2ECVA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of tripartite motif-containing protein 5
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
GSSGSSGMASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 5
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of Tripartite motif-containing protein 5
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 4
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecvA00
5AITA 2VNFA 5FB1A 5JG6A 1N87A 3N9OA 4AVXA 2IDAA 4FO9A 2KR4A 4AUQB 1JM7A 2EODA 4LJNA 2G45A 3I2DA 3QZVA 4ZDTA 2DX8A 2FSAA 2YHNA 2YSJA 4C9ZA 4Q6FA 2L5UA 1JOCA 4R7EA 5AIUA 3L1ZB 5FERA 4FK5A 2LXPC 2QJ0A 1CHCA 2KYUA 3HCTA 3ZYQA 4B7YC 2MUMA 5TDRA 4B86C 5KH3A 2YUCA 1MM3A 1WEPA 2Y1NA 2M85A 5LCWB 5B75A 3ZVYA 3O35A 2LGKA 1WGMA 2D8SA 4A0CD 2M6MA 2JMJA 5TABA 3LQJA 3ASLA 5G05B 4X3GA 2NAAA 2VJFB 4L58A 1E4UA 5TDWA 4FJCA 3ZPVE 3IHPA 5KH7A 4MSXA 2CSYA 3U5NA 1V87A 2YT5A 3U5OA 4TKPB 4F52B 5I3LA 3VK6A 5LKTA 5LKXA 2YYRA 1HYIA 2KREA 2LDRA 4A49A 4CCGX 3O37A 3RTRB 5B76A 2MNZA 2H0DA 4V3KC 4L7XA 3M99A 4I7DA 4QF2A 1FBVA 2K4DA 3LQIA 5C13A 1WILA 2G43A 3SHBA 5H1UA 5B77A 1VD4A 4AYCB 1BORA 2XB1A 2MD8C 2KFTA 3ZNIA 2L43A 5D1KB 2LQ6A 2YURA 4ZQLA 4P5OB 2LGGA 2VJEB 2MNYA 3RPGC 4R8PK 5G04B 2BAYA 3U5MA 1Z2QA 2ECIA 4O64A 2EGPA 3PHDA 2K16A 1X4JA 1WEVA 1X4IA 2E6SA 5KH9A 2ECVA 2MA5A 3KQIA 3N9PA 3LQHA 3RPGB 2OXQC 4WZ0A 2MIQA 4GNFA 5H1VA 1DVPA 2F42A 3N9LA 3M63A 4YBMA 1F62A 1JM7B 2ECTA 4FIPA 3HCUA 1WEWA 3NG2A 2KE1A 2KGIA 4LKAA 4MVTA 3EB6A 2K17A 3T6RA 2KU3A 3PUQA 1LDKC 2F6JA 2PNXA 5DINA 1U6GB 4PTBA 3SOWA 3PURA 5B8DA 3SOXA 2Y1MA 3L11A 2C2VS 3KNVA 5G0FA 2CKLA 4LLBA 3U5PA 2VPDA 4PPEA 2MD7B 2ZETC 2KWOA 2MT5A 2YSMA 2PUYA 4WZ2A 2L0BA 3ZTGA 4N4FA 2JMDA 4GNDA 4CA1A 4UP5A 4BHWA 4XI1A 2VPGA 2C2LA 2QIZA 3O36A 2YQLA 2CSZA 2YHOA 4S3OC 5LKZA 4LADB 2RI7A 2QICA 3O33A 2E6RA 2HYED 3GV4A 5H1TA 1X4UA 3KV5A 1XWHA 2ECWA 4YADA 1Z60A 5C11A 1WESA 4S3OB 2LRIC 2JRJA 2H0DB 2HDPA 3ZPV1 5EYAF 1VYXA 1HYJA 4A4BA 3EB5A 2KGGA 2CT2A 2YREA 2VP7A 4UI9B 2ECJA 1WFKA 3MHSA 2K1JA 3KV6A 4UP0A 4YBTA 3N9MA 3C6WA 2LGLA 3LRQA 4WZ3B 3HCSA 2L80A 3DPLR 2KWNA 4R2YA 1IYMA 3M62A 5B78A 2RSDA 1T1HA 2Y43A 3O70A 4GNGA 3HTKC 4YATA 4IC3A 4YAXA 4NN2A 2I50A 1WIMA 2VJFA 2EA6A 1LDJB 5H9MA 2KWKA 4I7BA 4IC2A 3SOUA 2F6NA 3O7AA 5B79A 1WE9A 2YU4A 4AP4A 4LK9A 4GB0A 4QF3A 1WENA 4GNEA 3T7LA 3C5KA 3V43A 3GL6A 1RMDA 2XEUA 3ZVZB 4YC9A 5J3XA 1FP0A 5FEYA 2LN0A 3DQVR 1WEQA 2YQMA 1WEOA 2LXHC 4YABA 5D1LB 3N9QA 2JMIA 3MHHA 3L1XA 4I7CA 2VPEA 2LGVA 5TBNA 1WEUA 4N3WA 5D1MB 1MM2A 2CKLB 3N9NA 4AYCA 1WEEA 3O34A 1Z6UA 2UZGA 1G25A 4W4UA 5TRBA 5DKAA 1K2FA 2LV9A 5FB0A 2VJEA 4YBSA 2VPBA 2G6QA 4BBQA 2ECGA 2ECNA 2KIZA 2FUIA 2M1RA 2FUUA 2MA6A 2M3HA 4ZUXU 4WA6A 2KWJA 2YW8A 4A4CA 1ZBDB 5LKUA 2AN6A 1WEMA 4V3LC 3FL2A 2L75A 1VFYA
chains in the Genus database with same CATH superfamily
5AITA 2VNFA 4OGEA 2M13A 5FB1A 5JG6A 1N87A 2JM3A 3N9OA 4AVXA 2IDAA 4FO9A 2KR4A 4AUQB 2LAUA 1JM7A 2EODA 4LJNA 2G45A 3I2DA 3QZVA 4ZDTA 2DX8A 2FSAA 2YHNA 2YSJA 4C9ZA 4Q6FA 2L5UA 1JOCA 4R7EA 5AIUA 3L1ZB 5FERA 4FK5A 2LXPC 5SVIA 2QJ0A 1CHCA 2KYUA 3HCTA 3ZYQA 4B7YC 3LVQE 2MUMA 5TDRA 4B86C 5KH3A 2YUCA 1MM3A 1WEPA 2Y1NA 3PLWA 2M85A 5LCWB 5B75A 2FD4A 3ZVYA 3O35A 3LDYA 2LGKA 1WGMA 2D8SA 2CRRA 2L7PA 4A0CD 2M6MA 2JMJA 2KKXA 4O62A 5TABA 3LQJA 3ASLA 5G05B 4X3GA 2NAAA 2VJFB 4L58A 1E4UA 5TDWA 3FAOA 4FJCA 3ZPVE 3IHPA 2MKEA 5KH7A 4MSXA 2CSYA 3U5NA 1V87A 2YT5A 3U5OA 4TKPB 4F52B 5I3LA 3VK6A 5LKTA 5LKXA 2CONA 2YYRA 1HYIA 2KREA 2P57A 3FEHA 2LDRA 4A49A 4H9DA 4CCGX 3O37A 2JUNA 3RTRB 2MNZA 5B76A 2H0DA 2IQJA 4V3KC 4L7XA 3M99A 4I7DA 4QF2A 3T9KA 1FBVA 3O47A 2K4DA 1MBMA 2XOCA 3LQIA 3M7KA 5C13A 1WILA 2G43A 3SHBA 2OWAA 5H1UA 5B77A 1VD4A 3H7HA 3Q1DA 1BORA 4AYCB 2XB1A 2MD8C 2KFTA 3ZNIA 2L43A 5D1KB 2LQ6A 2YURA 4ZQLA 4P5OB 2LGGA 2VJEB 2MNYA 3RPGC 4R8PK 5G04B 2BAYA 3U5MA 1Z2QA 2ECIA 4O64A 2EGPA 3PHDA 2K16A 1X4JA 2RR4A 1WEVA 1X4IA 2E6SA 5KH9A 2ECVA 2MA5A 3KQIA 3N9PA 3LQHA 3RPGB 2OXQC 5K3QA 4WZ0A 2MIQA 5SVXA 4GNFA 5H1VA 1DVPA 2F42A 2FFWA 3N9LA 3M63A 4YBMA 1F62A 1JM7B 2ECTA 4FIPA 3HCUA 1WEWA 2XOYA 3NG2A 2KE1A 2KGIA 4F1PA 4LKAA 3DWDA 2XP0A 4MVTA 3EB6A 2K17A 3T6RA 2KU3A 3PUQA 1LDKC 2F6JA 2PNXA 5DINA 1U6GB 4PTBA 3SOWA 3PURA 5B8DA 3SOXA 2Y1MA 3L11A 2C2VS 5SVIB 3KNVA 2B0OE 5G0FA 2YVRA 2CKLA 2EGMA 4LLBA 3U5PA 2VPDA 4PPEA 3JUEA 3LJUX 2DSMA 2MD7B 2ZETC 2CSVA 2KWOA 2MT5A 2YSMA 2PUYA 4WZ2A 2L0BA 3ZTGA 4N4FA 2JMDA 3LVRE 4GNDA 4CA1A 4UP5A 3FANA 4BHWA 4XI1A 2VPGA 2EXUA 2C2LA 2QIZA 3O36A 2YQLA 2CSZA 2YHOA 4S3OC 5LKZA 4LADB 2RI7A 2QICA 3O33A 2E6RA 2HYED 3GV4A 5H1TA 1X4UA 3KV5A 1XWHA 2ECWA 4OGCA 4YADA 1Z60A 2D8UA 5C11A 1WESA 3SUBA 4S3OB 2LRIC 2JRJA 2H0DB 2HDPA 3ZPV1 5EYAF 1VYXA 1HYJA 4A4BA 2CRWA 3EB5A 2KGGA 2CT2A 2YREA 2VP7A 4UI9B 2ECJA 1WFKA 3MHSA 2K1JA 3FM8C 3KV6A 4UP0A 4YBTA 3N9MA 4Z0RA 3C6WA 2LGLA 3LRQA 1DCQA 3HCSA 4WZ3B 2L80A 3DPLR 3E2DA 2KWNA 4R2YA 1IYMA 2KKYA 3M62A 5B78A 2RSDA 1T1HA 2Y43A 3O70A 4GNGA 3HTKC 4YATA 4IC3A 4YAXA 4NN2A 2I50A 1WIMA 2VJFA 2EA6A 3DDTA 1LDJB 5H9MA 2KWKA 4IC2A 4I7BA 3SOUA 2F6NA 3O7AA 5B79A 1WE9A 2YU4A 4AP4A 4LK9A 4GB0A 4QF3A 1WENA 4GNEA 2XOZA 3T7LA 3C5KA 3V43A 2DJAA 3GL6A 1RMDA 2XEUA 3ZVZB 4YC9A 5J3XA 1FP0A 5FEYA 2LN0A 3DQVR 3KDEC 1WEQA 2YQMA 3MDBC 1WEOA 2LXHC 4YABA 5D1LB 3N9QA 2JMIA 3MHHA 3L1XA 4I7CA 3FJUB 2VPEA 2LGVA 5TBNA 1WEUA 4N3WA 5D1MB 1MM2A 2CKLB 3N9NA 4AYCA 1WEEA 3O34A 1Z6UA 2UZGA 1G25A 4W4UA 5TRBA 5DKAA 1K2FA 4Z0OA 2LV9A 5FB0A 2VJEA 5SVYA 4YBSA 2VPBA 2E61A 2G6QA 4BBQA 2ECGA 2ECNA 2KIZA 2FUIA 2M1RA 2FUUA 2MA6A 2M3HA 4ZUXU 4QQ4A 4WA6A 2KWJA 2YW8A 4A4CA 1ZBDB 5LKUA 2AN6A 1WEMA 4V3LC 3FL2A 2L75A 1VFYA
chains in the Genus database with same CATH topology
5AITA 2VNFA 5FB1A 5JG6A 1N87A 3N9OA 4AVXA 2IDAA 4FO9A 2KR4A 4AUQB 1JM7A 2EODA 4LJNA 2G45A 3I2DA 3QZVA 4ZDTA 2DX8A 2FSAA 2YHNA 2YSJA 4C9ZA 4Q6FA 2L5UA 1JOCA 4R7EA 5AIUA 3L1ZB 5FERA 4FK5A 2LXPC 2QJ0A 1CHCA 2KYUA 3HCTA 3ZYQA 4B7YC 2MUMA 5TDRA 4B86C 5KH3A 2YUCA 1MM3A 1WEPA 2Y1NA 2M85A 5LCWB 5B75A 3ZVYA 3O35A 2LGKA 1WGMA 2D8SA 4A0CD 2M6MA 2JMJA 5TABA 3LQJA 3ASLA 5G05B 4X3GA 2NAAA 2VJFB 4L58A 1E4UA 5TDWA 4FJCA 3ZPVE 3IHPA 5KH7A 4MSXA 2CSYA 3U5NA 1V87A 2YT5A 3U5OA 4TKPB 4F52B 5I3LA 3VK6A 5LKTA 5LKXA 2YYRA 1HYIA 2KREA 2LDRA 4A49A 4CCGX 3O37A 3RTRB 5B76A 2MNZA 2H0DA 4V3KC 4L7XA 3M99A 4I7DA 4QF2A 1FBVA 2K4DA 3LQIA 5C13A 1WILA 2G43A 3SHBA 5H1UA 5B77A 1VD4A 4AYCB 1BORA 2XB1A 2MD8C 2KFTA 3ZNIA 2L43A 5D1KB 2LQ6A 2YURA 4ZQLA 4P5OB 2LGGA 2VJEB 2MNYA 3RPGC 4R8PK 5G04B 2BAYA 3U5MA 1Z2QA 2ECIA 4O64A 2EGPA 3PHDA 2K16A 1X4JA 1WEVA 1X4IA 2E6SA 5KH9A 2ECVA 2MA5A 3KQIA 3N9PA 3LQHA 3RPGB 2OXQC 4WZ0A 2MIQA 4GNFA 5H1VA 1DVPA 2F42A 3N9LA 3M63A 4YBMA 1F62A 1JM7B 2ECTA 4FIPA 3HCUA 1WEWA 3NG2A 2KE1A 2KGIA 4LKAA 4MVTA 3EB6A 2K17A 3T6RA 2KU3A 3PUQA 1LDKC 2F6JA 2PNXA 5DINA 1U6GB 4PTBA 3SOWA 3PURA 5B8DA 3SOXA 2Y1MA 3L11A 2C2VS 3KNVA 5G0FA 2CKLA 4LLBA 3U5PA 2VPDA 4PPEA 2MD7B 2ZETC 2KWOA 2MT5A 2YSMA 2PUYA 4WZ2A 2L0BA 3ZTGA 4N4FA 2JMDA 4GNDA 4CA1A 4UP5A 4BHWA 4XI1A 2VPGA 2C2LA 2QIZA 3O36A 2YQLA 2CSZA 2YHOA 4S3OC 5LKZA 4LADB 2RI7A 2QICA 3O33A 2E6RA 2HYED 3GV4A 5H1TA 1X4UA 3KV5A 1XWHA 2ECWA 4YADA 1Z60A 5C11A 1WESA 4S3OB 2LRIC 2JRJA 2H0DB 2HDPA 3ZPV1 5EYAF 1VYXA 1HYJA 4A4BA 3EB5A 2KGGA 2CT2A 2YREA 2VP7A 4UI9B 2ECJA 1WFKA 3MHSA 2K1JA 3KV6A 4UP0A 4YBTA 3N9MA 3C6WA 2LGLA 3LRQA 4WZ3B 3HCSA 2L80A 3DPLR 2KWNA 4R2YA 1IYMA 3M62A 5B78A 2RSDA 1T1HA 2Y43A 3O70A 4GNGA 3HTKC 4YATA 4IC3A 4YAXA 4NN2A 2I50A 1WIMA 2VJFA 2EA6A 1LDJB 5H9MA 2KWKA 4I7BA 4IC2A 3SOUA 2F6NA 3O7AA 5B79A 1WE9A 2YU4A 4AP4A 4LK9A 4GB0A 4QF3A 1WENA 4GNEA 3T7LA 3C5KA 3V43A 3GL6A 1RMDA 2XEUA 3ZVZB 4YC9A 5J3XA 1FP0A 5FEYA 2LN0A 3DQVR 1WEQA 2YQMA 1WEOA 2LXHC 4YABA 5D1LB 3N9QA 2JMIA 3MHHA 3L1XA 4I7CA 2VPEA 2LGVA 5TBNA 1WEUA 4N3WA 5D1MB 1MM2A 2CKLB 3N9NA 4AYCA 1WEEA 3O34A 1Z6UA 2UZGA 1G25A 4W4UA 5TRBA 5DKAA 1K2FA 2LV9A 5FB0A 2VJEA 4YBSA 2VPBA 2G6QA 4BBQA 2ECGA 2ECNA 2KIZA 2FUIA 2M1RA 2FUUA 2MA6A 2M3HA 4ZUXU 4WA6A 2KWJA 2YW8A 4A4CA 1ZBDB 5LKUA 2AN6A 1WEMA 4V3LC 3FL2A 2L75A 1VFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIT A;  2VNF A;  5FB1 A;  5JG6 A;  1N87 A;  3N9O A;  4AVX A;  2IDA A;  4FO9 A;  2KR4 A;  4AUQ B;  1JM7 A;  2EOD A;  4LJN A;  2G45 A;  3I2D A;  3QZV A;  4ZDT A;  2DX8 A;  2FSA A;  2YHN A;  2YSJ A;  4C9Z A;  4Q6F A;  2L5U A;  1JOC A;  4R7E A;  5AIU A;  3L1Z B;  5FER A;  4FK5 A;  2LXP C;  2QJ0 A;  1CHC A;  2KYU A;  3HCT A;  3ZYQ A;  4B7Y C;  2MUM A;  5TDR A;  4B86 C;  5KH3 A;  2YUC A;  1MM3 A;  1WEP A;  2Y1N A;  2M85 A;  5LCW B;  5B75 A;  3ZVY A;  3O35 A;  2LGK A;  1WGM A;  2D8S A;  4A0C D;  2M6M A;  2JMJ A;  5TAB A;  3LQJ A;  3ASL A;  5G05 B;  4X3G A;  2NAA A;  2VJF B;  4L58 A;  1E4U A;  5TDW A;  4FJC A;  3ZPV E;  3IHP A;  5KH7 A;  4MSX A;  2CSY A;  3U5N A;  1V87 A;  2YT5 A;  3U5O A;  4TKP B;  4F52 B;  5I3L A;  3VK6 A;  5LKT A;  5LKX A;  2YYR A;  1HYI A;  2KRE A;  2LDR A;  4A49 A;  4CCG X;  3O37 A;  3RTR B;  5B76 A;  2MNZ A;  2H0D A;  4V3K C;  4L7X A;  3M99 A;  4I7D A;  4QF2 A;  1FBV A;  2K4D A;  3LQI A;  5C13 A;  1WIL A;  2G43 A;  3SHB A;  5H1U A;  5B77 A;  1VD4 A;  4AYC B;  1BOR A;  2XB1 A;  2MD8 C;  2KFT A;  3ZNI A;  2L43 A;  5D1K B;  2LQ6 A;  2YUR A;  4ZQL A;  4P5O B;  2LGG A;  2VJE B;  2MNY A;  3RPG C;  4R8P K;  5G04 B;  2BAY A;  3U5M A;  1Z2Q A;  2ECI A;  4O64 A;  2EGP A;  3PHD A;  2K16 A;  1X4J A;  1WEV A;  1X4I A;  2E6S A;  5KH9 A;  2ECV A;  2MA5 A;  3KQI A;  3N9P A;  3LQH A;  3RPG B;  2OXQ C;  4WZ0 A;  2MIQ A;  4GNF A;  5H1V A;  1DVP A;  2F42 A;  3N9L A;  3M63 A;  4YBM A;  1F62 A;  1JM7 B;  2ECT A;  4FIP A;  3HCU A;  1WEW A;  3NG2 A;  2KE1 A;  2KGI A;  4LKA A;  4MVT A;  3EB6 A;  2K17 A;  3T6R A;  2KU3 A;  3PUQ A;  1LDK C;  2F6J A;  2PNX A;  5DIN A;  1U6G B;  4PTB A;  3SOW A;  3PUR A;  5B8D A;  3SOX A;  2Y1M A;  3L11 A;  2C2V S;  3KNV A;  5G0F A;  2CKL A;  4LLB A;  3U5P A;  2VPD A;  4PPE A;  2MD7 B;  2ZET C;  2KWO A;  2MT5 A;  2YSM A;  2PUY A;  4WZ2 A;  2L0B A;  3ZTG A;  4N4F A;  2JMD A;  4GND A;  4CA1 A;  4UP5 A;  4BHW A;  4XI1 A;  2VPG A;  2C2L A;  2QIZ A;  3O36 A;  2YQL A;  2CSZ A;  2YHO A;  4S3O C;  5LKZ A;  4LAD B;  2RI7 A;  2QIC A;  3O33 A;  2E6R A;  2HYE D;  3GV4 A;  5H1T A;  1X4U A;  3KV5 A;  1XWH A;  2ECW A;  4YAD A;  1Z60 A;  5C11 A;  1WES A;  4S3O B;  2LRI C;  2JRJ A;  2H0D B;  2HDP A;  3ZPV 1;  5EYA F;  1VYX A;  1HYJ A;  4A4B A;  3EB5 A;  2KGG A;  2CT2 A;  2YRE A;  2VP7 A;  4UI9 B;  2ECJ A;  1WFK A;  3MHS A;  2K1J A;  3KV6 A;  4UP0 A;  4YBT A;  3N9M A;  3C6W A;  2LGL A;  3LRQ A;  4WZ3 B;  3HCS A;  2L80 A;  3DPL R;  2KWN A;  4R2Y A;  1IYM A;  3M62 A;  5B78 A;  2RSD A;  1T1H A;  2Y43 A;  3O70 A;  4GNG A;  3HTK C;  4YAT A;  4IC3 A;  4YAX A;  4NN2 A;  2I50 A;  1WIM A;  2VJF A;  2EA6 A;  1LDJ B;  5H9M A;  2KWK A;  4I7B A;  4IC2 A;  3SOU A;  2F6N A;  3O7A A;  5B79 A;  1WE9 A;  2YU4 A;  4AP4 A;  4LK9 A;  4GB0 A;  4QF3 A;  1WEN A;  4GNE A;  3T7L A;  3C5K A;  3V43 A;  3GL6 A;  1RMD A;  2XEU A;  3ZVZ B;  4YC9 A;  5J3X A;  1FP0 A;  5FEY A;  2LN0 A;  3DQV R;  1WEQ A;  2YQM A;  1WEO A;  2LXH C;  4YAB A;  5D1L B;  3N9Q A;  2JMI A;  3MHH A;  3L1X A;  4I7C A;  2VPE A;  2LGV A;  5TBN A;  1WEU A;  4N3W A;  5D1M B;  1MM2 A;  2CKL B;  3N9N A;  4AYC A;  1WEE A;  3O34 A;  1Z6U A;  2UZG A;  1G25 A;  4W4U A;  5TRB A;  5DKA A;  1K2F A;  2LV9 A;  5FB0 A;  2VJE A;  4YBS A;  2VPB A;  2G6Q A;  4BBQ A;  2ECG A;  2ECN A;  2KIZ A;  2FUI A;  2M1R A;  2FUU A;  2MA6 A;  2M3H A;  4ZUX U;  4WA6 A;  2KWJ A;  2YW8 A;  4A4C A;  1ZBD B;  5LKU A;  2AN6 A;  1WEM A;  4V3L C;  3FL2 A;  2L75 A;  1VFY A; 
#chains in the Genus database with same CATH topology
 5AIT A;  2VNF A;  4OGE A;  2M13 A;  5FB1 A;  5JG6 A;  1N87 A;  2JM3 A;  3N9O A;  4AVX A;  2IDA A;  4FO9 A;  2KR4 A;  4AUQ B;  2LAU A;  1JM7 A;  2EOD A;  4LJN A;  2G45 A;  3I2D A;  3QZV A;  4ZDT A;  2DX8 A;  2FSA A;  2YHN A;  2YSJ A;  4C9Z A;  4Q6F A;  2L5U A;  1JOC A;  4R7E A;  5AIU A;  3L1Z B;  5FER A;  4FK5 A;  2LXP C;  5SVI A;  2QJ0 A;  1CHC A;  2KYU A;  3HCT A;  3ZYQ A;  4B7Y C;  3LVQ E;  2MUM A;  5TDR A;  4B86 C;  5KH3 A;  2YUC A;  1MM3 A;  1WEP A;  2Y1N A;  3PLW A;  2M85 A;  5LCW B;  5B75 A;  2FD4 A;  3ZVY A;  3O35 A;  3LDY A;  2LGK A;  1WGM A;  2D8S A;  2CRR A;  2L7P A;  4A0C D;  2M6M A;  2JMJ A;  2KKX A;  4O62 A;  5TAB A;  3LQJ A;  3ASL A;  5G05 B;  4X3G A;  2NAA A;  2VJF B;  4L58 A;  1E4U A;  5TDW A;  3FAO A;  4FJC A;  3ZPV E;  3IHP A;  2MKE A;  5KH7 A;  4MSX A;  2CSY A;  3U5N A;  1V87 A;  2YT5 A;  3U5O A;  4TKP B;  4F52 B;  5I3L A;  3VK6 A;  5LKT A;  5LKX A;  2CON A;  2YYR A;  1HYI A;  2KRE A;  2P57 A;  3FEH A;  2LDR A;  4A49 A;  4H9D A;  4CCG X;  3O37 A;  2JUN A;  3RTR B;  2MNZ A;  5B76 A;  2H0D A;  2IQJ A;  4V3K C;  4L7X A;  3M99 A;  4I7D A;  4QF2 A;  3T9K A;  1FBV A;  3O47 A;  2K4D A;  1MBM A;  2XOC A;  3LQI A;  3M7K A;  5C13 A;  1WIL A;  2G43 A;  3SHB A;  2OWA A;  5H1U A;  5B77 A;  1VD4 A;  3H7H A;  3Q1D A;  1BOR A;  4AYC B;  2XB1 A;  2MD8 C;  2KFT A;  3ZNI A;  2L43 A;  5D1K B;  2LQ6 A;  2YUR A;  4ZQL A;  4P5O B;  2LGG A;  2VJE B;  2MNY A;  3RPG C;  4R8P K;  5G04 B;  2BAY A;  3U5M A;  1Z2Q A;  2ECI A;  4O64 A;  2EGP A;  3PHD A;  2K16 A;  1X4J A;  2RR4 A;  1WEV A;  1X4I A;  2E6S A;  5KH9 A;  2ECV A;  2MA5 A;  3KQI A;  3N9P A;  3LQH A;  3RPG B;  2OXQ C;  5K3Q A;  4WZ0 A;  2MIQ A;  5SVX A;  4GNF A;  5H1V A;  1DVP A;  2F42 A;  2FFW A;  3N9L A;  3M63 A;  4YBM A;  1F62 A;  1JM7 B;  2ECT A;  4FIP A;  3HCU A;  1WEW A;  2XOY A;  3NG2 A;  2KE1 A;  2KGI A;  4F1P A;  4LKA A;  3DWD A;  2XP0 A;  4MVT A;  3EB6 A;  2K17 A;  3T6R A;  2KU3 A;  3PUQ A;  1LDK C;  2F6J A;  2PNX A;  5DIN A;  1U6G B;  4PTB A;  3SOW A;  3PUR A;  5B8D A;  3SOX A;  2Y1M A;  3L11 A;  2C2V S;  5SVI B;  3KNV A;  2B0O E;  5G0F A;  2YVR A;  2CKL A;  2EGM A;  4LLB A;  3U5P A;  2VPD A;  4PPE A;  3JUE A;  3LJU X;  2DSM A;  2MD7 B;  2ZET C;  2CSV A;  2KWO A;  2MT5 A;  2YSM A;  2PUY A;  4WZ2 A;  2L0B A;  3ZTG A;  4N4F A;  2JMD A;  3LVR E;  4GND A;  4CA1 A;  4UP5 A;  3FAN A;  4BHW A;  4XI1 A;  2VPG A;  2EXU A;  2C2L A;  2QIZ A;  3O36 A;  2YQL A;  2CSZ A;  2YHO A;  4S3O C;  5LKZ A;  4LAD B;  2RI7 A;  2QIC A;  3O33 A;  2E6R A;  2HYE D;  3GV4 A;  5H1T A;  1X4U A;  3KV5 A;  1XWH A;  2ECW A;  4OGC A;  4YAD A;  1Z60 A;  2D8U A;  5C11 A;  1WES A;  3SUB A;  4S3O B;  2LRI C;  2JRJ A;  2H0D B;  2HDP A;  3ZPV 1;  5EYA F;  1VYX A;  1HYJ A;  4A4B A;  2CRW A;  3EB5 A;  2KGG A;  2CT2 A;  2YRE A;  2VP7 A;  4UI9 B;  2ECJ A;  1WFK A;  3MHS A;  2K1J A;  3FM8 C;  3KV6 A;  4UP0 A;  4YBT A;  3N9M A;  4Z0R A;  3C6W A;  2LGL A;  3LRQ A;  1DCQ A;  3HCS A;  4WZ3 B;  2L80 A;  3DPL R;  3E2D A;  2KWN A;  4R2Y A;  1IYM A;  2KKY A;  3M62 A;  5B78 A;  2RSD A;  1T1H A;  2Y43 A;  3O70 A;  4GNG A;  3HTK C;  4YAT A;  4IC3 A;  4YAX A;  4NN2 A;  2I50 A;  1WIM A;  2VJF A;  2EA6 A;  3DDT A;  1LDJ B;  5H9M A;  2KWK A;  4IC2 A;  4I7B A;  3SOU A;  2F6N A;  3O7A A;  5B79 A;  1WE9 A;  2YU4 A;  4AP4 A;  4LK9 A;  4GB0 A;  4QF3 A;  1WEN A;  4GNE A;  2XOZ A;  3T7L A;  3C5K A;  3V43 A;  2DJA A;  3GL6 A;  1RMD A;  2XEU A;  3ZVZ B;  4YC9 A;  5J3X A;  1FP0 A;  5FEY A;  2LN0 A;  3DQV R;  3KDE C;  1WEQ A;  2YQM A;  3MDB C;  1WEO A;  2LXH C;  4YAB A;  5D1L B;  3N9Q A;  2JMI A;  3MHH A;  3L1X A;  4I7C A;  3FJU B;  2VPE A;  2LGV A;  5TBN A;  1WEU A;  4N3W A;  5D1M B;  1MM2 A;  2CKL B;  3N9N A;  4AYC A;  1WEE A;  3O34 A;  1Z6U A;  2UZG A;  1G25 A;  4W4U A;  5TRB A;  5DKA A;  1K2F A;  4Z0O A;  2LV9 A;  5FB0 A;  2VJE A;  5SVY A;  4YBS A;  2VPB A;  2E61 A;  2G6Q A;  4BBQ A;  2ECG A;  2ECN A;  2KIZ A;  2FUI A;  2M1R A;  2FUU A;  2MA6 A;  2M3H A;  4ZUX U;  4QQ4 A;  4WA6 A;  2KWJ A;  2YW8 A;  4A4C A;  1ZBD B;  5LKU A;  2AN6 A;  1WEM A;  4V3L C;  3FL2 A;  2L75 A;  1VFY A; 
#chains in the Genus database with same CATH homology
 5AIT A;  2VNF A;  5FB1 A;  5JG6 A;  1N87 A;  3N9O A;  4AVX A;  2IDA A;  4FO9 A;  2KR4 A;  4AUQ B;  1JM7 A;  2EOD A;  4LJN A;  2G45 A;  3I2D A;  3QZV A;  4ZDT A;  2DX8 A;  2FSA A;  2YHN A;  2YSJ A;  4C9Z A;  4Q6F A;  2L5U A;  1JOC A;  4R7E A;  5AIU A;  3L1Z B;  5FER A;  4FK5 A;  2LXP C;  2QJ0 A;  1CHC A;  2KYU A;  3HCT A;  3ZYQ A;  4B7Y C;  2MUM A;  5TDR A;  4B86 C;  5KH3 A;  2YUC A;  1MM3 A;  1WEP A;  2Y1N A;  2M85 A;  5LCW B;  5B75 A;  3ZVY A;  3O35 A;  2LGK A;  1WGM A;  2D8S A;  4A0C D;  2M6M A;  2JMJ A;  5TAB A;  3LQJ A;  3ASL A;  5G05 B;  4X3G A;  2NAA A;  2VJF B;  4L58 A;  1E4U A;  5TDW A;  4FJC A;  3ZPV E;  3IHP A;  5KH7 A;  4MSX A;  2CSY A;  3U5N A;  1V87 A;  2YT5 A;  3U5O A;  4TKP B;  4F52 B;  5I3L A;  3VK6 A;  5LKT A;  5LKX A;  2YYR A;  1HYI A;  2KRE A;  2LDR A;  4A49 A;  4CCG X;  3O37 A;  3RTR B;  5B76 A;  2MNZ A;  2H0D A;  4V3K C;  4L7X A;  3M99 A;  4I7D A;  4QF2 A;  1FBV A;  2K4D A;  3LQI A;  5C13 A;  1WIL A;  2G43 A;  3SHB A;  5H1U A;  5B77 A;  1VD4 A;  4AYC B;  1BOR A;  2XB1 A;  2MD8 C;  2KFT A;  3ZNI A;  2L43 A;  5D1K B;  2LQ6 A;  2YUR A;  4ZQL A;  4P5O B;  2LGG A;  2VJE B;  2MNY A;  3RPG C;  4R8P K;  5G04 B;  2BAY A;  3U5M A;  1Z2Q A;  2ECI A;  4O64 A;  2EGP A;  3PHD A;  2K16 A;  1X4J A;  1WEV A;  1X4I A;  2E6S A;  5KH9 A;  2ECV A;  2MA5 A;  3KQI A;  3N9P A;  3LQH A;  3RPG B;  2OXQ C;  4WZ0 A;  2MIQ A;  4GNF A;  5H1V A;  1DVP A;  2F42 A;  3N9L A;  3M63 A;  4YBM A;  1F62 A;  1JM7 B;  2ECT A;  4FIP A;  3HCU A;  1WEW A;  3NG2 A;  2KE1 A;  2KGI A;  4LKA A;  4MVT A;  3EB6 A;  2K17 A;  3T6R A;  2KU3 A;  3PUQ A;  1LDK C;  2F6J A;  2PNX A;  5DIN A;  1U6G B;  4PTB A;  3SOW A;  3PUR A;  5B8D A;  3SOX A;  2Y1M A;  3L11 A;  2C2V S;  3KNV A;  5G0F A;  2CKL A;  4LLB A;  3U5P A;  2VPD A;  4PPE A;  2MD7 B;  2ZET C;  2KWO A;  2MT5 A;  2YSM A;  2PUY A;  4WZ2 A;  2L0B A;  3ZTG A;  4N4F A;  2JMD A;  4GND A;  4CA1 A;  4UP5 A;  4BHW A;  4XI1 A;  2VPG A;  2C2L A;  2QIZ A;  3O36 A;  2YQL A;  2CSZ A;  2YHO A;  4S3O C;  5LKZ A;  4LAD B;  2RI7 A;  2QIC A;  3O33 A;  2E6R A;  2HYE D;  3GV4 A;  5H1T A;  1X4U A;  3KV5 A;  1XWH A;  2ECW A;  4YAD A;  1Z60 A;  5C11 A;  1WES A;  4S3O B;  2LRI C;  2JRJ A;  2H0D B;  2HDP A;  3ZPV 1;  5EYA F;  1VYX A;  1HYJ A;  4A4B A;  3EB5 A;  2KGG A;  2CT2 A;  2YRE A;  2VP7 A;  4UI9 B;  2ECJ A;  1WFK A;  3MHS A;  2K1J A;  3KV6 A;  4UP0 A;  4YBT A;  3N9M A;  3C6W A;  2LGL A;  3LRQ A;  4WZ3 B;  3HCS A;  2L80 A;  3DPL R;  2KWN A;  4R2Y A;  1IYM A;  3M62 A;  5B78 A;  2RSD A;  1T1H A;  2Y43 A;  3O70 A;  4GNG A;  3HTK C;  4YAT A;  4IC3 A;  4YAX A;  4NN2 A;  2I50 A;  1WIM A;  2VJF A;  2EA6 A;  1LDJ B;  5H9M A;  2KWK A;  4I7B A;  4IC2 A;  3SOU A;  2F6N A;  3O7A A;  5B79 A;  1WE9 A;  2YU4 A;  4AP4 A;  4LK9 A;  4GB0 A;  4QF3 A;  1WEN A;  4GNE A;  3T7L A;  3C5K A;  3V43 A;  3GL6 A;  1RMD A;  2XEU A;  3ZVZ B;  4YC9 A;  5J3X A;  1FP0 A;  5FEY A;  2LN0 A;  3DQV R;  1WEQ A;  2YQM A;  1WEO A;  2LXH C;  4YAB A;  5D1L B;  3N9Q A;  2JMI A;  3MHH A;  3L1X A;  4I7C A;  2VPE A;  2LGV A;  5TBN A;  1WEU A;  4N3W A;  5D1M B;  1MM2 A;  2CKL B;  3N9N A;  4AYC A;  1WEE A;  3O34 A;  1Z6U A;  2UZG A;  1G25 A;  4W4U A;  5TRB A;  5DKA A;  1K2F A;  2LV9 A;  5FB0 A;  2VJE A;  4YBS A;  2VPB A;  2G6Q A;  4BBQ A;  2ECG A;  2ECN A;  2KIZ A;  2FUI A;  2M1R A;  2FUU A;  2MA6 A;  2M3H A;  4ZUX U;  4WA6 A;  2KWJ A;  2YW8 A;  4A4C A;  1ZBD B;  5LKU A;  2AN6 A;  1WEM A;  4V3L C;  3FL2 A;  2L75 A;  1VFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...