2ECVA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of tripartite motif-containing protein 5
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
GSSGSSGMASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Tripartite motif-containing protein 5
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of Tripartite motif-containing protein 5
rcsb
source organism Homo sapiens
total genus 4
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecvA00
1FP0A 4GNGA 3VK6A 2H0DB 1LDKC 5B75A 3O34A 3PURA 3N9NA 4C9ZA 2EGPA 4LLBA 2LXHC 1JM7B 4PPEA 2YQLA 2MNZA 3HCUA 5B76A 1WIMA 2G6QA 2YSJA 4R2YA 3GV4A 2K16A 2LQ6A 4TKPB 3LQIA 1G25A 2LXPC 4F52B 5H1UA 4B7YC 4WZ3B 1WEEA 2EA6A 5H9MA 2KU3A 5J3XA 2Y1NA 3KNVA 2YU4A 3RTRB 5TABA 2YYRA 3EB6A 4V3LC 3ZTGA 2D8SA 3U5NA 2PUYA 1MM2A 2KGGA 3KV5A 1Z6UA 3M62A 1IYMA 2QIZA 2E6SA 4A49A 2HYED 1X4IA 1WEMA 1VYXA 3GL6A 2K17A 1Z2QA 2KYUA 3N9MA 2VJEA 2C2VS 5B79A 4FJCA 2NAAA 4GNDA 5G04B 2Y43A 2YT5A 4Q6FA 2G45A 1V87A 2YURA 2OXQC 2IDAA 4O64A 4I7BA 1T1HA 2EODA 5JG6A 3QZVA 5H1TA 3HCSA 3KQIA 3O33A 2AN6A 2CKLA 5G05B 2M1RA 2LGGA 2MT5A 4FIPA 1WESA 1X4UA 3LRQA 2F42A 3HCTA 3ZVYA 4CCGX 2YSMA 3T6RA 2LV9A 5C11A 2L43A 4YBMA 2ECWA 1WEOA 4GNFA 2MD7B 1RMDA 4IC2A 1WFKA 3SOXA 2VPGA 2YQMA 4MSXA 2MIQA 5TDRA 3V43A 2ECVA 5LKXA 1X4JA 2LDRA 1N87A 2KWKA 3ZVZB 4AUQB 3ZNIA 1HYIA 2VJEB 2CSYA 3ZYQA 4N4FA 2E6RA 2FSAA 2VJFA 5D1LB 4XI1A 4QF2A 3L1ZB 5FERA 1WENA 3U5MA 4ZDTA 2JRJA 4GNEA 1XWHA 3NG2A 2K4DA 4UP5A 1WEPA 1WEWA 2YUCA 3L1XA 2M3HA 4LK9A 4WA6A 1HYJA 2KIZA 2HDPA 3I2DA 4YAXA 2MUMA 3N9QA 4A4CA 4AYCB 3O70A 5FB0A 2L0BA 2K1JA 2CKLB 2CSZA 3LQJA 2KR4A 4I7CA 1WILA 5LCWB 3PUQA 2YREA 5G0FA 2KWJA 1U6GB 1BORA 3LQHA 1MM3A 3N9PA 3DQVR 1LDJB 1WEVA 4L7XA 2VNFA 4YADA 2VPDA 4CA1A 2ECTA 2XEUA 4A4BA 1VFYA 2Y1MA 4I7DA 1F62A 3PHDA 5H1VA 2M6MA 3RPGB 4A0CD 4YATA 4BBQA 4WZ2A 5DINA 4AVXA 1CHCA 3U5PA 2FUIA 5FB1A 5LKTA 4BHWA 2YW8A 2L5UA 2KFTA 5B77A 2ECJA 2CT2A 2I50A 3M99A 2RSDA 2JMDA 2LN0A 3ASLA 3SOUA 2L80A 2PNXA 1K2FA 4LADB 5AITA 3MHHA 2KE1A 5DKAA 5EYAF 4L58A 5B78A 3EB5A 3KV6A 4P5OB 3MHSA 2JMIA 2MNYA 4YBTA 4W4UA 4B86C 5TRBA 3SHBA 3U5OA 3ZPV1 2BAYA 2QICA 4GB0A 5LKUA 4WZ0A 3O35A 2LGKA 2RI7A 2MA5A 5TBNA 4R8PK 5B8DA 1E4UA 3N9LA 4FO9A 2ECNA 4UP0A 2VPEA 5D1MB 3HTKC 2VP7A 2ECIA 2C2LA 4NN2A 1WEUA 2FUUA 3IHPA 2JMJA 4PTBA 4UI9B 1VD4A 3DPLR 3N9OA 1WEQA 3C6WA 2KGIA 4MVTA 3SOWA 3FL2A 1WGMA 1JOCA 2H0DA 4V3KC 5KH7A 4FK5A 2ECGA 2LGLA 2KWOA 2F6NA 1JM7A 3O36A 1WE9A 2LGVA 2ZETC 4AP4A 3C5KA 2MD8C 4LKAA 2MA6A 4IC3A 1ZBDB 3M63A 4ZQLA 3RPGC 2DX8A 4N3WA 4ZUXU 2YHOA 4X3GA 2KWNA 4LJNA 2VPBA 2VJFB 5D1KB 4YBSA 5I3LA 2UZGA 2G43A 5KH3A 4S3OC 5TDWA 2KREA 4S3OB 5FEYA 5LKZA 3O7AA 3ZPVE 5C13A 2M85A 3O37A 5AIUA 4AYCA 4QF3A 4R7EA 2L75A 2LRIC 4YABA 2F6JA 2YHNA 3L11A 4YC9A 1Z60A 1DVPA 5KH9A 1FBVA 2QJ0A 3T7LA 2XB1A
chains in the Genus database with same CATH superfamily
1FP0A 4GNGA 3VK6A 2H0DB 1LDKC 5B75A 3O34A 3PURA 3DWDA 3N9NA 4C9ZA 2EGPA 4LLBA 2LXHC 1JM7B 4PPEA 2MKEA 2MNZA 2YQLA 3HCUA 5B76A 1WIMA 2G6QA 2YSJA 4R2YA 2EGMA 3GV4A 2K16A 2LQ6A 4TKPB 3FJUB 3LQIA 1G25A 2LXPC 4F52B 5H1UA 4B7YC 4WZ3B 1WEEA 2EA6A 5H9MA 4Z0OA 2KU3A 5J3XA 3LVQE 2CRWA 2Y1NA 3KNVA 2YU4A 3RTRB 3JUEA 5TABA 2YYRA 3EB6A 4V3LC 3O47A 3ZTGA 2D8SA 3U5NA 3PLWA 4H9DA 2PUYA 1MM2A 2P57A 2KGGA 3DDTA 1Z6UA 3FM8C 3KV5A 3M62A 1IYMA 2QIZA 2E6SA 4A49A 2HYED 4O62A 1X4IA 1WEMA 1VYXA 3LVRE 3GL6A 2K17A 1Z2QA 2KYUA 3N9MA 2JM3A 2VJEA 2C2VS 5B79A 4FJCA 2NAAA 4GNDA 5G04B 2Y43A 2CSVA 3H7HA 2YT5A 4Q6FA 2G45A 1V87A 2YURA 2OXQC 2IDAA 4O64A 4I7BA 1T1HA 2EODA 5JG6A 3QZVA 5H1TA 3HCSA 3KQIA 3O33A 2AN6A 2CKLA 5G05B 2M1RA 2LGGA 2MT5A 4FIPA 1WESA 1X4UA 3LRQA 2F42A 3HCTA 3MDBC 2M13A 3E2DA 3ZVYA 4CCGX 2KKYA 2YSMA 3T6RA 2LV9A 5SVIA 5C11A 2XP0A 2L43A 2CRRA 4YBMA 3FAOA 2ECWA 1WEOA 4GNFA 2E61A 2MD7B 1RMDA 2L7PA 3T9KA 4IC2A 1WFKA 3SOXA 2VPGA 2YQMA 4MSXA 2MIQA 5TDRA 3V43A 2ECVA 5LKXA 1X4JA 2LDRA 1N87A 2KKXA 2KWKA 3ZVZB 1DCQA 4AUQB 3ZNIA 1HYIA 2VJEB 2CSYA 3ZYQA 4N4FA 2E6RA 2FSAA 2VJFA 5D1LB 4XI1A 4QF2A 3L1ZB 5FERA 1WENA 4ZDTA 3U5MA 4GNEA 2JRJA 1XWHA 3NG2A 2K4DA 5SVYA 4UP5A 1WEPA 1WEWA 2YUCA 3L1XA 2M3HA 4LK9A 4WA6A 1HYJA 2KIZA 2HDPA 3I2DA 2IQJA 4YAXA 2MUMA 3N9QA 4A4CA 4AYCB 3O70A 5FB0A 2L0BA 2K1JA 2CKLB 2CSZA 3Q1DA 3LQJA 2KR4A 4I7CA 1WILA 5LCWB 3FANA 3PUQA 2YREA 5G0FA 2KWJA 1U6GB 1BORA 3LQHA 1MM3A 3LJUX 3N9PA 3DQVR 1LDJB 3M7KA 5SVIB 2D8UA 4OGCA 1WEVA 4L7XA 2VNFA 4YADA 2VPDA 4CA1A 2ECTA 2XEUA 4A4BA 1VFYA 2Y1MA 4I7DA 1F62A 3PHDA 5H1VA 2M6MA 3RPGB 4A0CD 4YATA 4BBQA 4WZ2A 5DINA 4OGEA 4AVXA 1CHCA 2LAUA 3U5PA 2FUIA 5FB1A 5LKTA 4BHWA 2YW8A 4Z0RA 2L5UA 2KFTA 5B77A 2ECJA 4F1PA 2CT2A 2I50A 3M99A 2XOZA 2RSDA 2JMDA 2LN0A 2JUNA 3ASLA 3SOUA 2L80A 2PNXA 1K2FA 4LADB 5AITA 3MHHA 2KE1A 5DKAA 5EYAF 4L58A 2YVRA 5B78A 3EB5A 3KV6A 4P5OB 3MHSA 2JMIA 2MNYA 4YBTA 4W4UA 4B86C 5TRBA 3SHBA 3U5OA 2FD4A 3ZPV1 2BAYA 2QICA 4GB0A 5LKUA 2XOYA 4WZ0A 3O35A 2LGKA 2RI7A 2MA5A 5TBNA 4R8PK 5B8DA 2EXUA 1E4UA 3N9LA 4FO9A 3SUBA 2ECNA 3KDEC 4UP0A 2VPEA 5D1MB 3HTKC 5SVXA 2VP7A 2ECIA 2C2LA 4NN2A 1WEUA 2FUUA 3IHPA 2JMJA 3FEHA 4PTBA 4UI9B 1VD4A 3DPLR 3N9OA 1WEQA 3C6WA 2XOCA 2KGIA 4MVTA 3SOWA 3FL2A 1WGMA 1JOCA 2H0DA 4V3KC 5KH7A 2DJAA 4FK5A 2DSMA 2ECGA 2LGLA 2KWOA 2F6NA 5K3QA 1JM7A 3O36A 1WE9A 2LGVA 2ZETC 4AP4A 3C5KA 2MD8C 4LKAA 2MA6A 4IC3A 1ZBDB 3M63A 4ZQLA 3RPGC 2CONA 2DX8A 4N3WA 4ZUXU 3LDYA 4QQ4A 2YHOA 4X3GA 2FFWA 4LJNA 2KWNA 2VPBA 2VJFB 1MBMA 5D1KB 4YBSA 5I3LA 2UZGA 2G43A 5KH3A 2B0OE 4S3OC 5TDWA 2KREA 4S3OB 5FEYA 5LKZA 3O7AA 2RR4A 3ZPVE 5C13A 2M85A 3O37A 5AIUA 4AYCA 2OWAA 4QF3A 4R7EA 2L75A 2LRIC 4YABA 2F6JA 2YHNA 3L11A 4YC9A 1Z60A 1DVPA 5KH9A 1FBVA 2QJ0A 3T7LA 2XB1A
chains in the Genus database with same CATH topology
1FP0A 4GNGA 3VK6A 2H0DB 1LDKC 5B75A 3O34A 3PURA 3N9NA 4C9ZA 2EGPA 4LLBA 2LXHC 1JM7B 4PPEA 2YQLA 2MNZA 3HCUA 5B76A 1WIMA 2G6QA 2YSJA 4R2YA 3GV4A 2K16A 2LQ6A 4TKPB 3LQIA 1G25A 2LXPC 4F52B 5H1UA 4B7YC 4WZ3B 1WEEA 2EA6A 5H9MA 2KU3A 5J3XA 2Y1NA 3KNVA 2YU4A 3RTRB 5TABA 2YYRA 3EB6A 4V3LC 3ZTGA 2D8SA 3U5NA 2PUYA 1MM2A 2KGGA 3KV5A 1Z6UA 3M62A 1IYMA 2QIZA 2E6SA 4A49A 2HYED 1X4IA 1WEMA 1VYXA 3GL6A 2K17A 1Z2QA 2KYUA 3N9MA 2VJEA 2C2VS 5B79A 4FJCA 2NAAA 4GNDA 5G04B 2Y43A 2YT5A 4Q6FA 2G45A 1V87A 2YURA 2OXQC 2IDAA 4O64A 4I7BA 1T1HA 2EODA 5JG6A 3QZVA 5H1TA 3HCSA 3KQIA 3O33A 2AN6A 2CKLA 5G05B 2M1RA 2LGGA 2MT5A 4FIPA 1WESA 1X4UA 3LRQA 2F42A 3HCTA 3ZVYA 4CCGX 2YSMA 3T6RA 2LV9A 5C11A 2L43A 4YBMA 2ECWA 1WEOA 4GNFA 2MD7B 1RMDA 4IC2A 1WFKA 3SOXA 2VPGA 2YQMA 4MSXA 2MIQA 5TDRA 3V43A 2ECVA 5LKXA 1X4JA 2LDRA 1N87A 2KWKA 3ZVZB 4AUQB 3ZNIA 1HYIA 2VJEB 2CSYA 3ZYQA 4N4FA 2E6RA 2FSAA 2VJFA 5D1LB 4XI1A 4QF2A 3L1ZB 5FERA 1WENA 3U5MA 4ZDTA 2JRJA 4GNEA 1XWHA 3NG2A 2K4DA 4UP5A 1WEPA 1WEWA 2YUCA 3L1XA 2M3HA 4LK9A 4WA6A 1HYJA 2KIZA 2HDPA 3I2DA 4YAXA 2MUMA 3N9QA 4A4CA 4AYCB 3O70A 5FB0A 2L0BA 2K1JA 2CKLB 2CSZA 3LQJA 2KR4A 4I7CA 1WILA 5LCWB 3PUQA 2YREA 5G0FA 2KWJA 1U6GB 1BORA 3LQHA 1MM3A 3N9PA 3DQVR 1LDJB 1WEVA 4L7XA 2VNFA 4YADA 2VPDA 4CA1A 2ECTA 2XEUA 4A4BA 1VFYA 2Y1MA 4I7DA 1F62A 3PHDA 5H1VA 2M6MA 3RPGB 4A0CD 4YATA 4BBQA 4WZ2A 5DINA 4AVXA 1CHCA 3U5PA 2FUIA 5FB1A 5LKTA 4BHWA 2YW8A 2L5UA 2KFTA 5B77A 2ECJA 2CT2A 2I50A 3M99A 2RSDA 2JMDA 2LN0A 3ASLA 3SOUA 2L80A 2PNXA 1K2FA 4LADB 5AITA 3MHHA 2KE1A 5DKAA 5EYAF 4L58A 5B78A 3EB5A 3KV6A 4P5OB 3MHSA 2JMIA 2MNYA 4YBTA 4W4UA 4B86C 5TRBA 3SHBA 3U5OA 3ZPV1 2BAYA 2QICA 4GB0A 5LKUA 4WZ0A 3O35A 2LGKA 2RI7A 2MA5A 5TBNA 4R8PK 5B8DA 1E4UA 3N9LA 4FO9A 2ECNA 4UP0A 2VPEA 5D1MB 3HTKC 2VP7A 2ECIA 2C2LA 4NN2A 1WEUA 2FUUA 3IHPA 2JMJA 4PTBA 4UI9B 1VD4A 3DPLR 3N9OA 1WEQA 3C6WA 2KGIA 4MVTA 3SOWA 3FL2A 1WGMA 1JOCA 2H0DA 4V3KC 5KH7A 4FK5A 2ECGA 2LGLA 2KWOA 2F6NA 1JM7A 3O36A 1WE9A 2LGVA 2ZETC 4AP4A 3C5KA 2MD8C 4LKAA 2MA6A 4IC3A 1ZBDB 3M63A 4ZQLA 3RPGC 2DX8A 4N3WA 4ZUXU 2YHOA 4X3GA 2KWNA 4LJNA 2VPBA 2VJFB 5D1KB 4YBSA 5I3LA 2UZGA 2G43A 5KH3A 4S3OC 5TDWA 2KREA 4S3OB 5FEYA 5LKZA 3O7AA 3ZPVE 5C13A 2M85A 3O37A 5AIUA 4AYCA 4QF3A 4R7EA 2L75A 2LRIC 4YABA 2F6JA 2YHNA 3L11A 4YC9A 1Z60A 1DVPA 5KH9A 1FBVA 2QJ0A 3T7LA 2XB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FP0 A;  4GNG A;  3VK6 A;  2H0D B;  1LDK C;  5B75 A;  3O34 A;  3PUR A;  3N9N A;  4C9Z A;  2EGP A;  4LLB A;  2LXH C;  1JM7 B;  4PPE A;  2YQL A;  2MNZ A;  3HCU A;  5B76 A;  1WIM A;  2G6Q A;  2YSJ A;  4R2Y A;  3GV4 A;  2K16 A;  2LQ6 A;  4TKP B;  3LQI A;  1G25 A;  2LXP C;  4F52 B;  5H1U A;  4B7Y C;  4WZ3 B;  1WEE A;  2EA6 A;  5H9M A;  2KU3 A;  5J3X A;  2Y1N A;  3KNV A;  2YU4 A;  3RTR B;  5TAB A;  2YYR A;  3EB6 A;  4V3L C;  3ZTG A;  2D8S A;  3U5N A;  2PUY A;  1MM2 A;  2KGG A;  3KV5 A;  1Z6U A;  3M62 A;  1IYM A;  2QIZ A;  2E6S A;  4A49 A;  2HYE D;  1X4I A;  1WEM A;  1VYX A;  3GL6 A;  2K17 A;  1Z2Q A;  2KYU A;  3N9M A;  2VJE A;  2C2V S;  5B79 A;  4FJC A;  2NAA A;  4GND A;  5G04 B;  2Y43 A;  2YT5 A;  4Q6F A;  2G45 A;  1V87 A;  2YUR A;  2OXQ C;  2IDA A;  4O64 A;  4I7B A;  1T1H A;  2EOD A;  5JG6 A;  3QZV A;  5H1T A;  3HCS A;  3KQI A;  3O33 A;  2AN6 A;  2CKL A;  5G05 B;  2M1R A;  2LGG A;  2MT5 A;  4FIP A;  1WES A;  1X4U A;  3LRQ A;  2F42 A;  3HCT A;  3ZVY A;  4CCG X;  2YSM A;  3T6R A;  2LV9 A;  5C11 A;  2L43 A;  4YBM A;  2ECW A;  1WEO A;  4GNF A;  2MD7 B;  1RMD A;  4IC2 A;  1WFK A;  3SOX A;  2VPG A;  2YQM A;  4MSX A;  2MIQ A;  5TDR A;  3V43 A;  2ECV A;  5LKX A;  1X4J A;  2LDR A;  1N87 A;  2KWK A;  3ZVZ B;  4AUQ B;  3ZNI A;  1HYI A;  2VJE B;  2CSY A;  3ZYQ A;  4N4F A;  2E6R A;  2FSA A;  2VJF A;  5D1L B;  4XI1 A;  4QF2 A;  3L1Z B;  5FER A;  1WEN A;  3U5M A;  4ZDT A;  2JRJ A;  4GNE A;  1XWH A;  3NG2 A;  2K4D A;  4UP5 A;  1WEP A;  1WEW A;  2YUC A;  3L1X A;  2M3H A;  4LK9 A;  4WA6 A;  1HYJ A;  2KIZ A;  2HDP A;  3I2D A;  4YAX A;  2MUM A;  3N9Q A;  4A4C A;  4AYC B;  3O70 A;  5FB0 A;  2L0B A;  2K1J A;  2CKL B;  2CSZ A;  3LQJ A;  2KR4 A;  4I7C A;  1WIL A;  5LCW B;  3PUQ A;  2YRE A;  5G0F A;  2KWJ A;  1U6G B;  1BOR A;  3LQH A;  1MM3 A;  3N9P A;  3DQV R;  1LDJ B;  1WEV A;  4L7X A;  2VNF A;  4YAD A;  2VPD A;  4CA1 A;  2ECT A;  2XEU A;  4A4B A;  1VFY A;  2Y1M A;  4I7D A;  1F62 A;  3PHD A;  5H1V A;  2M6M A;  3RPG B;  4A0C D;  4YAT A;  4BBQ A;  4WZ2 A;  5DIN A;  4AVX A;  1CHC A;  3U5P A;  2FUI A;  5FB1 A;  5LKT A;  4BHW A;  2YW8 A;  2L5U A;  2KFT A;  5B77 A;  2ECJ A;  2CT2 A;  2I50 A;  3M99 A;  2RSD A;  2JMD A;  2LN0 A;  3ASL A;  3SOU A;  2L80 A;  2PNX A;  1K2F A;  4LAD B;  5AIT A;  3MHH A;  2KE1 A;  5DKA A;  5EYA F;  4L58 A;  5B78 A;  3EB5 A;  3KV6 A;  4P5O B;  3MHS A;  2JMI A;  2MNY A;  4YBT A;  4W4U A;  4B86 C;  5TRB A;  3SHB A;  3U5O A;  3ZPV 1;  2BAY A;  2QIC A;  4GB0 A;  5LKU A;  4WZ0 A;  3O35 A;  2LGK A;  2RI7 A;  2MA5 A;  5TBN A;  4R8P K;  5B8D A;  1E4U A;  3N9L A;  4FO9 A;  2ECN A;  4UP0 A;  2VPE A;  5D1M B;  3HTK C;  2VP7 A;  2ECI A;  2C2L A;  4NN2 A;  1WEU A;  2FUU A;  3IHP A;  2JMJ A;  4PTB A;  4UI9 B;  1VD4 A;  3DPL R;  3N9O A;  1WEQ A;  3C6W A;  2KGI A;  4MVT A;  3SOW A;  3FL2 A;  1WGM A;  1JOC A;  2H0D A;  4V3K C;  5KH7 A;  4FK5 A;  2ECG A;  2LGL A;  2KWO A;  2F6N A;  1JM7 A;  3O36 A;  1WE9 A;  2LGV A;  2ZET C;  4AP4 A;  3C5K A;  2MD8 C;  4LKA A;  2MA6 A;  4IC3 A;  1ZBD B;  3M63 A;  4ZQL A;  3RPG C;  2DX8 A;  4N3W A;  4ZUX U;  2YHO A;  4X3G A;  2KWN A;  4LJN A;  2VPB A;  2VJF B;  5D1K B;  4YBS A;  5I3L A;  2UZG A;  2G43 A;  5KH3 A;  4S3O C;  5TDW A;  2KRE A;  4S3O B;  5FEY A;  5LKZ A;  3O7A A;  3ZPV E;  5C13 A;  2M85 A;  3O37 A;  5AIU A;  4AYC A;  4QF3 A;  4R7E A;  2L75 A;  2LRI C;  4YAB A;  2F6J A;  2YHN A;  3L11 A;  4YC9 A;  1Z60 A;  1DVP A;  5KH9 A;  1FBV A;  2QJ0 A;  3T7L A;  2XB1 A; 
#chains in the Genus database with same CATH topology
 1FP0 A;  4GNG A;  3VK6 A;  2H0D B;  1LDK C;  5B75 A;  3O34 A;  3PUR A;  3DWD A;  3N9N A;  4C9Z A;  2EGP A;  4LLB A;  2LXH C;  1JM7 B;  4PPE A;  2MKE A;  2MNZ A;  2YQL A;  3HCU A;  5B76 A;  1WIM A;  2G6Q A;  2YSJ A;  4R2Y A;  2EGM A;  3GV4 A;  2K16 A;  2LQ6 A;  4TKP B;  3FJU B;  3LQI A;  1G25 A;  2LXP C;  4F52 B;  5H1U A;  4B7Y C;  4WZ3 B;  1WEE A;  2EA6 A;  5H9M A;  4Z0O A;  2KU3 A;  5J3X A;  3LVQ E;  2CRW A;  2Y1N A;  3KNV A;  2YU4 A;  3RTR B;  3JUE A;  5TAB A;  2YYR A;  3EB6 A;  4V3L C;  3O47 A;  3ZTG A;  2D8S A;  3U5N A;  3PLW A;  4H9D A;  2PUY A;  1MM2 A;  2P57 A;  2KGG A;  3DDT A;  1Z6U A;  3FM8 C;  3KV5 A;  3M62 A;  1IYM A;  2QIZ A;  2E6S A;  4A49 A;  2HYE D;  4O62 A;  1X4I A;  1WEM A;  1VYX A;  3LVR E;  3GL6 A;  2K17 A;  1Z2Q A;  2KYU A;  3N9M A;  2JM3 A;  2VJE A;  2C2V S;  5B79 A;  4FJC A;  2NAA A;  4GND A;  5G04 B;  2Y43 A;  2CSV A;  3H7H A;  2YT5 A;  4Q6F A;  2G45 A;  1V87 A;  2YUR A;  2OXQ C;  2IDA A;  4O64 A;  4I7B A;  1T1H A;  2EOD A;  5JG6 A;  3QZV A;  5H1T A;  3HCS A;  3KQI A;  3O33 A;  2AN6 A;  2CKL A;  5G05 B;  2M1R A;  2LGG A;  2MT5 A;  4FIP A;  1WES A;  1X4U A;  3LRQ A;  2F42 A;  3HCT A;  3MDB C;  2M13 A;  3E2D A;  3ZVY A;  4CCG X;  2KKY A;  2YSM A;  3T6R A;  2LV9 A;  5SVI A;  5C11 A;  2XP0 A;  2L43 A;  2CRR A;  4YBM A;  3FAO A;  2ECW A;  1WEO A;  4GNF A;  2E61 A;  2MD7 B;  1RMD A;  2L7P A;  3T9K A;  4IC2 A;  1WFK A;  3SOX A;  2VPG A;  2YQM A;  4MSX A;  2MIQ A;  5TDR A;  3V43 A;  2ECV A;  5LKX A;  1X4J A;  2LDR A;  1N87 A;  2KKX A;  2KWK A;  3ZVZ B;  1DCQ A;  4AUQ B;  3ZNI A;  1HYI A;  2VJE B;  2CSY A;  3ZYQ A;  4N4F A;  2E6R A;  2FSA A;  2VJF A;  5D1L B;  4XI1 A;  4QF2 A;  3L1Z B;  5FER A;  1WEN A;  4ZDT A;  3U5M A;  4GNE A;  2JRJ A;  1XWH A;  3NG2 A;  2K4D A;  5SVY A;  4UP5 A;  1WEP A;  1WEW A;  2YUC A;  3L1X A;  2M3H A;  4LK9 A;  4WA6 A;  1HYJ A;  2KIZ A;  2HDP A;  3I2D A;  2IQJ A;  4YAX A;  2MUM A;  3N9Q A;  4A4C A;  4AYC B;  3O70 A;  5FB0 A;  2L0B A;  2K1J A;  2CKL B;  2CSZ A;  3Q1D A;  3LQJ A;  2KR4 A;  4I7C A;  1WIL A;  5LCW B;  3FAN A;  3PUQ A;  2YRE A;  5G0F A;  2KWJ A;  1U6G B;  1BOR A;  3LQH A;  1MM3 A;  3LJU X;  3N9P A;  3DQV R;  1LDJ B;  3M7K A;  5SVI B;  2D8U A;  4OGC A;  1WEV A;  4L7X A;  2VNF A;  4YAD A;  2VPD A;  4CA1 A;  2ECT A;  2XEU A;  4A4B A;  1VFY A;  2Y1M A;  4I7D A;  1F62 A;  3PHD A;  5H1V A;  2M6M A;  3RPG B;  4A0C D;  4YAT A;  4BBQ A;  4WZ2 A;  5DIN A;  4OGE A;  4AVX A;  1CHC A;  2LAU A;  3U5P A;  2FUI A;  5FB1 A;  5LKT A;  4BHW A;  2YW8 A;  4Z0R A;  2L5U A;  2KFT A;  5B77 A;  2ECJ A;  4F1P A;  2CT2 A;  2I50 A;  3M99 A;  2XOZ A;  2RSD A;  2JMD A;  2LN0 A;  2JUN A;  3ASL A;  3SOU A;  2L80 A;  2PNX A;  1K2F A;  4LAD B;  5AIT A;  3MHH A;  2KE1 A;  5DKA A;  5EYA F;  4L58 A;  2YVR A;  5B78 A;  3EB5 A;  3KV6 A;  4P5O B;  3MHS A;  2JMI A;  2MNY A;  4YBT A;  4W4U A;  4B86 C;  5TRB A;  3SHB A;  3U5O A;  2FD4 A;  3ZPV 1;  2BAY A;  2QIC A;  4GB0 A;  5LKU A;  2XOY A;  4WZ0 A;  3O35 A;  2LGK A;  2RI7 A;  2MA5 A;  5TBN A;  4R8P K;  5B8D A;  2EXU A;  1E4U A;  3N9L A;  4FO9 A;  3SUB A;  2ECN A;  3KDE C;  4UP0 A;  2VPE A;  5D1M B;  3HTK C;  5SVX A;  2VP7 A;  2ECI A;  2C2L A;  4NN2 A;  1WEU A;  2FUU A;  3IHP A;  2JMJ A;  3FEH A;  4PTB A;  4UI9 B;  1VD4 A;  3DPL R;  3N9O A;  1WEQ A;  3C6W A;  2XOC A;  2KGI A;  4MVT A;  3SOW A;  3FL2 A;  1WGM A;  1JOC A;  2H0D A;  4V3K C;  5KH7 A;  2DJA A;  4FK5 A;  2DSM A;  2ECG A;  2LGL A;  2KWO A;  2F6N A;  5K3Q A;  1JM7 A;  3O36 A;  1WE9 A;  2LGV A;  2ZET C;  4AP4 A;  3C5K A;  2MD8 C;  4LKA A;  2MA6 A;  4IC3 A;  1ZBD B;  3M63 A;  4ZQL A;  3RPG C;  2CON A;  2DX8 A;  4N3W A;  4ZUX U;  3LDY A;  4QQ4 A;  2YHO A;  4X3G A;  2FFW A;  4LJN A;  2KWN A;  2VPB A;  2VJF B;  1MBM A;  5D1K B;  4YBS A;  5I3L A;  2UZG A;  2G43 A;  5KH3 A;  2B0O E;  4S3O C;  5TDW A;  2KRE A;  4S3O B;  5FEY A;  5LKZ A;  3O7A A;  2RR4 A;  3ZPV E;  5C13 A;  2M85 A;  3O37 A;  5AIU A;  4AYC A;  2OWA A;  4QF3 A;  4R7E A;  2L75 A;  2LRI C;  4YAB A;  2F6J A;  2YHN A;  3L11 A;  4YC9 A;  1Z60 A;  1DVP A;  5KH9 A;  1FBV A;  2QJ0 A;  3T7L A;  2XB1 A; 
#chains in the Genus database with same CATH homology
 1FP0 A;  4GNG A;  3VK6 A;  2H0D B;  1LDK C;  5B75 A;  3O34 A;  3PUR A;  3N9N A;  4C9Z A;  2EGP A;  4LLB A;  2LXH C;  1JM7 B;  4PPE A;  2YQL A;  2MNZ A;  3HCU A;  5B76 A;  1WIM A;  2G6Q A;  2YSJ A;  4R2Y A;  3GV4 A;  2K16 A;  2LQ6 A;  4TKP B;  3LQI A;  1G25 A;  2LXP C;  4F52 B;  5H1U A;  4B7Y C;  4WZ3 B;  1WEE A;  2EA6 A;  5H9M A;  2KU3 A;  5J3X A;  2Y1N A;  3KNV A;  2YU4 A;  3RTR B;  5TAB A;  2YYR A;  3EB6 A;  4V3L C;  3ZTG A;  2D8S A;  3U5N A;  2PUY A;  1MM2 A;  2KGG A;  3KV5 A;  1Z6U A;  3M62 A;  1IYM A;  2QIZ A;  2E6S A;  4A49 A;  2HYE D;  1X4I A;  1WEM A;  1VYX A;  3GL6 A;  2K17 A;  1Z2Q A;  2KYU A;  3N9M A;  2VJE A;  2C2V S;  5B79 A;  4FJC A;  2NAA A;  4GND A;  5G04 B;  2Y43 A;  2YT5 A;  4Q6F A;  2G45 A;  1V87 A;  2YUR A;  2OXQ C;  2IDA A;  4O64 A;  4I7B A;  1T1H A;  2EOD A;  5JG6 A;  3QZV A;  5H1T A;  3HCS A;  3KQI A;  3O33 A;  2AN6 A;  2CKL A;  5G05 B;  2M1R A;  2LGG A;  2MT5 A;  4FIP A;  1WES A;  1X4U A;  3LRQ A;  2F42 A;  3HCT A;  3ZVY A;  4CCG X;  2YSM A;  3T6R A;  2LV9 A;  5C11 A;  2L43 A;  4YBM A;  2ECW A;  1WEO A;  4GNF A;  2MD7 B;  1RMD A;  4IC2 A;  1WFK A;  3SOX A;  2VPG A;  2YQM A;  4MSX A;  2MIQ A;  5TDR A;  3V43 A;  2ECV A;  5LKX A;  1X4J A;  2LDR A;  1N87 A;  2KWK A;  3ZVZ B;  4AUQ B;  3ZNI A;  1HYI A;  2VJE B;  2CSY A;  3ZYQ A;  4N4F A;  2E6R A;  2FSA A;  2VJF A;  5D1L B;  4XI1 A;  4QF2 A;  3L1Z B;  5FER A;  1WEN A;  3U5M A;  4ZDT A;  2JRJ A;  4GNE A;  1XWH A;  3NG2 A;  2K4D A;  4UP5 A;  1WEP A;  1WEW A;  2YUC A;  3L1X A;  2M3H A;  4LK9 A;  4WA6 A;  1HYJ A;  2KIZ A;  2HDP A;  3I2D A;  4YAX A;  2MUM A;  3N9Q A;  4A4C A;  4AYC B;  3O70 A;  5FB0 A;  2L0B A;  2K1J A;  2CKL B;  2CSZ A;  3LQJ A;  2KR4 A;  4I7C A;  1WIL A;  5LCW B;  3PUQ A;  2YRE A;  5G0F A;  2KWJ A;  1U6G B;  1BOR A;  3LQH A;  1MM3 A;  3N9P A;  3DQV R;  1LDJ B;  1WEV A;  4L7X A;  2VNF A;  4YAD A;  2VPD A;  4CA1 A;  2ECT A;  2XEU A;  4A4B A;  1VFY A;  2Y1M A;  4I7D A;  1F62 A;  3PHD A;  5H1V A;  2M6M A;  3RPG B;  4A0C D;  4YAT A;  4BBQ A;  4WZ2 A;  5DIN A;  4AVX A;  1CHC A;  3U5P A;  2FUI A;  5FB1 A;  5LKT A;  4BHW A;  2YW8 A;  2L5U A;  2KFT A;  5B77 A;  2ECJ A;  2CT2 A;  2I50 A;  3M99 A;  2RSD A;  2JMD A;  2LN0 A;  3ASL A;  3SOU A;  2L80 A;  2PNX A;  1K2F A;  4LAD B;  5AIT A;  3MHH A;  2KE1 A;  5DKA A;  5EYA F;  4L58 A;  5B78 A;  3EB5 A;  3KV6 A;  4P5O B;  3MHS A;  2JMI A;  2MNY A;  4YBT A;  4W4U A;  4B86 C;  5TRB A;  3SHB A;  3U5O A;  3ZPV 1;  2BAY A;  2QIC A;  4GB0 A;  5LKU A;  4WZ0 A;  3O35 A;  2LGK A;  2RI7 A;  2MA5 A;  5TBN A;  4R8P K;  5B8D A;  1E4U A;  3N9L A;  4FO9 A;  2ECN A;  4UP0 A;  2VPE A;  5D1M B;  3HTK C;  2VP7 A;  2ECI A;  2C2L A;  4NN2 A;  1WEU A;  2FUU A;  3IHP A;  2JMJ A;  4PTB A;  4UI9 B;  1VD4 A;  3DPL R;  3N9O A;  1WEQ A;  3C6W A;  2KGI A;  4MVT A;  3SOW A;  3FL2 A;  1WGM A;  1JOC A;  2H0D A;  4V3K C;  5KH7 A;  4FK5 A;  2ECG A;  2LGL A;  2KWO A;  2F6N A;  1JM7 A;  3O36 A;  1WE9 A;  2LGV A;  2ZET C;  4AP4 A;  3C5K A;  2MD8 C;  4LKA A;  2MA6 A;  4IC3 A;  1ZBD B;  3M63 A;  4ZQL A;  3RPG C;  2DX8 A;  4N3W A;  4ZUX U;  2YHO A;  4X3G A;  2KWN A;  4LJN A;  2VPB A;  2VJF B;  5D1K B;  4YBS A;  5I3L A;  2UZG A;  2G43 A;  5KH3 A;  4S3O C;  5TDW A;  2KRE A;  4S3O B;  5FEY A;  5LKZ A;  3O7A A;  3ZPV E;  5C13 A;  2M85 A;  3O37 A;  5AIU A;  4AYC A;  4QF3 A;  4R7E A;  2L75 A;  2LRI C;  4YAB A;  2F6J A;  2YHN A;  3L11 A;  4YC9 A;  1Z60 A;  1DVP A;  5KH9 A;  1FBV A;  2QJ0 A;  3T7L A;  2XB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...