2ECVA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain of tripartite motif-containing protein 5
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGMASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 5
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain of Tripartite motif-containing protein 5
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 4
structure length 85
sequence length 85
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecvA00
2ECIA 2F6JA 1F62A 5LCWB 3C5KA 2ECJA 3GV4A 2KGGA 1VYXA 3LRQA 5AITA 2MA5A 2KWNA 5D1KB 4A4BA 2YYRA 2G43A 3SOWA 3O36A 2QICA 3T7LA 1X4IA 4AVXA 3O35A 4CCGX 2E6RA 2VJEB 5KH9A 1WGMA 2YREA 4WA6A 4WZ2A 3N9PA 2YU4A 4YADA 1V87A 3SOUA 5B8DA 3O37A 2H0DB 3U5MA 5B78A 5KH3A 3PHDA 1WILA 1BORA 5D1LB 2YSMA 2LGGA 3SOXA 2CT2A 4F52B 4QF2A 3N9LA 1FBVA 4GNFA 4MVTA 5DKAA 3KV5A 2KYUA 5B79A 3DQVR 4GNGA 2UZGA 5LKXA 4R7EA 1VFYA 4AYCA 3QZVA 3O70A 4NN2A 3VK6A 2VPBA 3HCSA 1N87A 5C11A 2CSZA 2E6SA 5DINA 5I3LA 2KR4A 5J3XA 4FO9A 4LLBA 2K17A 2PNXA 4R2YA 1U6GB 4LKAA 4FK5A 2LGKA 4IC3A 2MIQA 3RPGB 4I7CA 2ZETC 3LQHA 2OXQC 3RPGC 3DPLR 2IDAA 4QF3A 5TRBA 4ZDTA 2LGLA 2ECVA 2KWOA 2VP7A 3MHSA 5G05B 5LKUA 2F6NA 4WZ3B 4YBSA 2L0BA 2ECGA 2FUUA 2KIZA 2M85A 1WEMA 5LKTA 4A0CD 2H0DA 2KFTA 4B86C 5JG6A 2AN6A 2BAYA 2F42A 4P5OB 4MSXA 5TDWA 3N9NA 5D1MB 3ZPV1 4WZ0A 4ZQLA 2ECNA 2Y1MA 3SHBA 2MNZA 4YATA 3KQIA 2KWJA 4Q6FA 4AP4A 5H1UA 5H1VA 4UI9B 2VPEA 1WEWA 2Y1NA 2C2VS 2JMIA 2YQLA 2G45A 3KV6A 3L1XA 2M6MA 4YC9A 2VNFA 5C13A 4ZUXU 2K1JA 2MA6A 1X4JA 4UP5A 2FUIA 2MUMA 2KE1A 5LKZA 4R8PK 1Z2QA 2L5UA 4PTBA 1E4UA 1IYMA 3ZVZB 4O64A 1JM7A 4I7BA 1WFKA 2RI7A 5B75A 4GB0A 1HYJA 5TDRA 2CKLA 1T1HA 4TKPB 2K4DA 4W4UA 3LQIA 1WE9A 4X3GA 5TBNA 2PUYA 2QJ0A 3ZVYA 4UP0A 3FL2A 2L80A 1MM2A 1DVPA 2DX8A 3O7AA 4PPEA 2K16A 2JRJA 2MT5A 2XB1A 2LQ6A 4GNEA 2MD7B 3ASLA 4A4CA 5G0FA 1JM7B 3L11A 1HYIA 1Z6UA 3EB5A 2CKLB 3T6RA 1VD4A 4LJNA 1ZBDB 1LDJB 3HCUA 3N9MA 2YUCA 3NG2A 3M99A 2QIZA 3ZNIA 2LV9A 3O34A 2Y43A 1WEVA 2YHNA 2JMDA 3IHPA 2I50A 4B7YC 3N9QA 2L43A 1Z60A 3L1ZB 2LGVA 2VPGA 1X4UA 5EYAF 1K2FA 3V43A 5B76A 1JOCA 2VPDA 3GL6A 3O33A 4N4FA 5FEYA 1FP0A 4BBQA 1WESA 2KGIA 2EODA 4YBTA 2YSJA 2JMJA 2KU3A 4IC2A 4N3WA 3LQJA 3HTKC 1WEUA 2LXHC 3HCTA 2MNYA 2EA6A 3RTRB 1MM3A 2EGPA 1WEOA 1WEPA 2KWKA 2ECTA 4L58A 2NAAA 4YABA 5KH7A 3I2DA 1WEQA 2C2LA 3PUQA 4FIPA 4LADB 2RSDA 3U5NA 4CA1A 5FERA 5H9MA 1CHCA 2CSYA 2D8SA 2YT5A 2FSAA 2HYED 4YAXA 2LRIC 4LK9A 4V3LC 4V3KC 4I7DA 4YBMA 2LXPC 1WIMA 2YHOA 2VJFA 3N9OA 5FB1A 3ZPVE 1XWHA 3U5PA 2L75A 2G6QA 2YW8A 3ZYQA 2YQMA 4A49A 4BHWA 5B77A 1WENA 1LDKC 2KREA 2HDPA 2YURA 3MHHA 2ECWA 4FJCA 3U5OA 3KNVA 4GNDA 5H1TA 2MD8C 3C6WA 2LDRA 1G25A 2VJFB 4C9ZA 2M1RA 3M63A 2LN0A 5AIUA 2XEUA 4AYCB 2M3HA 1RMDA 5TABA 1WEEA 3ZTGA 3PURA 4S3OB 3EB6A 4AUQB 5FB0A 2VJEA 5G04B 4XI1A 4L7XA 3M62A 4S3OC
chains in the Genus database with same CATH superfamily
2XP0A 2ECIA 2F6JA 1F62A 5LCWB 3C5KA 2ECJA 3GV4A 2KGGA 1VYXA 3LRQA 5AITA 2MA5A 2KWNA 2RR4A 5D1KB 3MDBC 4A4BA 2YYRA 2G43A 3SOWA 3O36A 2QICA 2YVRA 3T7LA 1X4IA 4AVXA 3O35A 4CCGX 2E6RA 2VJEB 5KH9A 1WGMA 2YREA 4WA6A 4WZ2A 2CRWA 3N9PA 2YU4A 2DSMA 4YADA 1V87A 3SOUA 5B8DA 3O37A 2H0DB 3U5MA 5B78A 5KH3A 3PHDA 2P57A 1WILA 3KDEC 1BORA 5D1LB 2YSMA 2LGGA 3SOXA 2CT2A 4F52B 4QF2A 3N9LA 1FBVA 4GNFA 4MVTA 5DKAA 4OGEA 3KV5A 2KYUA 5B79A 3DQVR 4GNGA 2UZGA 5LKXA 2FFWA 4R7EA 1VFYA 4AYCA 3QZVA 3O70A 4NN2A 3VK6A 2VPBA 3HCSA 1N87A 5C11A 2IQJA 2FD4A 2CSZA 2E6SA 2MKEA 5DINA 5SVIB 2D8UA 5I3LA 2KR4A 5J3XA 4FO9A 4LLBA 2K17A 2PNXA 4R2YA 1U6GB 4LKAA 4Z0RA 4FK5A 2LGKA 4IC3A 2EXUA 2MIQA 3RPGB 2L7PA 4I7CA 2ZETC 3LQHA 2OXQC 2XOZA 3SUBA 3RPGC 3DPLR 2IDAA 4QF3A 5TRBA 4ZDTA 3FAOA 2LGLA 2ECVA 3M7KA 3Q1DA 2KWOA 2VP7A 2OWAA 3MHSA 5G05B 5LKUA 2F6NA 4WZ3B 4YBSA 2L0BA 2ECGA 1DCQA 2FUUA 2KIZA 2M85A 1WEMA 5LKTA 4A0CD 2H0DA 2DJAA 2KFTA 4OGCA 4B86C 5JG6A 2AN6A 2BAYA 2F42A 4P5OB 4MSXA 5TDWA 3N9NA 5D1MB 4Z0OA 3ZPV1 4WZ0A 4ZQLA 2ECNA 3LDYA 2Y1MA 3SHBA 2MNZA 4YATA 4QQ4A 3KQIA 2KWJA 3LVRE 4Q6FA 4AP4A 3PLWA 2JUNA 5H1UA 5H1VA 4UI9B 2CONA 2VPEA 1WEWA 2Y1NA 2C2VS 2JMIA 2YQLA 2G45A 3KV6A 3L1XA 2M6MA 4YC9A 2VNFA 3FEHA 5C13A 1MBMA 2K1JA 4ZUXU 2MA6A 1X4JA 5SVIA 4UP5A 2FUIA 2MUMA 2KE1A 3DWDA 5LKZA 4R8PK 1Z2QA 2L5UA 4PTBA 1E4UA 1IYMA 3ZVZB 4O64A 1JM7A 2XOYA 4I7BA 1WFKA 2RI7A 5B75A 4GB0A 1HYJA 5TDRA 2CKLA 1T1HA 4TKPB 2K4DA 4W4UA 3LQIA 1WE9A 3JUEA 4X3GA 5TBNA 2PUYA 2QJ0A 3FM8C 3ZVYA 4UP0A 3FL2A 2L80A 1MM2A 1DVPA 2DX8A 3O7AA 4PPEA 2E61A 2K16A 2JRJA 2MT5A 2XB1A 2LQ6A 4GNEA 3H7HA 2MD7B 3ASLA 4A4CA 5G0FA 1JM7B 2JM3A 3L11A 2CSVA 1HYIA 1Z6UA 3EB5A 2CKLB 3T6RA 1VD4A 4LJNA 4O62A 4H9DA 1ZBDB 1LDJB 3HCUA 3N9MA 2YUCA 3NG2A 3M99A 2LAUA 2QIZA 3E2DA 3ZNIA 2LV9A 3O34A 2Y43A 1WEVA 2YHNA 2JMDA 3IHPA 2I50A 4B7YC 3N9QA 2L43A 1Z60A 2XOCA 3L1ZB 2LGVA 2VPGA 5K3QA 1X4UA 5EYAF 1K2FA 3V43A 5B76A 1JOCA 2VPDA 3GL6A 3O33A 4N4FA 5FEYA 1FP0A 4BBQA 1WESA 2KGIA 2EODA 4YBTA 2YSJA 2KKYA 2JMJA 4F1PA 3FANA 2KU3A 5SVYA 4IC2A 4N3WA 3LQJA 3HTKC 3LJUX 1WEUA 2LXHC 3HCTA 2MNYA 2EA6A 3RTRB 1MM3A 3T9KA 2EGPA 2KKXA 1WEOA 1WEPA 2KWKA 2ECTA 4L58A 2NAAA 4YABA 5KH7A 3FJUB 3I2DA 1WEQA 2C2LA 3PUQA 4FIPA 4LADB 2RSDA 3U5NA 4CA1A 5FERA 5H9MA 1CHCA 2CSYA 2D8SA 2YT5A 2FSAA 2HYED 2LRIC 4LK9A 4V3LC 4YAXA 4V3KC 3O47A 4I7DA 4YBMA 2LXPC 1WIMA 2YHOA 2VJFA 3N9OA 5FB1A 3ZPVE 1XWHA 3U5PA 2B0OE 2L75A 2G6QA 2EGMA 2CRRA 2YW8A 3ZYQA 2YQMA 4A49A 4BHWA 5B77A 1WENA 1LDKC 2M13A 2KREA 2HDPA 2YURA 3MHHA 2ECWA 4FJCA 3U5OA 3KNVA 4GNDA 5H1TA 3LVQE 2MD8C 3C6WA 2LDRA 1G25A 2VJFB 4C9ZA 2M1RA 3M63A 2LN0A 5AIUA 2XEUA 4AYCB 2M3HA 1RMDA 5TABA 1WEEA 3ZTGA 3PURA 4S3OB 3EB6A 4AUQB 5FB0A 2VJEA 5G04B 3DDTA 4XI1A 4L7XA 3M62A 5SVXA 4S3OC
chains in the Genus database with same CATH topology
2ECIA 2F6JA 1F62A 5LCWB 3C5KA 2ECJA 3GV4A 2KGGA 1VYXA 3LRQA 5AITA 2MA5A 2KWNA 5D1KB 4A4BA 2YYRA 2G43A 3SOWA 3O36A 2QICA 3T7LA 1X4IA 4AVXA 3O35A 4CCGX 2E6RA 2VJEB 5KH9A 1WGMA 2YREA 4WA6A 4WZ2A 3N9PA 2YU4A 4YADA 1V87A 3SOUA 5B8DA 3O37A 2H0DB 3U5MA 5B78A 5KH3A 3PHDA 1WILA 1BORA 5D1LB 2YSMA 2LGGA 3SOXA 2CT2A 4F52B 4QF2A 3N9LA 1FBVA 4GNFA 4MVTA 5DKAA 3KV5A 2KYUA 5B79A 3DQVR 4GNGA 2UZGA 5LKXA 4R7EA 1VFYA 4AYCA 3QZVA 3O70A 4NN2A 3VK6A 2VPBA 3HCSA 1N87A 5C11A 2CSZA 2E6SA 5DINA 5I3LA 2KR4A 5J3XA 4FO9A 4LLBA 2K17A 2PNXA 4R2YA 1U6GB 4LKAA 4FK5A 2LGKA 4IC3A 2MIQA 3RPGB 4I7CA 2ZETC 3LQHA 2OXQC 3RPGC 3DPLR 2IDAA 4QF3A 5TRBA 4ZDTA 2LGLA 2ECVA 2KWOA 2VP7A 3MHSA 5G05B 5LKUA 2F6NA 4WZ3B 4YBSA 2L0BA 2ECGA 2FUUA 2KIZA 2M85A 1WEMA 5LKTA 4A0CD 2H0DA 2KFTA 4B86C 5JG6A 2AN6A 2BAYA 2F42A 4P5OB 4MSXA 5TDWA 3N9NA 5D1MB 3ZPV1 4WZ0A 4ZQLA 2ECNA 2Y1MA 3SHBA 2MNZA 4YATA 3KQIA 2KWJA 4Q6FA 4AP4A 5H1UA 5H1VA 4UI9B 2VPEA 1WEWA 2Y1NA 2C2VS 2JMIA 2YQLA 2G45A 3KV6A 3L1XA 2M6MA 4YC9A 2VNFA 5C13A 4ZUXU 2K1JA 2MA6A 1X4JA 4UP5A 2FUIA 2MUMA 2KE1A 5LKZA 4R8PK 1Z2QA 2L5UA 4PTBA 1E4UA 1IYMA 3ZVZB 4O64A 1JM7A 4I7BA 1WFKA 2RI7A 5B75A 4GB0A 1HYJA 5TDRA 2CKLA 1T1HA 4TKPB 2K4DA 4W4UA 3LQIA 1WE9A 4X3GA 5TBNA 2PUYA 2QJ0A 3ZVYA 4UP0A 3FL2A 2L80A 1MM2A 1DVPA 2DX8A 3O7AA 4PPEA 2K16A 2JRJA 2MT5A 2XB1A 2LQ6A 4GNEA 2MD7B 3ASLA 4A4CA 5G0FA 1JM7B 3L11A 1HYIA 1Z6UA 3EB5A 2CKLB 3T6RA 1VD4A 4LJNA 1ZBDB 1LDJB 3HCUA 3N9MA 2YUCA 3NG2A 3M99A 2QIZA 3ZNIA 2LV9A 3O34A 2Y43A 1WEVA 2YHNA 2JMDA 3IHPA 2I50A 4B7YC 3N9QA 2L43A 1Z60A 3L1ZB 2LGVA 2VPGA 1X4UA 5EYAF 1K2FA 3V43A 5B76A 1JOCA 2VPDA 3GL6A 3O33A 4N4FA 5FEYA 1FP0A 4BBQA 1WESA 2KGIA 2EODA 4YBTA 2YSJA 2JMJA 2KU3A 4IC2A 4N3WA 3LQJA 3HTKC 1WEUA 2LXHC 3HCTA 2MNYA 2EA6A 3RTRB 1MM3A 2EGPA 1WEOA 1WEPA 2KWKA 2ECTA 4L58A 2NAAA 4YABA 5KH7A 3I2DA 1WEQA 2C2LA 3PUQA 4FIPA 4LADB 2RSDA 3U5NA 4CA1A 5FERA 5H9MA 1CHCA 2CSYA 2D8SA 2YT5A 2FSAA 2HYED 4YAXA 2LRIC 4LK9A 4V3LC 4V3KC 4I7DA 4YBMA 2LXPC 1WIMA 2YHOA 2VJFA 3N9OA 5FB1A 3ZPVE 1XWHA 3U5PA 2L75A 2G6QA 2YW8A 3ZYQA 2YQMA 4A49A 4BHWA 5B77A 1WENA 1LDKC 2KREA 2HDPA 2YURA 3MHHA 2ECWA 4FJCA 3U5OA 3KNVA 4GNDA 5H1TA 2MD8C 3C6WA 2LDRA 1G25A 2VJFB 4C9ZA 2M1RA 3M63A 2LN0A 5AIUA 2XEUA 4AYCB 2M3HA 1RMDA 5TABA 1WEEA 3ZTGA 3PURA 4S3OB 3EB6A 4AUQB 5FB0A 2VJEA 5G04B 4XI1A 4L7XA 3M62A 4S3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECI A;  2F6J A;  1F62 A;  5LCW B;  3C5K A;  2ECJ A;  3GV4 A;  2KGG A;  1VYX A;  3LRQ A;  5AIT A;  2MA5 A;  2KWN A;  5D1K B;  4A4B A;  2YYR A;  2G43 A;  3SOW A;  3O36 A;  2QIC A;  3T7L A;  1X4I A;  4AVX A;  3O35 A;  4CCG X;  2E6R A;  2VJE B;  5KH9 A;  1WGM A;  2YRE A;  4WA6 A;  4WZ2 A;  3N9P A;  2YU4 A;  4YAD A;  1V87 A;  3SOU A;  5B8D A;  3O37 A;  2H0D B;  3U5M A;  5B78 A;  5KH3 A;  3PHD A;  1WIL A;  1BOR A;  5D1L B;  2YSM A;  2LGG A;  3SOX A;  2CT2 A;  4F52 B;  4QF2 A;  3N9L A;  1FBV A;  4GNF A;  4MVT A;  5DKA A;  3KV5 A;  2KYU A;  5B79 A;  3DQV R;  4GNG A;  2UZG A;  5LKX A;  4R7E A;  1VFY A;  4AYC A;  3QZV A;  3O70 A;  4NN2 A;  3VK6 A;  2VPB A;  3HCS A;  1N87 A;  5C11 A;  2CSZ A;  2E6S A;  5DIN A;  5I3L A;  2KR4 A;  5J3X A;  4FO9 A;  4LLB A;  2K17 A;  2PNX A;  4R2Y A;  1U6G B;  4LKA A;  4FK5 A;  2LGK A;  4IC3 A;  2MIQ A;  3RPG B;  4I7C A;  2ZET C;  3LQH A;  2OXQ C;  3RPG C;  3DPL R;  2IDA A;  4QF3 A;  5TRB A;  4ZDT A;  2LGL A;  2ECV A;  2KWO A;  2VP7 A;  3MHS A;  5G05 B;  5LKU A;  2F6N A;  4WZ3 B;  4YBS A;  2L0B A;  2ECG A;  2FUU A;  2KIZ A;  2M85 A;  1WEM A;  5LKT A;  4A0C D;  2H0D A;  2KFT A;  4B86 C;  5JG6 A;  2AN6 A;  2BAY A;  2F42 A;  4P5O B;  4MSX A;  5TDW A;  3N9N A;  5D1M B;  3ZPV 1;  4WZ0 A;  4ZQL A;  2ECN A;  2Y1M A;  3SHB A;  2MNZ A;  4YAT A;  3KQI A;  2KWJ A;  4Q6F A;  4AP4 A;  5H1U A;  5H1V A;  4UI9 B;  2VPE A;  1WEW A;  2Y1N A;  2C2V S;  2JMI A;  2YQL A;  2G45 A;  3KV6 A;  3L1X A;  2M6M A;  4YC9 A;  2VNF A;  5C13 A;  4ZUX U;  2K1J A;  2MA6 A;  1X4J A;  4UP5 A;  2FUI A;  2MUM A;  2KE1 A;  5LKZ A;  4R8P K;  1Z2Q A;  2L5U A;  4PTB A;  1E4U A;  1IYM A;  3ZVZ B;  4O64 A;  1JM7 A;  4I7B A;  1WFK A;  2RI7 A;  5B75 A;  4GB0 A;  1HYJ A;  5TDR A;  2CKL A;  1T1H A;  4TKP B;  2K4D A;  4W4U A;  3LQI A;  1WE9 A;  4X3G A;  5TBN A;  2PUY A;  2QJ0 A;  3ZVY A;  4UP0 A;  3FL2 A;  2L80 A;  1MM2 A;  1DVP A;  2DX8 A;  3O7A A;  4PPE A;  2K16 A;  2JRJ A;  2MT5 A;  2XB1 A;  2LQ6 A;  4GNE A;  2MD7 B;  3ASL A;  4A4C A;  5G0F A;  1JM7 B;  3L11 A;  1HYI A;  1Z6U A;  3EB5 A;  2CKL B;  3T6R A;  1VD4 A;  4LJN A;  1ZBD B;  1LDJ B;  3HCU A;  3N9M A;  2YUC A;  3NG2 A;  3M99 A;  2QIZ A;  3ZNI A;  2LV9 A;  3O34 A;  2Y43 A;  1WEV A;  2YHN A;  2JMD A;  3IHP A;  2I50 A;  4B7Y C;  3N9Q A;  2L43 A;  1Z60 A;  3L1Z B;  2LGV A;  2VPG A;  1X4U A;  5EYA F;  1K2F A;  3V43 A;  5B76 A;  1JOC A;  2VPD A;  3GL6 A;  3O33 A;  4N4F A;  5FEY A;  1FP0 A;  4BBQ A;  1WES A;  2KGI A;  2EOD A;  4YBT A;  2YSJ A;  2JMJ A;  2KU3 A;  4IC2 A;  4N3W A;  3LQJ A;  3HTK C;  1WEU A;  2LXH C;  3HCT A;  2MNY A;  2EA6 A;  3RTR B;  1MM3 A;  2EGP A;  1WEO A;  1WEP A;  2KWK A;  2ECT A;  4L58 A;  2NAA A;  4YAB A;  5KH7 A;  3I2D A;  1WEQ A;  2C2L A;  3PUQ A;  4FIP A;  4LAD B;  2RSD A;  3U5N A;  4CA1 A;  5FER A;  5H9M A;  1CHC A;  2CSY A;  2D8S A;  2YT5 A;  2FSA A;  2HYE D;  4YAX A;  2LRI C;  4LK9 A;  4V3L C;  4V3K C;  4I7D A;  4YBM A;  2LXP C;  1WIM A;  2YHO A;  2VJF A;  3N9O A;  5FB1 A;  3ZPV E;  1XWH A;  3U5P A;  2L75 A;  2G6Q A;  2YW8 A;  3ZYQ A;  2YQM A;  4A49 A;  4BHW A;  5B77 A;  1WEN A;  1LDK C;  2KRE A;  2HDP A;  2YUR A;  3MHH A;  2ECW A;  4FJC A;  3U5O A;  3KNV A;  4GND A;  5H1T A;  2MD8 C;  3C6W A;  2LDR A;  1G25 A;  2VJF B;  4C9Z A;  2M1R A;  3M63 A;  2LN0 A;  5AIU A;  2XEU A;  4AYC B;  2M3H A;  1RMD A;  5TAB A;  1WEE A;  3ZTG A;  3PUR A;  4S3O B;  3EB6 A;  4AUQ B;  5FB0 A;  2VJE A;  5G04 B;  4XI1 A;  4L7X A;  3M62 A;  4S3O C; 
#chains in the Genus database with same CATH topology
 2XP0 A;  2ECI A;  2F6J A;  1F62 A;  5LCW B;  3C5K A;  2ECJ A;  3GV4 A;  2KGG A;  1VYX A;  3LRQ A;  5AIT A;  2MA5 A;  2KWN A;  2RR4 A;  5D1K B;  3MDB C;  4A4B A;  2YYR A;  2G43 A;  3SOW A;  3O36 A;  2QIC A;  2YVR A;  3T7L A;  1X4I A;  4AVX A;  3O35 A;  4CCG X;  2E6R A;  2VJE B;  5KH9 A;  1WGM A;  2YRE A;  4WA6 A;  4WZ2 A;  2CRW A;  3N9P A;  2YU4 A;  2DSM A;  4YAD A;  1V87 A;  3SOU A;  5B8D A;  3O37 A;  2H0D B;  3U5M A;  5B78 A;  5KH3 A;  3PHD A;  2P57 A;  1WIL A;  3KDE C;  1BOR A;  5D1L B;  2YSM A;  2LGG A;  3SOX A;  2CT2 A;  4F52 B;  4QF2 A;  3N9L A;  1FBV A;  4GNF A;  4MVT A;  5DKA A;  4OGE A;  3KV5 A;  2KYU A;  5B79 A;  3DQV R;  4GNG A;  2UZG A;  5LKX A;  2FFW A;  4R7E A;  1VFY A;  4AYC A;  3QZV A;  3O70 A;  4NN2 A;  3VK6 A;  2VPB A;  3HCS A;  1N87 A;  5C11 A;  2IQJ A;  2FD4 A;  2CSZ A;  2E6S A;  2MKE A;  5DIN A;  5SVI B;  2D8U A;  5I3L A;  2KR4 A;  5J3X A;  4FO9 A;  4LLB A;  2K17 A;  2PNX A;  4R2Y A;  1U6G B;  4LKA A;  4Z0R A;  4FK5 A;  2LGK A;  4IC3 A;  2EXU A;  2MIQ A;  3RPG B;  2L7P A;  4I7C A;  2ZET C;  3LQH A;  2OXQ C;  2XOZ A;  3SUB A;  3RPG C;  3DPL R;  2IDA A;  4QF3 A;  5TRB A;  4ZDT A;  3FAO A;  2LGL A;  2ECV A;  3M7K A;  3Q1D A;  2KWO A;  2VP7 A;  2OWA A;  3MHS A;  5G05 B;  5LKU A;  2F6N A;  4WZ3 B;  4YBS A;  2L0B A;  2ECG A;  1DCQ A;  2FUU A;  2KIZ A;  2M85 A;  1WEM A;  5LKT A;  4A0C D;  2H0D A;  2DJA A;  2KFT A;  4OGC A;  4B86 C;  5JG6 A;  2AN6 A;  2BAY A;  2F42 A;  4P5O B;  4MSX A;  5TDW A;  3N9N A;  5D1M B;  4Z0O A;  3ZPV 1;  4WZ0 A;  4ZQL A;  2ECN A;  3LDY A;  2Y1M A;  3SHB A;  2MNZ A;  4YAT A;  4QQ4 A;  3KQI A;  2KWJ A;  3LVR E;  4Q6F A;  4AP4 A;  3PLW A;  2JUN A;  5H1U A;  5H1V A;  4UI9 B;  2CON A;  2VPE A;  1WEW A;  2Y1N A;  2C2V S;  2JMI A;  2YQL A;  2G45 A;  3KV6 A;  3L1X A;  2M6M A;  4YC9 A;  2VNF A;  3FEH A;  5C13 A;  1MBM A;  2K1J A;  4ZUX U;  2MA6 A;  1X4J A;  5SVI A;  4UP5 A;  2FUI A;  2MUM A;  2KE1 A;  3DWD A;  5LKZ A;  4R8P K;  1Z2Q A;  2L5U A;  4PTB A;  1E4U A;  1IYM A;  3ZVZ B;  4O64 A;  1JM7 A;  2XOY A;  4I7B A;  1WFK A;  2RI7 A;  5B75 A;  4GB0 A;  1HYJ A;  5TDR A;  2CKL A;  1T1H A;  4TKP B;  2K4D A;  4W4U A;  3LQI A;  1WE9 A;  3JUE A;  4X3G A;  5TBN A;  2PUY A;  2QJ0 A;  3FM8 C;  3ZVY A;  4UP0 A;  3FL2 A;  2L80 A;  1MM2 A;  1DVP A;  2DX8 A;  3O7A A;  4PPE A;  2E61 A;  2K16 A;  2JRJ A;  2MT5 A;  2XB1 A;  2LQ6 A;  4GNE A;  3H7H A;  2MD7 B;  3ASL A;  4A4C A;  5G0F A;  1JM7 B;  2JM3 A;  3L11 A;  2CSV A;  1HYI A;  1Z6U A;  3EB5 A;  2CKL B;  3T6R A;  1VD4 A;  4LJN A;  4O62 A;  4H9D A;  1ZBD B;  1LDJ B;  3HCU A;  3N9M A;  2YUC A;  3NG2 A;  3M99 A;  2LAU A;  2QIZ A;  3E2D A;  3ZNI A;  2LV9 A;  3O34 A;  2Y43 A;  1WEV A;  2YHN A;  2JMD A;  3IHP A;  2I50 A;  4B7Y C;  3N9Q A;  2L43 A;  1Z60 A;  2XOC A;  3L1Z B;  2LGV A;  2VPG A;  5K3Q A;  1X4U A;  5EYA F;  1K2F A;  3V43 A;  5B76 A;  1JOC A;  2VPD A;  3GL6 A;  3O33 A;  4N4F A;  5FEY A;  1FP0 A;  4BBQ A;  1WES A;  2KGI A;  2EOD A;  4YBT A;  2YSJ A;  2KKY A;  2JMJ A;  4F1P A;  3FAN A;  2KU3 A;  5SVY A;  4IC2 A;  4N3W A;  3LQJ A;  3HTK C;  3LJU X;  1WEU A;  2LXH C;  3HCT A;  2MNY A;  2EA6 A;  3RTR B;  1MM3 A;  3T9K A;  2EGP A;  2KKX A;  1WEO A;  1WEP A;  2KWK A;  2ECT A;  4L58 A;  2NAA A;  4YAB A;  5KH7 A;  3FJU B;  3I2D A;  1WEQ A;  2C2L A;  3PUQ A;  4FIP A;  4LAD B;  2RSD A;  3U5N A;  4CA1 A;  5FER A;  5H9M A;  1CHC A;  2CSY A;  2D8S A;  2YT5 A;  2FSA A;  2HYE D;  2LRI C;  4LK9 A;  4V3L C;  4YAX A;  4V3K C;  3O47 A;  4I7D A;  4YBM A;  2LXP C;  1WIM A;  2YHO A;  2VJF A;  3N9O A;  5FB1 A;  3ZPV E;  1XWH A;  3U5P A;  2B0O E;  2L75 A;  2G6Q A;  2EGM A;  2CRR A;  2YW8 A;  3ZYQ A;  2YQM A;  4A49 A;  4BHW A;  5B77 A;  1WEN A;  1LDK C;  2M13 A;  2KRE A;  2HDP A;  2YUR A;  3MHH A;  2ECW A;  4FJC A;  3U5O A;  3KNV A;  4GND A;  5H1T A;  3LVQ E;  2MD8 C;  3C6W A;  2LDR A;  1G25 A;  2VJF B;  4C9Z A;  2M1R A;  3M63 A;  2LN0 A;  5AIU A;  2XEU A;  4AYC B;  2M3H A;  1RMD A;  5TAB A;  1WEE A;  3ZTG A;  3PUR A;  4S3O B;  3EB6 A;  4AUQ B;  5FB0 A;  2VJE A;  5G04 B;  3DDT A;  4XI1 A;  4L7X A;  3M62 A;  5SVX A;  4S3O C; 
#chains in the Genus database with same CATH homology
 2ECI A;  2F6J A;  1F62 A;  5LCW B;  3C5K A;  2ECJ A;  3GV4 A;  2KGG A;  1VYX A;  3LRQ A;  5AIT A;  2MA5 A;  2KWN A;  5D1K B;  4A4B A;  2YYR A;  2G43 A;  3SOW A;  3O36 A;  2QIC A;  3T7L A;  1X4I A;  4AVX A;  3O35 A;  4CCG X;  2E6R A;  2VJE B;  5KH9 A;  1WGM A;  2YRE A;  4WA6 A;  4WZ2 A;  3N9P A;  2YU4 A;  4YAD A;  1V87 A;  3SOU A;  5B8D A;  3O37 A;  2H0D B;  3U5M A;  5B78 A;  5KH3 A;  3PHD A;  1WIL A;  1BOR A;  5D1L B;  2YSM A;  2LGG A;  3SOX A;  2CT2 A;  4F52 B;  4QF2 A;  3N9L A;  1FBV A;  4GNF A;  4MVT A;  5DKA A;  3KV5 A;  2KYU A;  5B79 A;  3DQV R;  4GNG A;  2UZG A;  5LKX A;  4R7E A;  1VFY A;  4AYC A;  3QZV A;  3O70 A;  4NN2 A;  3VK6 A;  2VPB A;  3HCS A;  1N87 A;  5C11 A;  2CSZ A;  2E6S A;  5DIN A;  5I3L A;  2KR4 A;  5J3X A;  4FO9 A;  4LLB A;  2K17 A;  2PNX A;  4R2Y A;  1U6G B;  4LKA A;  4FK5 A;  2LGK A;  4IC3 A;  2MIQ A;  3RPG B;  4I7C A;  2ZET C;  3LQH A;  2OXQ C;  3RPG C;  3DPL R;  2IDA A;  4QF3 A;  5TRB A;  4ZDT A;  2LGL A;  2ECV A;  2KWO A;  2VP7 A;  3MHS A;  5G05 B;  5LKU A;  2F6N A;  4WZ3 B;  4YBS A;  2L0B A;  2ECG A;  2FUU A;  2KIZ A;  2M85 A;  1WEM A;  5LKT A;  4A0C D;  2H0D A;  2KFT A;  4B86 C;  5JG6 A;  2AN6 A;  2BAY A;  2F42 A;  4P5O B;  4MSX A;  5TDW A;  3N9N A;  5D1M B;  3ZPV 1;  4WZ0 A;  4ZQL A;  2ECN A;  2Y1M A;  3SHB A;  2MNZ A;  4YAT A;  3KQI A;  2KWJ A;  4Q6F A;  4AP4 A;  5H1U A;  5H1V A;  4UI9 B;  2VPE A;  1WEW A;  2Y1N A;  2C2V S;  2JMI A;  2YQL A;  2G45 A;  3KV6 A;  3L1X A;  2M6M A;  4YC9 A;  2VNF A;  5C13 A;  4ZUX U;  2K1J A;  2MA6 A;  1X4J A;  4UP5 A;  2FUI A;  2MUM A;  2KE1 A;  5LKZ A;  4R8P K;  1Z2Q A;  2L5U A;  4PTB A;  1E4U A;  1IYM A;  3ZVZ B;  4O64 A;  1JM7 A;  4I7B A;  1WFK A;  2RI7 A;  5B75 A;  4GB0 A;  1HYJ A;  5TDR A;  2CKL A;  1T1H A;  4TKP B;  2K4D A;  4W4U A;  3LQI A;  1WE9 A;  4X3G A;  5TBN A;  2PUY A;  2QJ0 A;  3ZVY A;  4UP0 A;  3FL2 A;  2L80 A;  1MM2 A;  1DVP A;  2DX8 A;  3O7A A;  4PPE A;  2K16 A;  2JRJ A;  2MT5 A;  2XB1 A;  2LQ6 A;  4GNE A;  2MD7 B;  3ASL A;  4A4C A;  5G0F A;  1JM7 B;  3L11 A;  1HYI A;  1Z6U A;  3EB5 A;  2CKL B;  3T6R A;  1VD4 A;  4LJN A;  1ZBD B;  1LDJ B;  3HCU A;  3N9M A;  2YUC A;  3NG2 A;  3M99 A;  2QIZ A;  3ZNI A;  2LV9 A;  3O34 A;  2Y43 A;  1WEV A;  2YHN A;  2JMD A;  3IHP A;  2I50 A;  4B7Y C;  3N9Q A;  2L43 A;  1Z60 A;  3L1Z B;  2LGV A;  2VPG A;  1X4U A;  5EYA F;  1K2F A;  3V43 A;  5B76 A;  1JOC A;  2VPD A;  3GL6 A;  3O33 A;  4N4F A;  5FEY A;  1FP0 A;  4BBQ A;  1WES A;  2KGI A;  2EOD A;  4YBT A;  2YSJ A;  2JMJ A;  2KU3 A;  4IC2 A;  4N3W A;  3LQJ A;  3HTK C;  1WEU A;  2LXH C;  3HCT A;  2MNY A;  2EA6 A;  3RTR B;  1MM3 A;  2EGP A;  1WEO A;  1WEP A;  2KWK A;  2ECT A;  4L58 A;  2NAA A;  4YAB A;  5KH7 A;  3I2D A;  1WEQ A;  2C2L A;  3PUQ A;  4FIP A;  4LAD B;  2RSD A;  3U5N A;  4CA1 A;  5FER A;  5H9M A;  1CHC A;  2CSY A;  2D8S A;  2YT5 A;  2FSA A;  2HYE D;  4YAX A;  2LRI C;  4LK9 A;  4V3L C;  4V3K C;  4I7D A;  4YBM A;  2LXP C;  1WIM A;  2YHO A;  2VJF A;  3N9O A;  5FB1 A;  3ZPV E;  1XWH A;  3U5P A;  2L75 A;  2G6Q A;  2YW8 A;  3ZYQ A;  2YQM A;  4A49 A;  4BHW A;  5B77 A;  1WEN A;  1LDK C;  2KRE A;  2HDP A;  2YUR A;  3MHH A;  2ECW A;  4FJC A;  3U5O A;  3KNV A;  4GND A;  5H1T A;  2MD8 C;  3C6W A;  2LDR A;  1G25 A;  2VJF B;  4C9Z A;  2M1R A;  3M63 A;  2LN0 A;  5AIU A;  2XEU A;  4AYC B;  2M3H A;  1RMD A;  5TAB A;  1WEE A;  3ZTG A;  3PUR A;  4S3O B;  3EB6 A;  4AUQ B;  5FB0 A;  2VJE A;  5G04 B;  4XI1 A;  4L7X A;  3M62 A;  4S3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...