2ECVA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of tripartite motif-containing protein 5
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
GSSGSSGMASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 5
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of Tripartite motif-containing protein 5
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 4
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecvA00
3T6RA 2BAYA 2YREA 5FB1A 2MNZA 2QICA 3KQIA 2YUCA 3DPLR 5D1KB 4LLBA 2FUUA 3HCSA 1RMDA 4N3WA 3N9MA 1WEPA 1G25A 4R7EA 2IDAA 4UI9B 2EGPA 3C6WA 2MD8C 4AYCB 3SOUA 2PNXA 2KGIA 1WEOA 5KH9A 4AVXA 2KWJA 3VK6A 4O64A 2C2VS 2LXPC 2RI7A 3O7AA 5LKXA 4A4CA 1WEVA 1VD4A 1IYMA 3M99A 4YBMA 1WEEA 3PHDA 2Y1MA 3SOXA 1WFKA 2RSDA 3RPGC 3O70A 4WZ0A 2ECGA 1VYXA 3O33A 2JMDA 1WEMA 1Z6UA 4GNDA 2EODA 2VP7A 4FO9A 5D1MB 3HCTA 2K16A 1HYIA 1FBVA 2KIZA 5FEYA 1JM7B 2VJEB 5B78A 3ZNIA 2LDRA 2ZETC 4A4BA 3L1ZB 5B75A 2VPDA 2QIZA 4V3LC 2LV9A 2Y1NA 4GNFA 5TABA 1Z60A 3NG2A 5B76A 2LXHC 2NAAA 3SHBA 4QF2A 4AYCA 1WEQA 4YC9A 2I50A 4FJCA 3KV5A 1T1HA 1XWHA 4I7CA 5G04B 2LGVA 2MD7B 1V87A 2ECWA 2EA6A 5TDRA 5KH3A 2KWOA 2G45A 2YSMA 4XI1A 3RTRB 5KH7A 5EYAF 5C11A 2L75A 2JMJA 4TKPB 3RPGB 2LGGA 4X3GA 4YBTA 3EB6A 4W4UA 2H0DB 3LQIA 3ZPV1 5H1VA 3MHSA 5LKUA 4IC2A 5TDWA 2CT2A 1WE9A 2KYUA 2K17A 2LGLA 2FUIA 2CKLB 2CSYA 2E6SA 3I2DA 5JG6A 1N87A 1WEWA 4ZUXU 2LQ6A 1JM7A 2K1JA 2VJEA 2LGKA 2L43A 5G0FA 3ZVZB 2KU3A 4LADB 3GV4A 5D1LB 2K4DA 2MA5A 3ZYQA 3QZVA 5H1TA 3C5KA 2F6NA 3L1XA 5B8DA 4I7BA 2ECTA 2YT5A 3U5OA 2OXQC 2KE1A 4AUQB 1DVPA 2HYED 1WIMA 1K2FA 4WA6A 2KREA 4LKAA 4FIPA 5AIUA 4GNGA 2YHNA 3N9QA 4WZ3B 3L11A 4GNEA 4A0CD 2VJFB 4CCGX 5DKAA 4MVTA 2MA6A 5FB0A 3V43A 1F62A 1WEUA 2YQMA 3IHPA 3MHHA 4S3OC 2FSAA 5LCWB 2YYRA 2CSZA 5B79A 2H0DA 2VPGA 4QF3A 5G05B 4LJNA 4BBQA 1U6GB 5H9MA 3GL6A 2KR4A 2XEUA 2YU4A 3T7LA 2CKLA 1FP0A 3M62A 1LDKC 1MM2A 2M1RA 5LKZA 2G43A 2YQLA 4P5OB 2KWNA 3ZPVE 3N9LA 2ECNA 4ZQLA 3KNVA 1WENA 3LQJA 2LN0A 2DX8A 1ZBDB 2L5UA 4C9ZA 1VFYA 4L7XA 4F52B 2F42A 2UZGA 5AITA 3DQVR 1X4JA 4ZDTA 2ECIA 4B7YC 3PUQA 3N9OA 4A49A 2L80A 2HDPA 2E6RA 2YSJA 2KWKA 3HCUA 1X4IA 4L58A 3KV6A 2VNFA 1E4UA 2M6MA 2MUMA 1WESA 2JMIA 4B86C 4R8PK 3U5NA 2VPEA 4I7DA 2JRJA 2M85A 4UP0A 3LRQA 2C2LA 3PURA 2VJFA 4PTBA 1X4UA 4YAXA 4WZ2A 3ASLA 2YURA 4FK5A 2MIQA 1HYJA 4GB0A 3O36A 1LDJB 2MNYA 2D8SA 2KFTA 2KGGA 4S3OB 4YABA 3U5MA 2G6QA 2QJ0A 3U5PA 3M63A 3SOWA 5B77A 5C13A 4Q6FA 4YADA 4CA1A 3O37A 2L0BA 5DINA 1CHCA 2XB1A 1JOCA 3HTKC 3O35A 4UP5A 5TRBA 2ECJA 3N9NA 4AP4A 5LKTA 2YW8A 2LRIC 1BORA 4LK9A 4V3KC 1WGMA 5J3XA 4YATA 4IC3A 3LQHA 5TBNA 2PUYA 3ZTGA 2AN6A 5FERA 4BHWA 3O34A 1WILA 3ZVYA 1Z2QA 3FL2A 4N4FA 2YHOA 2F6JA 5H1UA 2VPBA 2Y43A 4YBSA 4NN2A 4MSXA 2MT5A 4PPEA 5I3LA 2ECVA 2M3HA 3EB5A 3N9PA 1MM3A 4R2YA
chains in the Genus database with same CATH superfamily
3T6RA 2BAYA 2YREA 5FB1A 2MNZA 2QICA 2XOYA 3KQIA 2B0OE 2YUCA 3DPLR 5D1KB 4LLBA 2FUUA 3HCSA 1RMDA 4N3WA 2CRWA 3N9MA 1WEPA 1G25A 4R7EA 2IDAA 4UI9B 2EGPA 3C6WA 2MD8C 4QQ4A 3FAOA 4AYCB 3SOUA 2PNXA 2KGIA 1WEOA 5KH9A 4AVXA 2KWJA 2RR4A 3VK6A 4O64A 2C2VS 2LXPC 2RI7A 3O7AA 5LKXA 4A4CA 3PLWA 1WEVA 1VD4A 1IYMA 3M99A 4YBMA 1WEEA 3PHDA 2Y1MA 5SVYA 3O47A 3SOXA 1WFKA 2XOCA 2RSDA 3RPGC 3LJUX 3O70A 4WZ0A 2ECGA 1VYXA 2D8UA 3FM8C 3O33A 2JMDA 1WEMA 1Z6UA 4GNDA 2EODA 2VP7A 4FO9A 5D1MB 3M7KA 2LAUA 3HCTA 2K16A 1HYIA 1FBVA 2KIZA 5FEYA 1JM7B 2VJEB 5B78A 3ZNIA 2LDRA 2ZETC 4A4BA 3L1ZB 5B75A 2VPDA 2QIZA 4V3LC 2LV9A 2Y1NA 4GNFA 5TABA 1Z60A 3NG2A 5B76A 2LXHC 2NAAA 3SHBA 4QF2A 4AYCA 1WEQA 2EGMA 4YC9A 3H7HA 2I50A 2OWAA 4FJCA 3KV5A 1T1HA 1XWHA 4I7CA 5G04B 2LGVA 2MD7B 3FJUB 1V87A 2ECWA 2KKYA 2EA6A 5TDRA 4F1PA 5KH3A 2KWOA 2G45A 2YSMA 4XI1A 3RTRB 5KH7A 5EYAF 5C11A 2L75A 2JMJA 4TKPB 3RPGB 2LGGA 4X3GA 4YBTA 3EB6A 4W4UA 2H0DB 3LQIA 3ZPV1 5H1VA 3JUEA 3MHSA 2JUNA 5LKUA 3LVRE 4IC2A 5TDWA 2CT2A 1WE9A 2KYUA 2K17A 2LGLA 2FUIA 2CKLB 2CSYA 2E6SA 3I2DA 5JG6A 2XOZA 1N87A 1WEWA 4ZUXU 2LQ6A 2CSVA 1JM7A 2K1JA 2VJEA 4OGCA 2LGKA 4OGEA 1MBMA 2L43A 5G0FA 3ZVZB 2KU3A 4LADB 3GV4A 5D1LB 2K4DA 2MA5A 3ZYQA 3QZVA 5H1TA 3C5KA 2F6NA 2CRRA 3L1XA 5B8DA 4I7BA 2ECTA 5K3QA 2YT5A 3U5OA 2OXQC 2KE1A 4AUQB 1DVPA 2HYED 1WIMA 2FD4A 2P57A 4Z0RA 3MDBC 1K2FA 4WA6A 2KREA 4LKAA 4FIPA 5AIUA 4GNGA 2YHNA 3N9QA 4WZ3B 3L11A 4GNEA 4A0CD 2VJFB 4CCGX 5DKAA 4MVTA 2MA6A 5FB0A 3V43A 1F62A 1WEUA 2YQMA 3IHPA 3MHHA 4S3OC 2FSAA 5LCWB 2YYRA 2CSZA 5B79A 2H0DA 2VPGA 4QF3A 5G05B 3E2DA 4LJNA 4BBQA 1U6GB 5H9MA 3GL6A 2KR4A 2XEUA 2YU4A 3T7LA 2CKLA 1FP0A 3M62A 3Q1DA 1LDKC 1MM2A 2M1RA 5LKZA 2G43A 3SUBA 2YQLA 4P5OB 2KWNA 3ZPVE 3N9LA 2ECNA 4ZQLA 3LVQE 5SVIB 3KNVA 1WENA 3LQJA 2CONA 2LN0A 2DX8A 1ZBDB 2L5UA 4C9ZA 1VFYA 2IQJA 4L7XA 4F52B 2F42A 3KDEC 2UZGA 5AITA 3DQVR 1X4JA 4ZDTA 2ECIA 2E61A 3FANA 4B7YC 3PUQA 3N9OA 4A49A 2L80A 2HDPA 2KKXA 2E6RA 2YSJA 2KWKA 2XP0A 3HCUA 1X4IA 4L58A 3KV6A 2VNFA 1E4UA 2M6MA 2MUMA 1WESA 2JMIA 4B86C 4R8PK 3U5NA 2VPEA 4I7DA 2JRJA 3FEHA 2M85A 4UP0A 3LRQA 2C2LA 3PURA 2VJFA 4PTBA 1X4UA 4YAXA 4WZ2A 3LDYA 3ASLA 2YURA 4FK5A 2MIQA 2L7PA 1HYJA 4GB0A 3O36A 2EXUA 1LDJB 2MNYA 2D8SA 2KFTA 2KGGA 4S3OB 4H9DA 4YABA 3U5MA 2G6QA 2QJ0A 3U5PA 3M63A 3DDTA 2JM3A 3SOWA 5B77A 5C13A 4Q6FA 4YADA 4CA1A 3O37A 2L0BA 5DINA 4Z0OA 1CHCA 2XB1A 1JOCA 3HTKC 3O35A 4UP5A 1DCQA 2MKEA 5TRBA 2ECJA 3N9NA 5SVIA 4AP4A 5LKTA 2DJAA 2YW8A 2LRIC 1BORA 4LK9A 4V3KC 1WGMA 5J3XA 4YATA 2M13A 2FFWA 4IC3A 3LQHA 4O62A 5TBNA 2PUYA 2YVRA 3DWDA 2DSMA 3ZTGA 2AN6A 5FERA 4BHWA 3O34A 1WILA 3ZVYA 1Z2QA 3FL2A 4N4FA 2YHOA 2F6JA 5H1UA 2VPBA 5SVXA 2Y43A 4YBSA 4NN2A 4MSXA 2MT5A 4PPEA 5I3LA 2ECVA 2M3HA 3EB5A 3T9KA 3N9PA 1MM3A 4R2YA
chains in the Genus database with same CATH topology
3T6RA 2BAYA 2YREA 5FB1A 2MNZA 2QICA 3KQIA 2YUCA 3DPLR 5D1KB 4LLBA 2FUUA 3HCSA 1RMDA 4N3WA 3N9MA 1WEPA 1G25A 4R7EA 2IDAA 4UI9B 2EGPA 3C6WA 2MD8C 4AYCB 3SOUA 2PNXA 2KGIA 1WEOA 5KH9A 4AVXA 2KWJA 3VK6A 4O64A 2C2VS 2LXPC 2RI7A 3O7AA 5LKXA 4A4CA 1WEVA 1VD4A 1IYMA 3M99A 4YBMA 1WEEA 3PHDA 2Y1MA 3SOXA 1WFKA 2RSDA 3RPGC 3O70A 4WZ0A 2ECGA 1VYXA 3O33A 2JMDA 1WEMA 1Z6UA 4GNDA 2EODA 2VP7A 4FO9A 5D1MB 3HCTA 2K16A 1HYIA 1FBVA 2KIZA 5FEYA 1JM7B 2VJEB 5B78A 3ZNIA 2LDRA 2ZETC 4A4BA 3L1ZB 5B75A 2VPDA 2QIZA 4V3LC 2LV9A 2Y1NA 4GNFA 5TABA 1Z60A 3NG2A 5B76A 2LXHC 2NAAA 3SHBA 4QF2A 4AYCA 1WEQA 4YC9A 2I50A 4FJCA 3KV5A 1T1HA 1XWHA 4I7CA 5G04B 2LGVA 2MD7B 1V87A 2ECWA 2EA6A 5TDRA 5KH3A 2KWOA 2G45A 2YSMA 4XI1A 3RTRB 5KH7A 5EYAF 5C11A 2L75A 2JMJA 4TKPB 3RPGB 2LGGA 4X3GA 4YBTA 3EB6A 4W4UA 2H0DB 3LQIA 3ZPV1 5H1VA 3MHSA 5LKUA 4IC2A 5TDWA 2CT2A 1WE9A 2KYUA 2K17A 2LGLA 2FUIA 2CKLB 2CSYA 2E6SA 3I2DA 5JG6A 1N87A 1WEWA 4ZUXU 2LQ6A 1JM7A 2K1JA 2VJEA 2LGKA 2L43A 5G0FA 3ZVZB 2KU3A 4LADB 3GV4A 5D1LB 2K4DA 2MA5A 3ZYQA 3QZVA 5H1TA 3C5KA 2F6NA 3L1XA 5B8DA 4I7BA 2ECTA 2YT5A 3U5OA 2OXQC 2KE1A 4AUQB 1DVPA 2HYED 1WIMA 1K2FA 4WA6A 2KREA 4LKAA 4FIPA 5AIUA 4GNGA 2YHNA 3N9QA 4WZ3B 3L11A 4GNEA 4A0CD 2VJFB 4CCGX 5DKAA 4MVTA 2MA6A 5FB0A 3V43A 1F62A 1WEUA 2YQMA 3IHPA 3MHHA 4S3OC 2FSAA 5LCWB 2YYRA 2CSZA 5B79A 2H0DA 2VPGA 4QF3A 5G05B 4LJNA 4BBQA 1U6GB 5H9MA 3GL6A 2KR4A 2XEUA 2YU4A 3T7LA 2CKLA 1FP0A 3M62A 1LDKC 1MM2A 2M1RA 5LKZA 2G43A 2YQLA 4P5OB 2KWNA 3ZPVE 3N9LA 2ECNA 4ZQLA 3KNVA 1WENA 3LQJA 2LN0A 2DX8A 1ZBDB 2L5UA 4C9ZA 1VFYA 4L7XA 4F52B 2F42A 2UZGA 5AITA 3DQVR 1X4JA 4ZDTA 2ECIA 4B7YC 3PUQA 3N9OA 4A49A 2L80A 2HDPA 2E6RA 2YSJA 2KWKA 3HCUA 1X4IA 4L58A 3KV6A 2VNFA 1E4UA 2M6MA 2MUMA 1WESA 2JMIA 4B86C 4R8PK 3U5NA 2VPEA 4I7DA 2JRJA 2M85A 4UP0A 3LRQA 2C2LA 3PURA 2VJFA 4PTBA 1X4UA 4YAXA 4WZ2A 3ASLA 2YURA 4FK5A 2MIQA 1HYJA 4GB0A 3O36A 1LDJB 2MNYA 2D8SA 2KFTA 2KGGA 4S3OB 4YABA 3U5MA 2G6QA 2QJ0A 3U5PA 3M63A 3SOWA 5B77A 5C13A 4Q6FA 4YADA 4CA1A 3O37A 2L0BA 5DINA 1CHCA 2XB1A 1JOCA 3HTKC 3O35A 4UP5A 5TRBA 2ECJA 3N9NA 4AP4A 5LKTA 2YW8A 2LRIC 1BORA 4LK9A 4V3KC 1WGMA 5J3XA 4YATA 4IC3A 3LQHA 5TBNA 2PUYA 3ZTGA 2AN6A 5FERA 4BHWA 3O34A 1WILA 3ZVYA 1Z2QA 3FL2A 4N4FA 2YHOA 2F6JA 5H1UA 2VPBA 2Y43A 4YBSA 4NN2A 4MSXA 2MT5A 4PPEA 5I3LA 2ECVA 2M3HA 3EB5A 3N9PA 1MM3A 4R2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6R A;  2BAY A;  2YRE A;  5FB1 A;  2MNZ A;  2QIC A;  3KQI A;  2YUC A;  3DPL R;  5D1K B;  4LLB A;  2FUU A;  3HCS A;  1RMD A;  4N3W A;  3N9M A;  1WEP A;  1G25 A;  4R7E A;  2IDA A;  4UI9 B;  2EGP A;  3C6W A;  2MD8 C;  4AYC B;  3SOU A;  2PNX A;  2KGI A;  1WEO A;  5KH9 A;  4AVX A;  2KWJ A;  3VK6 A;  4O64 A;  2C2V S;  2LXP C;  2RI7 A;  3O7A A;  5LKX A;  4A4C A;  1WEV A;  1VD4 A;  1IYM A;  3M99 A;  4YBM A;  1WEE A;  3PHD A;  2Y1M A;  3SOX A;  1WFK A;  2RSD A;  3RPG C;  3O70 A;  4WZ0 A;  2ECG A;  1VYX A;  3O33 A;  2JMD A;  1WEM A;  1Z6U A;  4GND A;  2EOD A;  2VP7 A;  4FO9 A;  5D1M B;  3HCT A;  2K16 A;  1HYI A;  1FBV A;  2KIZ A;  5FEY A;  1JM7 B;  2VJE B;  5B78 A;  3ZNI A;  2LDR A;  2ZET C;  4A4B A;  3L1Z B;  5B75 A;  2VPD A;  2QIZ A;  4V3L C;  2LV9 A;  2Y1N A;  4GNF A;  5TAB A;  1Z60 A;  3NG2 A;  5B76 A;  2LXH C;  2NAA A;  3SHB A;  4QF2 A;  4AYC A;  1WEQ A;  4YC9 A;  2I50 A;  4FJC A;  3KV5 A;  1T1H A;  1XWH A;  4I7C A;  5G04 B;  2LGV A;  2MD7 B;  1V87 A;  2ECW A;  2EA6 A;  5TDR A;  5KH3 A;  2KWO A;  2G45 A;  2YSM A;  4XI1 A;  3RTR B;  5KH7 A;  5EYA F;  5C11 A;  2L75 A;  2JMJ A;  4TKP B;  3RPG B;  2LGG A;  4X3G A;  4YBT A;  3EB6 A;  4W4U A;  2H0D B;  3LQI A;  3ZPV 1;  5H1V A;  3MHS A;  5LKU A;  4IC2 A;  5TDW A;  2CT2 A;  1WE9 A;  2KYU A;  2K17 A;  2LGL A;  2FUI A;  2CKL B;  2CSY A;  2E6S A;  3I2D A;  5JG6 A;  1N87 A;  1WEW A;  4ZUX U;  2LQ6 A;  1JM7 A;  2K1J A;  2VJE A;  2LGK A;  2L43 A;  5G0F A;  3ZVZ B;  2KU3 A;  4LAD B;  3GV4 A;  5D1L B;  2K4D A;  2MA5 A;  3ZYQ A;  3QZV A;  5H1T A;  3C5K A;  2F6N A;  3L1X A;  5B8D A;  4I7B A;  2ECT A;  2YT5 A;  3U5O A;  2OXQ C;  2KE1 A;  4AUQ B;  1DVP A;  2HYE D;  1WIM A;  1K2F A;  4WA6 A;  2KRE A;  4LKA A;  4FIP A;  5AIU A;  4GNG A;  2YHN A;  3N9Q A;  4WZ3 B;  3L11 A;  4GNE A;  4A0C D;  2VJF B;  4CCG X;  5DKA A;  4MVT A;  2MA6 A;  5FB0 A;  3V43 A;  1F62 A;  1WEU A;  2YQM A;  3IHP A;  3MHH A;  4S3O C;  2FSA A;  5LCW B;  2YYR A;  2CSZ A;  5B79 A;  2H0D A;  2VPG A;  4QF3 A;  5G05 B;  4LJN A;  4BBQ A;  1U6G B;  5H9M A;  3GL6 A;  2KR4 A;  2XEU A;  2YU4 A;  3T7L A;  2CKL A;  1FP0 A;  3M62 A;  1LDK C;  1MM2 A;  2M1R A;  5LKZ A;  2G43 A;  2YQL A;  4P5O B;  2KWN A;  3ZPV E;  3N9L A;  2ECN A;  4ZQL A;  3KNV A;  1WEN A;  3LQJ A;  2LN0 A;  2DX8 A;  1ZBD B;  2L5U A;  4C9Z A;  1VFY A;  4L7X A;  4F52 B;  2F42 A;  2UZG A;  5AIT A;  3DQV R;  1X4J A;  4ZDT A;  2ECI A;  4B7Y C;  3PUQ A;  3N9O A;  4A49 A;  2L80 A;  2HDP A;  2E6R A;  2YSJ A;  2KWK A;  3HCU A;  1X4I A;  4L58 A;  3KV6 A;  2VNF A;  1E4U A;  2M6M A;  2MUM A;  1WES A;  2JMI A;  4B86 C;  4R8P K;  3U5N A;  2VPE A;  4I7D A;  2JRJ A;  2M85 A;  4UP0 A;  3LRQ A;  2C2L A;  3PUR A;  2VJF A;  4PTB A;  1X4U A;  4YAX A;  4WZ2 A;  3ASL A;  2YUR A;  4FK5 A;  2MIQ A;  1HYJ A;  4GB0 A;  3O36 A;  1LDJ B;  2MNY A;  2D8S A;  2KFT A;  2KGG A;  4S3O B;  4YAB A;  3U5M A;  2G6Q A;  2QJ0 A;  3U5P A;  3M63 A;  3SOW A;  5B77 A;  5C13 A;  4Q6F A;  4YAD A;  4CA1 A;  3O37 A;  2L0B A;  5DIN A;  1CHC A;  2XB1 A;  1JOC A;  3HTK C;  3O35 A;  4UP5 A;  5TRB A;  2ECJ A;  3N9N A;  4AP4 A;  5LKT A;  2YW8 A;  2LRI C;  1BOR A;  4LK9 A;  4V3K C;  1WGM A;  5J3X A;  4YAT A;  4IC3 A;  3LQH A;  5TBN A;  2PUY A;  3ZTG A;  2AN6 A;  5FER A;  4BHW A;  3O34 A;  1WIL A;  3ZVY A;  1Z2Q A;  3FL2 A;  4N4F A;  2YHO A;  2F6J A;  5H1U A;  2VPB A;  2Y43 A;  4YBS A;  4NN2 A;  4MSX A;  2MT5 A;  4PPE A;  5I3L A;  2ECV A;  2M3H A;  3EB5 A;  3N9P A;  1MM3 A;  4R2Y A; 
#chains in the Genus database with same CATH topology
 3T6R A;  2BAY A;  2YRE A;  5FB1 A;  2MNZ A;  2QIC A;  2XOY A;  3KQI A;  2B0O E;  2YUC A;  3DPL R;  5D1K B;  4LLB A;  2FUU A;  3HCS A;  1RMD A;  4N3W A;  2CRW A;  3N9M A;  1WEP A;  1G25 A;  4R7E A;  2IDA A;  4UI9 B;  2EGP A;  3C6W A;  2MD8 C;  4QQ4 A;  3FAO A;  4AYC B;  3SOU A;  2PNX A;  2KGI A;  1WEO A;  5KH9 A;  4AVX A;  2KWJ A;  2RR4 A;  3VK6 A;  4O64 A;  2C2V S;  2LXP C;  2RI7 A;  3O7A A;  5LKX A;  4A4C A;  3PLW A;  1WEV A;  1VD4 A;  1IYM A;  3M99 A;  4YBM A;  1WEE A;  3PHD A;  2Y1M A;  5SVY A;  3O47 A;  3SOX A;  1WFK A;  2XOC A;  2RSD A;  3RPG C;  3LJU X;  3O70 A;  4WZ0 A;  2ECG A;  1VYX A;  2D8U A;  3FM8 C;  3O33 A;  2JMD A;  1WEM A;  1Z6U A;  4GND A;  2EOD A;  2VP7 A;  4FO9 A;  5D1M B;  3M7K A;  2LAU A;  3HCT A;  2K16 A;  1HYI A;  1FBV A;  2KIZ A;  5FEY A;  1JM7 B;  2VJE B;  5B78 A;  3ZNI A;  2LDR A;  2ZET C;  4A4B A;  3L1Z B;  5B75 A;  2VPD A;  2QIZ A;  4V3L C;  2LV9 A;  2Y1N A;  4GNF A;  5TAB A;  1Z60 A;  3NG2 A;  5B76 A;  2LXH C;  2NAA A;  3SHB A;  4QF2 A;  4AYC A;  1WEQ A;  2EGM A;  4YC9 A;  3H7H A;  2I50 A;  2OWA A;  4FJC A;  3KV5 A;  1T1H A;  1XWH A;  4I7C A;  5G04 B;  2LGV A;  2MD7 B;  3FJU B;  1V87 A;  2ECW A;  2KKY A;  2EA6 A;  5TDR A;  4F1P A;  5KH3 A;  2KWO A;  2G45 A;  2YSM A;  4XI1 A;  3RTR B;  5KH7 A;  5EYA F;  5C11 A;  2L75 A;  2JMJ A;  4TKP B;  3RPG B;  2LGG A;  4X3G A;  4YBT A;  3EB6 A;  4W4U A;  2H0D B;  3LQI A;  3ZPV 1;  5H1V A;  3JUE A;  3MHS A;  2JUN A;  5LKU A;  3LVR E;  4IC2 A;  5TDW A;  2CT2 A;  1WE9 A;  2KYU A;  2K17 A;  2LGL A;  2FUI A;  2CKL B;  2CSY A;  2E6S A;  3I2D A;  5JG6 A;  2XOZ A;  1N87 A;  1WEW A;  4ZUX U;  2LQ6 A;  2CSV A;  1JM7 A;  2K1J A;  2VJE A;  4OGC A;  2LGK A;  4OGE A;  1MBM A;  2L43 A;  5G0F A;  3ZVZ B;  2KU3 A;  4LAD B;  3GV4 A;  5D1L B;  2K4D A;  2MA5 A;  3ZYQ A;  3QZV A;  5H1T A;  3C5K A;  2F6N A;  2CRR A;  3L1X A;  5B8D A;  4I7B A;  2ECT A;  5K3Q A;  2YT5 A;  3U5O A;  2OXQ C;  2KE1 A;  4AUQ B;  1DVP A;  2HYE D;  1WIM A;  2FD4 A;  2P57 A;  4Z0R A;  3MDB C;  1K2F A;  4WA6 A;  2KRE A;  4LKA A;  4FIP A;  5AIU A;  4GNG A;  2YHN A;  3N9Q A;  4WZ3 B;  3L11 A;  4GNE A;  4A0C D;  2VJF B;  4CCG X;  5DKA A;  4MVT A;  2MA6 A;  5FB0 A;  3V43 A;  1F62 A;  1WEU A;  2YQM A;  3IHP A;  3MHH A;  4S3O C;  2FSA A;  5LCW B;  2YYR A;  2CSZ A;  5B79 A;  2H0D A;  2VPG A;  4QF3 A;  5G05 B;  3E2D A;  4LJN A;  4BBQ A;  1U6G B;  5H9M A;  3GL6 A;  2KR4 A;  2XEU A;  2YU4 A;  3T7L A;  2CKL A;  1FP0 A;  3M62 A;  3Q1D A;  1LDK C;  1MM2 A;  2M1R A;  5LKZ A;  2G43 A;  3SUB A;  2YQL A;  4P5O B;  2KWN A;  3ZPV E;  3N9L A;  2ECN A;  4ZQL A;  3LVQ E;  5SVI B;  3KNV A;  1WEN A;  3LQJ A;  2CON A;  2LN0 A;  2DX8 A;  1ZBD B;  2L5U A;  4C9Z A;  1VFY A;  2IQJ A;  4L7X A;  4F52 B;  2F42 A;  3KDE C;  2UZG A;  5AIT A;  3DQV R;  1X4J A;  4ZDT A;  2ECI A;  2E61 A;  3FAN A;  4B7Y C;  3PUQ A;  3N9O A;  4A49 A;  2L80 A;  2HDP A;  2KKX A;  2E6R A;  2YSJ A;  2KWK A;  2XP0 A;  3HCU A;  1X4I A;  4L58 A;  3KV6 A;  2VNF A;  1E4U A;  2M6M A;  2MUM A;  1WES A;  2JMI A;  4B86 C;  4R8P K;  3U5N A;  2VPE A;  4I7D A;  2JRJ A;  3FEH A;  2M85 A;  4UP0 A;  3LRQ A;  2C2L A;  3PUR A;  2VJF A;  4PTB A;  1X4U A;  4YAX A;  4WZ2 A;  3LDY A;  3ASL A;  2YUR A;  4FK5 A;  2MIQ A;  2L7P A;  1HYJ A;  4GB0 A;  3O36 A;  2EXU A;  1LDJ B;  2MNY A;  2D8S A;  2KFT A;  2KGG A;  4S3O B;  4H9D A;  4YAB A;  3U5M A;  2G6Q A;  2QJ0 A;  3U5P A;  3M63 A;  3DDT A;  2JM3 A;  3SOW A;  5B77 A;  5C13 A;  4Q6F A;  4YAD A;  4CA1 A;  3O37 A;  2L0B A;  5DIN A;  4Z0O A;  1CHC A;  2XB1 A;  1JOC A;  3HTK C;  3O35 A;  4UP5 A;  1DCQ A;  2MKE A;  5TRB A;  2ECJ A;  3N9N A;  5SVI A;  4AP4 A;  5LKT A;  2DJA A;  2YW8 A;  2LRI C;  1BOR A;  4LK9 A;  4V3K C;  1WGM A;  5J3X A;  4YAT A;  2M13 A;  2FFW A;  4IC3 A;  3LQH A;  4O62 A;  5TBN A;  2PUY A;  2YVR A;  3DWD A;  2DSM A;  3ZTG A;  2AN6 A;  5FER A;  4BHW A;  3O34 A;  1WIL A;  3ZVY A;  1Z2Q A;  3FL2 A;  4N4F A;  2YHO A;  2F6J A;  5H1U A;  2VPB A;  5SVX A;  2Y43 A;  4YBS A;  4NN2 A;  4MSX A;  2MT5 A;  4PPE A;  5I3L A;  2ECV A;  2M3H A;  3EB5 A;  3T9K A;  3N9P A;  1MM3 A;  4R2Y A; 
#chains in the Genus database with same CATH homology
 3T6R A;  2BAY A;  2YRE A;  5FB1 A;  2MNZ A;  2QIC A;  3KQI A;  2YUC A;  3DPL R;  5D1K B;  4LLB A;  2FUU A;  3HCS A;  1RMD A;  4N3W A;  3N9M A;  1WEP A;  1G25 A;  4R7E A;  2IDA A;  4UI9 B;  2EGP A;  3C6W A;  2MD8 C;  4AYC B;  3SOU A;  2PNX A;  2KGI A;  1WEO A;  5KH9 A;  4AVX A;  2KWJ A;  3VK6 A;  4O64 A;  2C2V S;  2LXP C;  2RI7 A;  3O7A A;  5LKX A;  4A4C A;  1WEV A;  1VD4 A;  1IYM A;  3M99 A;  4YBM A;  1WEE A;  3PHD A;  2Y1M A;  3SOX A;  1WFK A;  2RSD A;  3RPG C;  3O70 A;  4WZ0 A;  2ECG A;  1VYX A;  3O33 A;  2JMD A;  1WEM A;  1Z6U A;  4GND A;  2EOD A;  2VP7 A;  4FO9 A;  5D1M B;  3HCT A;  2K16 A;  1HYI A;  1FBV A;  2KIZ A;  5FEY A;  1JM7 B;  2VJE B;  5B78 A;  3ZNI A;  2LDR A;  2ZET C;  4A4B A;  3L1Z B;  5B75 A;  2VPD A;  2QIZ A;  4V3L C;  2LV9 A;  2Y1N A;  4GNF A;  5TAB A;  1Z60 A;  3NG2 A;  5B76 A;  2LXH C;  2NAA A;  3SHB A;  4QF2 A;  4AYC A;  1WEQ A;  4YC9 A;  2I50 A;  4FJC A;  3KV5 A;  1T1H A;  1XWH A;  4I7C A;  5G04 B;  2LGV A;  2MD7 B;  1V87 A;  2ECW A;  2EA6 A;  5TDR A;  5KH3 A;  2KWO A;  2G45 A;  2YSM A;  4XI1 A;  3RTR B;  5KH7 A;  5EYA F;  5C11 A;  2L75 A;  2JMJ A;  4TKP B;  3RPG B;  2LGG A;  4X3G A;  4YBT A;  3EB6 A;  4W4U A;  2H0D B;  3LQI A;  3ZPV 1;  5H1V A;  3MHS A;  5LKU A;  4IC2 A;  5TDW A;  2CT2 A;  1WE9 A;  2KYU A;  2K17 A;  2LGL A;  2FUI A;  2CKL B;  2CSY A;  2E6S A;  3I2D A;  5JG6 A;  1N87 A;  1WEW A;  4ZUX U;  2LQ6 A;  1JM7 A;  2K1J A;  2VJE A;  2LGK A;  2L43 A;  5G0F A;  3ZVZ B;  2KU3 A;  4LAD B;  3GV4 A;  5D1L B;  2K4D A;  2MA5 A;  3ZYQ A;  3QZV A;  5H1T A;  3C5K A;  2F6N A;  3L1X A;  5B8D A;  4I7B A;  2ECT A;  2YT5 A;  3U5O A;  2OXQ C;  2KE1 A;  4AUQ B;  1DVP A;  2HYE D;  1WIM A;  1K2F A;  4WA6 A;  2KRE A;  4LKA A;  4FIP A;  5AIU A;  4GNG A;  2YHN A;  3N9Q A;  4WZ3 B;  3L11 A;  4GNE A;  4A0C D;  2VJF B;  4CCG X;  5DKA A;  4MVT A;  2MA6 A;  5FB0 A;  3V43 A;  1F62 A;  1WEU A;  2YQM A;  3IHP A;  3MHH A;  4S3O C;  2FSA A;  5LCW B;  2YYR A;  2CSZ A;  5B79 A;  2H0D A;  2VPG A;  4QF3 A;  5G05 B;  4LJN A;  4BBQ A;  1U6G B;  5H9M A;  3GL6 A;  2KR4 A;  2XEU A;  2YU4 A;  3T7L A;  2CKL A;  1FP0 A;  3M62 A;  1LDK C;  1MM2 A;  2M1R A;  5LKZ A;  2G43 A;  2YQL A;  4P5O B;  2KWN A;  3ZPV E;  3N9L A;  2ECN A;  4ZQL A;  3KNV A;  1WEN A;  3LQJ A;  2LN0 A;  2DX8 A;  1ZBD B;  2L5U A;  4C9Z A;  1VFY A;  4L7X A;  4F52 B;  2F42 A;  2UZG A;  5AIT A;  3DQV R;  1X4J A;  4ZDT A;  2ECI A;  4B7Y C;  3PUQ A;  3N9O A;  4A49 A;  2L80 A;  2HDP A;  2E6R A;  2YSJ A;  2KWK A;  3HCU A;  1X4I A;  4L58 A;  3KV6 A;  2VNF A;  1E4U A;  2M6M A;  2MUM A;  1WES A;  2JMI A;  4B86 C;  4R8P K;  3U5N A;  2VPE A;  4I7D A;  2JRJ A;  2M85 A;  4UP0 A;  3LRQ A;  2C2L A;  3PUR A;  2VJF A;  4PTB A;  1X4U A;  4YAX A;  4WZ2 A;  3ASL A;  2YUR A;  4FK5 A;  2MIQ A;  1HYJ A;  4GB0 A;  3O36 A;  1LDJ B;  2MNY A;  2D8S A;  2KFT A;  2KGG A;  4S3O B;  4YAB A;  3U5M A;  2G6Q A;  2QJ0 A;  3U5P A;  3M63 A;  3SOW A;  5B77 A;  5C13 A;  4Q6F A;  4YAD A;  4CA1 A;  3O37 A;  2L0B A;  5DIN A;  1CHC A;  2XB1 A;  1JOC A;  3HTK C;  3O35 A;  4UP5 A;  5TRB A;  2ECJ A;  3N9N A;  4AP4 A;  5LKT A;  2YW8 A;  2LRI C;  1BOR A;  4LK9 A;  4V3K C;  1WGM A;  5J3X A;  4YAT A;  4IC3 A;  3LQH A;  5TBN A;  2PUY A;  3ZTG A;  2AN6 A;  5FER A;  4BHW A;  3O34 A;  1WIL A;  3ZVY A;  1Z2Q A;  3FL2 A;  4N4F A;  2YHO A;  2F6J A;  5H1U A;  2VPB A;  2Y43 A;  4YBS A;  4NN2 A;  4MSX A;  2MT5 A;  4PPE A;  5I3L A;  2ECV A;  2M3H A;  3EB5 A;  3N9P A;  1MM3 A;  4R2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...