH7 A;  1WIL A;  2YQL A;  2EA6 A;  3LQJ A;  2KFT A;  4YBT A;  5LKZ A;  2CSY A;  3PUQ A;  4WZ0 A;  1MM2 A;  2G6Q A;  5B75 A;  4WZ3 B;  5TDR A;  2KU3 A;  1WEM A;  3O37 A;  5EYA F;  4YAB A;  5B78 A;  3L11 A;  3M62 A;  3KQI A;  4QF2 A;  2YUR A;  1K2F A;  4QF3 A;  4WA6 A;  4FJC A;  3RPG B;  2L75 A;  1WIM A;  3O70 A;  4F52 B;  3T7L A;  2YSJ A;  4PTB A;  2F6N A;  3O34 A;  4LJN A;  2LRI C;  4GNG A;  3ZVZ B;  2Y43 A;  2VJE B;  4W4U A;  1WFK A;  1WEO A;  2NAA A;  3RTR B;  3SOX A;  5G05 B;  2Y1M A;  1WEE A;  2HDP A;  2ECW A;  4YAD A;  2YT5 A;  1WEN A;  1T1H A;  4YC9 A;  1HYI A;  1BOR A;  3N9O A;  1JM7 B;  1X4U A;  1MM3 A;  2C2V S;  2XEU A;  2LDR A;  2FUU A;  4R8P K;  3NG2 A;  2ECT A;  4A4C A;  2LGV A;  2ZET C;  2ECG A;  4GND A;  5JG6 A;  1Z60 A;  2MIQ A;  4V3K C;  5DIN A;  3IHP A;  5TBN A;  2YQM A;  2LV9 A;  3SOW A;  5D1M B;  3ZTG A;  1WEV A;  3PHD A;  2AN6 A;  1RMD A;  4S3O B;  1WEQ A;  5KH9 A;  2BAY A;  2EGP A;  3MHS A;  5FEY A;  2DX8 A;  4AP4 A;  4YAX A;  4UP5 A;  5B77 A;  5C11 A;  5LKU A;  5LKT A;  5KH3 A;  3RPG C;  2LGG A;  2IDA A;  4P5O B;  2VJF B;  2KWJ A;  3SOU A;  2KWK A;  1Z6U A;  4I7B A;  3U5M A;  2MT5 A;  5H1V A;  3LQH A;  2VPB A;  5G0F A;  2JMJ A;  2LXP C;  4GB0 A;  4FK5 A;  2PUY A;  1F62 A;  2KWO A;  3EB6 A;  4R2Y A;  4N3W A;  5AIU A;  4X3G A;  2VJE A;  2LN0 A;  3V43 A;  2LGL A;  2YYR A;  1IYM A;  4Q6F A;  2E6R A;  4CCG X;  5H9M A;  3HCT A;  3O36 A;  2MUM A;  2UZG A;  4MSX A;  2MA5 A;  3M63 A;  2RSD A;  2ECI A;  3N9N A;  5D1K B;  2K1J A;  5B8D A;  3U5N A;  2QIZ A;  3LQI A;  5G04 B;  3LRQ A;  1HYJ A;  4LLB A;  2L80 A;  3O7A A;  4S3O C;  3M99 A;  2EOD A;  1FP0 A;  2MD7 B;  5TRB A;  4L7X A;  2QJ0 A;  2FSA A;  3HCS A;  4UI9 B;  1V87 A;  2KE1 A;  2CT2 A;  2ECJ A;  4WZ2 A;  4B7Y C;  1JOC A;  2VP7 A;  2LGK A;  3QZV A;  3ZPV 1;  2M1R A;  2K4D A;  3VK6 A;  2K17 A;  2MNY A;  2JMD A;  2KGI A;  3O33 A;  5AIT A;  5TDW A;  5D1L B;  3ZVY A;  3ZNI A;  4I7C A;  4AVX A;  1LDJ B;  3L1Z B;  4GNE A;  2YU4 A;  5B79 A;  3N9Q A;  4A4B A;  1G25 A;  1LDK C;  1WE9 A;  3U5O A;  4GNF A;  2YRE A;  3N9M A;  2QIC A;  1WES A;  2K16 A;  5H1T A;  3C6W A;  2YUC A;  4LK9 A;  1XWH A;  2LQ6 A;  5LKX A; 
#chains in the Genus database with same CATH topology
 2KIZ A;  3SHB A;  1WEP A;  1X4J A;  1WEW A;  5I3L A;  2E6S A;  3LVR E;  3ZPV E;  4B86 C;  2ECN A;  1DVP A;  2KYU A;  4ZDT A;  2EGM A;  3PUR A;  2MD8 C;  3N9L A;  2CKL B;  1WEU A;  4OGC A;  2KWN A;  4YAT A;  3HTK C;  5B76 A;  2YSM A;  2IQJ A;  3O35 A;  4AYC B;  1VYX A;  4O64 A;  2L43 A;  4MVT A;  3M7K A;  2CSZ A;  3MHH A;  2XP0 A;  4FIP A;  4QQ4 A;  2VNF A;  4PPE A;  2H0D B;  1JM7 A;  3C5K A;  2G43 A;  5TAB A;  4CA1 A;  4V3L C;  3E2D A;  4YBM A;  2ECV A;  3DQV R;  2OXQ C;  3SUB A;  1N87 A;  2Y1N A;  3LJU X;  4IC2 A;  4L58 A;  3DWD A;  2OWA A;  3FEH A;  4H9D A;  4C9Z A;  1VFY A;  5FB1 A;  2M85 A;  5SVX A;  2VPE A;  4I7D A;  2YHO A;  4UP0 A;  2VPD A;  3ASL A;  4LAD B;  4F1P A;  4FO9 A;  4NN2 A;  1WGM A;  5K3Q A;  4A0C D;  3KV5 A;  4A49 A;  3GV4 A;  4TKP B;  2MA6 A;  5DKA A;  2LXH C;  1CHC A;  1ZBD B;  1Z2Q A;  1VD4 A;  1E4U A;  3FL2 A;  3KNV A;  2MKE A;  3EB5 A;  4AUQ B;  2YVR A;  4N4F A;  2RR4 A;  2FD4 A;  3KV6 A;  5SVI A;  3DDT A;  5J3X A;  2RI7 A;  5C13 A;  2VJF A;  2C2L A;  2KR4 A;  4LKA A;  2G45 A;  2PNX A;  2D8S A;  2L0B A;  2L5U A;  4YBS A;  2F6J A;  4ZQL A;  2VPG A;  4IC3 A;  3L1X A;  5FB0 A;  2XOZ A;  3ZYQ A;  3N9P A;  3DPL R;  1FBV A;  2P57 A;  4XI1 A;  2JMI A;  2CKL A;  2FUI A;  4BBQ A;  4AYC A;  5FER A;  3HCU A;  2M6M A;  1X4I A;  5LCW B;  2M3H A;  3O47 A;  3LDY A;  2F42 A;  3GL6 A;  3U5P A;  4R7E A;  2I50 A;  4ZUX U;  2YHN A;  2XB1 A;  2MNZ A;  3MDB C;  2JRJ A;  3T6R A;  4BHW A;  1U6G B;  2KGG A;  5H1U A;  3Q1D A;  2YW8 A;  2H0D A;  2KRE A;  3FJU B;  2HYE D;  3I2D A;  5KH7 A;  2KKX A;  1WIL A;  2M13 A;  4Z0O A;  2YQL A;  2EA6 A;  3LQJ A;  2JM3 A;  2KFT A;  2D8U A;  4YBT A;  5LKZ A;  2CSY A;  3PUQ A;  4WZ0 A;  5SVY A;  1MM2 A;  2G6Q A;  5B75 A;  3FAN A;  4WZ3 B;  5TDR A;  2KU3 A;  1WEM A;  3O37 A;  5EYA F;  4YAB A;  5B78 A;  3L11 A;  2FFW A;  3M62 A;  3KQI A;  4QF2 A;  2JUN A;  2YUR A;  1K2F A;  4QF3 A;  2CRR A;  4WA6 A;  3H7H A;  4FJC A;  3RPG B;  2B0O E;  2L75 A;  2DJA A;  1WIM A;  3O70 A;  4F52 B;  3FAO A;  3T7L A;  2YSJ A;  4PTB A;  2F6N A;  3O34 A;  4LJN A;  2LRI C;  4GNG A;  3ZVZ B;  2Y43 A;  2VJE B;  4W4U A;  3LVQ E;  1WFK A;  1WEO A;  2NAA A;  3RTR B;  3SOX A;  5G05 B;  2Y1M A;  1WEE A;  2HDP A;  2ECW A;  3JUE A;  4YAD A;  2YT5 A;  1WEN A;  1T1H A;  4YC9 A;  1HYI A;  4Z0R A;  1BOR A;  3N9O A;  1JM7 B;  1X4U A;  1MM3 A;  2C2V S;  2XEU A;  2LDR A;  2FUU A;  4R8P K;  3NG2 A;  2ECT A;  4A4C A;  2LGV A;  2ZET C;  2ECG A;  4GND A;  5JG6 A;  1Z60 A;  2MIQ A;  4V3K C;  5DIN A;  2LAU A;  3IHP A;  5TBN A;  2YQM A;  2LV9 A;  3SOW A;  5D1M B;  3ZTG A;  1WEV A;  3PHD A;  2AN6 A;  1RMD A;  4S3O B;  1WEQ A;  5KH9 A;  2BAY A;  2EGP A;  3MHS A;  5FEY A;  2DX8 A;  4AP4 A;  3KDE C;  4YAX A;  4UP5 A;  5B77 A;  5C11 A;  5LKU A;  2E61 A;  5LKT A;  5KH3 A;  5SVI B;  3RPG C;  2CRW A;  2LGG A;  2IDA A;  4P5O B;  2VJF B;  2KWJ A;  3SOU A;  2KWK A;  1Z6U A;  4I7B A;  3U5M A;  2MT5 A;  5H1V A;  3PLW A;  3LQH A;  2VPB A;  5G0F A;  2JMJ A;  2LXP C;  4GB0 A;  4FK5 A;  2PUY A;  1F62 A;  2KWO A;  3EB6 A;  4R2Y A;  4N3W A;  5AIU A;  4X3G A;  3T9K A;  2XOC A;  2VJE A;  2LN0 A;  3V43 A;  2LGL A;  2YYR A;  1IYM A;  2XOY A;  4Q6F A;  2E6R A;  4CCG X;  5H9M A;  2EXU A;  1MBM A;  3HCT A;  3O36 A;  2MUM A;  2UZG A;  4MSX A;  2MA5 A;  3M63 A;  2RSD A;  2ECI A;  3N9N A;  5D1K B;  2K1J A;  5B8D A;  3U5N A;  2QIZ A;  4OGE A;  3LQI A;  5G04 B;  3LRQ A;  2L7P A;  1HYJ A;  4LLB A;  2L80 A;  3O7A A;  4S3O C;  3M99 A;  2EOD A;  1FP0 A;  2KKY A;  2MD7 B;  5TRB A;  4L7X A;  2CON A;  2QJ0 A;  2FSA A;  3HCS A;  4UI9 B;  1V87 A;  2KE1 A;  2CT2 A;  4O62 A;  2ECJ A;  4WZ2 A;  4B7Y C;  1JOC A;  2VP7 A;  2LGK A;  3QZV A;  3ZPV 1;  2M1R A;  2K4D A;  3VK6 A;  2K17 A;  2MNY A;  2JMD A;  2KGI A;  3O33 A;  5AIT A;  5TDW A;  5D1L B;  3ZVY A;  3ZNI A;  4I7C A;  4AVX A;  1LDJ B;  3L1Z B;  4GNE A;  2YU4 A;  3FM8 C;  5B79 A;  3N9Q A;  4A4B A;  1G25 A;  1LDK C;  1WE9 A;  3U5O A;  4GNF A;  2YRE A;  3N9M A;  1DCQ A;  2DSM A;  2QIC A;  1WES A;  2CSV A;  2K16 A;  5H1T A;  3C6W A;  2YUC A;  4LK9 A;  1XWH A;  2LQ6 A;  5LKX A; 
#chains in the Genus database with same CATH homology
 2KIZ A;  3SHB A;  1WEP A;  1X4J A;  1WEW A;  5I3L A;  2E6S A;  3ZPV E;  4B86 C;  2ECN A;  1DVP A;  2KYU A;  4ZDT A;  3PUR A;  2MD8 C;  3N9L A;  2CKL B;  1WEU A;  2KWN A;  4YAT A;  3HTK C;  5B76 A;  2YSM A;  3O35 A;  4AYC B;  1VYX A;  4O64 A;  2L43 A;  4MVT A;  2CSZ A;  3MHH A;  4FIP A;  2VNF A;  4PPE A;  2H0D B;  1JM7 A;  3C5K A;  2G43 A;  5TAB A;  4CA1 A;  4V3L C;  4YBM A;  2ECV A;  3DQV R;  2OXQ C;  1N87 A;  2Y1N A;  4IC2 A;  4L58 A;  4C9Z A;  1VFY A;  5FB1 A;  2M85 A;  2VPE A;  4I7D A;  2YHO A;  4UP0 A;  2VPD A;  3ASL A;  4LAD B;  4FO9 A;  4NN2 A;  1WGM A;  4A0C D;  3KV5 A;  4A49 A;  3GV4 A;  4TKP B;  2MA6 A;  5DKA A;  2LXH C;  1CHC A;  1ZBD B;  1Z2Q A;  1VD4 A;  1E4U A;  3FL2 A;  3KNV A;  3EB5 A;  4AUQ B;  4N4F A;  3KV6 A;  5J3X A;  2RI7 A;  5C13 A;  2VJF A;  2C2L A;  2KR4 A;  4LKA A;  2G45 A;  2PNX A;  2D8S A;  2L0B A;  2L5U A;  4YBS A;  2F6J A;  4ZQL A;  2VPG A;  4IC3 A;  3L1X A;  5FB0 A;  3ZYQ A;  3N9P A;  3DPL R;  1FBV A;  4XI1 A;  2JMI A;  2CKL A;  2FUI A;  4BBQ A;  4AYC A;  5FER A;  3HCU A;  2M6M A;  1X4I A;  5LCW B;  2M3H A;  2F42 A;  3GL6 A;  3U5P A;  4R7E A;  2I50 A;  4ZUX U;  2YHN A;  2XB1 A;  2MNZ A;  2JRJ A;  3T6R A;  4BHW A;  1U6G B;  2KGG A;  5H1U A;  2YW8 A;  2H0D A;  2KRE A;  3I2D A;  2HYE D;  5KH7 A;  1WIL A;  2YQL A;  2EA6 A;  3LQJ A;  2KFT A;  4YBT A;  5LKZ A;  2CSY A;  3PUQ A;  4WZ0 A;  1MM2 A;  2G6Q A;  5B75 A;  4WZ3 B;  5TDR A;  2KU3 A;  1WEM A;  3O37 A;  5EYA F;  4YAB A;  5B78 A;  3L11 A;  3M62 A;  3KQI A;  4QF2 A;  2YUR A;  1K2F A;  4QF3 A;  4WA6 A;  4FJC A;  3RPG B;  2L75 A;  1WIM A;  3O70 A;  4F52 B;  3T7L A;  2YSJ A;  4PTB A;  2F6N A;  3O34 A;  4LJN A;  2LRI C;  4GNG A;  3ZVZ B;  2Y43 A;  2VJE B;  4W4U A;  1WFK A;  1WEO A;  2NAA A;  3RTR B;  3SOX A;  5G05 B;  2Y1M A;  1WEE A;  2HDP A;  2ECW A;  4YAD A;  2YT5 A;  1WEN A;  1T1H A;  4YC9 A;  1HYI A;  1BOR A;  3N9O A;  1JM7 B;  1X4U A;  1MM3 A;  2C2V S;  2XEU A;  2LDR A;  2FUU A;  4R8P K;  3NG2 A;  2ECT A;  4A4C A;  2LGV A;  2ZET C;  2ECG A;  4GND A;  5JG6 A;  1Z60 A;  2MIQ A;  4V3K C;  5DIN A;  3IHP A;  5TBN A;  2YQM A;  2LV9 A;  3SOW A;  5D1M B;  3ZTG A;  1WEV A;  3PHD A;  2AN6 A;  1RMD A;  4S3O B;  1WEQ A;  5KH9 A;  2BAY A;  2EGP A;  3MHS A;  5FEY A;  2DX8 A;  4AP4 A;  4YAX A;  4UP5 A;  5B77 A;  5C11 A;  5LKU A;  5LKT A;  5KH3 A;  3RPG C;  2LGG A;  2IDA A;  4P5O B;  2VJF B;  2KWJ A;  3SOU A;  2KWK A;  1Z6U A;  4I7B A;  3U5M A;  2MT5 A;  5H1V A;  3LQH A;  2VPB A;  5G0F A;  2JMJ A;  2LXP C;  4GB0 A;  4FK5 A;  2PUY A;  1F62 A;  2KWO A;  3EB6 A;  4R2Y A;  4N3W A;  5AIU A;  4X3G A;  2VJE A;  2LN0 A;  3V43 A;  2LGL A;  2YYR A;  1IYM A;  4Q6F A;  2E6R A;  4CCG X;  5H9M A;  3HCT A;  3O36 A;  2MUM A;  2UZG A;  4MSX A;  2MA5 A;  3M63 A;  2RSD A;  2ECI A;  3N9N A;  5D1K B;  2K1J A;  5B8D A;  3U5N A;  2QIZ A;  3LQI A;  5G04 B;  3LRQ A;  1HYJ A;  4LLB A;  2L80 A;  3O7A A;  4S3O C;  3M99 A;  2EOD A;  1FP0 A;  2MD7 B;  5TRB A;  4L7X A;  2QJ0 A;  2FSA A;  3HCS A;  4UI9 B;  1V87 A;  2KE1 A;  2CT2 A;  2ECJ A;  4WZ2 A;  4B7Y C;  1JOC A;  2VP7 A;  2LGK A;  3QZV A;  3ZPV 1;  2M1R A;  2K4D A;  3VK6 A;  2K17 A;  2MNY A;  2JMD A;  2KGI A;  3O33 A;  5AIT A;  5TDW A;  5D1L B;  3ZVY A;  3ZNI A;  4I7C A;  4AVX A;  1LDJ B;  3L1Z B;  4GNE A;  2YU4 A;  5B79 A;  3N9Q A;  4A4B A;  1G25 A;  1LDK C;  1WE9 A;  3U5O A;  4GNF A;  2YRE A;  3N9M A;  2QIC A;  1WES A;  2K16 A;  5H1T A;  3C6W A;  2YUC A;  4LK9 A;  1XWH A;  2LQ6 A;  5LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...