3EB5A

Structure of the ciap2 ring domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
SDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords Baculoviral IAP repeat-containing protein 3
publication title Structures of the cIAP2 RING domain reveal conformational changes associated with ubiquitin-conjugating enzyme (E2) recruitment.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 65
sequence length 65
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3eb5A00
2KGGA 3N9OA 4FIPA 2C2LA 1WEUA 3LRQA 4PTBA 1FP0A 2KWOA 3ZPV1 2XEUA 2YUCA 2LQ6A 1V87A 3O37A 1WEQA 5FEYA 5TDWA 2MUMA 5TBNA 2VJFB 1U6GB 2KE1A 2K4DA 1WEWA 4CA1A 5FB1A 4PPEA 1Z2QA 3N9MA 4GNDA 4I7CA 4YBTA 2ECTA 4LKAA 4UP5A 3N9QA 2QIZA 5TDRA 4AYCB 2ECJA 2YSJA 5J3XA 5JG6A 5AIUA 4LADB 4BBQA 2E6SA 3O35A 4GNEA 3O33A 4YADA 2D8SA 5D1KB 5B79A 2MA5A 4A4BA 5LCWB 5B75A 2F6NA 1ZBDB 3MHHA 3ZVYA 2YQLA 3LQIA 3T6RA 4I7DA 3V43A 2H0DB 2CKLB 1JM7B 2JMJA 1FBVA 2KWJA 5G05B 2M3HA 3O36A 3O70A 2MNZA 2JMDA 3KV6A 5DINA 2KIZA 1T1HA 1IYMA 2VP7A 2VNFA 2YHOA 3GL6A 1G25A 2K16A 2C2VS 1VFYA 3C6WA 1MM2A 2MIQA 5H9MA 2VJFA 3GV4A 2K17A 5AITA 4ZDTA 5FERA 2KWKA 4A49A 2OXQC 2LV9A 2L80A 4FK5A 2G43A 2ZETC 2MNYA 2YU4A 1WESA 4NN2A 4F52B 4AYCA 3C5KA 4XI1A 3MHSA 3N9LA 2LXPC 3KV5A 3L1ZB 4GNFA 4R2YA 1WEPA 1LDJB 4GB0A 2L0BA 3PUQA 1X4JA 2JRJA 1WEOA 2ECWA 1WIMA 3U5NA 5D1MB 2PNXA 4ZUXU 2CSYA 2G6QA 2RSDA 3DPLR 3HCSA 4WZ0A 3ZVZB 3KQIA 2H0DA 2CKLA 1JM7A 3LQHA 3EB6A 5H1VA 2QICA 2YW8A 3HTKC 3M63A 5TRBA 4AVXA 4B7YC 3NG2A 5B78A 4ZQLA 4MSXA 1VD4A 3PHDA 2MD7B 3N9NA 2AN6A 2F6JA 1K2FA 4B86C 2KFTA 4O64A 4YC9A 4AP4A 1JOCA 4QF3A 5B77A 1DVPA 2CSZA 3U5MA 5C13A 5C11A 5D1LB 2RI7A 4LJNA 1WGMA 2LGKA 5G0FA 1HYIA 1X4IA 4WZ3B 3HCUA 2F42A 3M99A 2KU3A 2LGGA 1BORA 4CCGX 3U5OA 4N4FA 2YSMA 2LXHC 1WEEA 5H1UA 4L58A 3VK6A 2XB1A 5KH3A 3M62A 2KREA 2L43A 2YURA 5LKXA 2QJ0A 2LGVA 5G04B 3DQVR 4LLBA 5EYAF 2FUIA 4A0CD 2FSAA 3L1XA 4IC3A 2VPEA 4V3LC 5LKZA 4YABA 3PURA 4R7EA 4FO9A 5LKTA 1CHCA 1RMDA 4V3KC 2M85A 2ECIA 1E4UA 4WA6A 2Y1NA 2YYRA 2G45A 2KYUA 2ECVA 3T7LA 3SOUA 2VJEB 2VPBA 2L75A 4L7XA 2VPDA 5KH7A 3SOXA 3I2DA 4MVTA 2LN0A 3ZTGA 2ECGA 1MM3A 2BAYA 2EGPA 2YHNA 1Z6UA 2YQMA 2CT2A 3L11A 5DKAA 1WFKA 3SOWA 2NAAA 4AUQB 4YBSA 3O7AA 1LDKC 2UZGA 3KNVA 4I7BA 2YT5A 3IHPA 3RTRB 4LK9A 4UI9B 3ZYQA 4P5OB 4Q6FA 3ZPVE 1VYXA 2ECNA 1Z60A 2E6RA 2KWNA 1F62A 1WEMA 3U5PA 2LRIC 2MA6A 2YREA 3O34A 4GNGA 2K1JA 5B8DA 2LGLA 4W4UA 1WENA 4UP0A 4YAXA 4BHWA 5I3LA 2Y1MA 3RPGB 3RPGC 2VPGA 1WILA 4WZ2A 5FB0A 2JMIA 4C9ZA 2LDRA 2M1RA 5TABA 4YBMA 2IDAA 2DX8A 2Y43A 4TKPB 4S3OB 4S3OC 1N87A 3QZVA 1XWHA 4R8PK 2MT5A 2VJEA 3ASLA 4A4CA 2L5UA 2KR4A 2EA6A 2HYED 5LKUA 5B76A 2PUYA 3LQJA 2KGIA 2HDPA 4QF2A 1X4UA 4FJCA 3N9PA 4IC2A 5H1TA 1HYJA 4YATA 3HCTA 1WE9A 2MD8C 5KH9A 4X3GA 1WEVA 3EB5A 2EODA 2FUUA 4N3WA 3SHBA 3ZNIA 2I50A 3FL2A 2M6MA
chains in the Genus database with same CATH superfamily
4OGEA 2FFWA 2KGGA 3N9OA 4FIPA 2C2LA 1WEUA 2KKYA 2RR4A 3LRQA 4PTBA 1FP0A 2KWOA 3ZPV1 2XEUA 2YUCA 2LQ6A 4F1PA 1V87A 3O37A 5SVYA 1WEQA 4OGCA 5FEYA 5TDWA 2MUMA 5TBNA 2VJFB 1U6GB 2KE1A 2K4DA 3LDYA 1WEWA 4CA1A 5FB1A 4PPEA 1Z2QA 3N9MA 4GNDA 4I7CA 4YBTA 2ECTA 2JM3A 4LKAA 4UP5A 3N9QA 5SVIA 2QIZA 5TDRA 4AYCB 2ECJA 2YSJA 5J3XA 5JG6A 5AIUA 4LADB 4BBQA 2E6SA 2EXUA 3O35A 3E2DA 4GNEA 3O33A 4YADA 2P57A 2D8SA 3FJUB 5D1KB 5B79A 2MA5A 4A4BA 5LCWB 5B75A 2F6NA 1ZBDB 3MHHA 3ZVYA 2YQLA 3LQIA 2KKXA 3T6RA 2LAUA 4I7DA 3V43A 2DJAA 2H0DB 2CKLB 1JM7B 2JMJA 1FBVA 2KWJA 3O36A 2M3HA 3O70A 5G05B 2MNZA 2JMDA 2L7PA 3KV6A 1MBMA 2KIZA 5DINA 1T1HA 1IYMA 2VP7A 3FEHA 2VNFA 2YHOA 3GL6A 1G25A 2K16A 2C2VS 1VFYA 3C6WA 1MM2A 2E61A 2MIQA 5H9MA 2VJFA 2D8UA 3GV4A 2K17A 5AITA 4ZDTA 5FERA 2KWKA 4A49A 2OXQC 2LV9A 2L80A 4QQ4A 4FK5A 2G43A 2ZETC 2MNYA 2YU4A 1WESA 2CONA 3PLWA 4NN2A 4AYCA 4F52B 3C5KA 4XI1A 3MHSA 3FAOA 3N9LA 2LXPC 3KV5A 3L1ZB 4GNFA 4R2YA 1WEPA 1LDJB 4GB0A 2L0BA 3PUQA 1X4JA 2JRJA 1WEOA 2ECWA 1WIMA 3U5NA 5D1MB 2PNXA 4ZUXU 2CSYA 2G6QA 2RSDA 3DPLR 3HCSA 4WZ0A 3ZVZB 3KQIA 2H0DA 2CKLA 1JM7A 3LQHA 2FD4A 3EB6A 5H1VA 2QICA 2YW8A 3HTKC 3M63A 5TRBA 4AVXA 4B7YC 3NG2A 5B78A 4ZQLA 4MSXA 1VD4A 3PHDA 1DCQA 2MD7B 3N9NA 2AN6A 2F6JA 1K2FA 4B86C 2KFTA 4O64A 4O62A 4YC9A 4AP4A 1JOCA 4QF3A 4H9DA 5B77A 1DVPA 2CSZA 3U5MA 2OWAA 3FM8C 5C13A 5C11A 5D1LB 2RI7A 4LJNA 1WGMA 2LGKA 5G0FA 1HYIA 2YVRA 1X4IA 4WZ3B 3HCUA 2F42A 3M99A 2KU3A 2LGGA 2XOYA 1BORA 4CCGX 3U5OA 4N4FA 2MKEA 2LXHC 2YSMA 4Z0OA 1WEEA 5H1UA 3MDBC 3LVQE 4L58A 3VK6A 2XB1A 5KH3A 3M62A 2KREA 2L43A 2YURA 5LKXA 2QJ0A 2LGVA 5G04B 3DQVR 4LLBA 5EYAF 2FUIA 4A0CD 2FSAA 3L1XA 4IC3A 2VPEA 4V3LC 5LKZA 4YABA 3PURA 4R7EA 4FO9A 5LKTA 1CHCA 1RMDA 4V3KC 2M85A 2ECIA 1E4UA 4WA6A 2Y1NA 2YYRA 2G45A 2KYUA 2ECVA 3T7LA 3SOUA 2VJEB 2VPBA 2L75A 4L7XA 2VPDA 5KH7A 3SOXA 3I2DA 4MVTA 3T9KA 2LN0A 3ZTGA 2ECGA 3Q1DA 1MM3A 2BAYA 2EGPA 2YHNA 4Z0RA 1Z6UA 2YQMA 2CT2A 3M7KA 2XP0A 3L11A 2CRRA 5DKAA 1WFKA 2XOCA 3SOWA 2NAAA 4AUQB 2XOZA 4YBSA 3O7AA 1LDKC 2UZGA 3KNVA 4I7BA 2YT5A 3IHPA 3RTRB 3DWDA 3KDEC 4LK9A 4UI9B 3ZYQA 4P5OB 4Q6FA 3ZPVE 3LJUX 1VYXA 2ECNA 1Z60A 2E6RA 2KWNA 1F62A 1WEMA 3U5PA 5SVXA 2LRIC 2EGMA 2MA6A 2YREA 3O34A 4GNGA 2K1JA 5B8DA 2LGLA 4W4UA 1WENA 3SUBA 4UP0A 4YAXA 4BHWA 5I3LA 2Y1MA 3RPGB 3RPGC 2VPGA 1WILA 4WZ2A 5FB0A 2CRWA 2JMIA 4C9ZA 2LDRA 2M1RA 5TABA 4YBMA 2IDAA 2DX8A 2Y43A 4TKPB 2B0OE 4S3OB 4S3OC 1N87A 3QZVA 1XWHA 4R8PK 2MT5A 5K3QA 2VJEA 3ASLA 4A4CA 2L5UA 2CSVA 2KR4A 2DSMA 2EA6A 3JUEA 2HYED 5LKUA 5B76A 2PUYA 5SVIB 3LQJA 2KGIA 2HDPA 4QF2A 1X4UA 4FJCA 3N9PA 4IC2A 3LVRE 5H1TA 1HYJA 3H7HA 4YATA 3HCTA 1WE9A 2MD8C 2JUNA 3O47A 5KH9A 2M13A 4X3GA 1WEVA 3DDTA 2EODA 2FUUA 4N3WA 3EB5A 3SHBA 3ZNIA 3FANA 2I50A 3FL2A 2M6MA 2IQJA
chains in the Genus database with same CATH topology
2KGGA 3N9OA 4FIPA 2C2LA 1WEUA 3LRQA 4PTBA 1FP0A 2KWOA 3ZPV1 2XEUA 2YUCA 2LQ6A 1V87A 3O37A 1WEQA 5FEYA 5TDWA 2MUMA 5TBNA 2VJFB 1U6GB 2KE1A 2K4DA 1WEWA 4CA1A 5FB1A 4PPEA 1Z2QA 3N9MA 4GNDA 4I7CA 4YBTA 2ECTA 4LKAA 4UP5A 3N9QA 2QIZA 5TDRA 4AYCB 2ECJA 2YSJA 5J3XA 5JG6A 5AIUA 4LADB 4BBQA 2E6SA 3O35A 4GNEA 3O33A 4YADA 2D8SA 5D1KB 5B79A 2MA5A 4A4BA 5LCWB 5B75A 2F6NA 1ZBDB 3MHHA 3ZVYA 2YQLA 3LQIA 3T6RA 4I7DA 3V43A 2H0DB 2CKLB 1JM7B 2JMJA 1FBVA 2KWJA 5G05B 2M3HA 3O36A 3O70A 2MNZA 2JMDA 3KV6A 5DINA 2KIZA 1T1HA 1IYMA 2VP7A 2VNFA 2YHOA 3GL6A 1G25A 2K16A 2C2VS 1VFYA 3C6WA 1MM2A 2MIQA 5H9MA 2VJFA 3GV4A 2K17A 5AITA 4ZDTA 5FERA 2KWKA 4A49A 2OXQC 2LV9A 2L80A 4FK5A 2G43A 2ZETC 2MNYA 2YU4A 1WESA 4NN2A 4F52B 4AYCA 3C5KA 4XI1A 3MHSA 3N9LA 2LXPC 3KV5A 3L1ZB 4GNFA 4R2YA 1WEPA 1LDJB 4GB0A 2L0BA 3PUQA 1X4JA 2JRJA 1WEOA 2ECWA 1WIMA 3U5NA 5D1MB 2PNXA 4ZUXU 2CSYA 2G6QA 2RSDA 3DPLR 3HCSA 4WZ0A 3ZVZB 3KQIA 2H0DA 2CKLA 1JM7A 3LQHA 3EB6A 5H1VA 2QICA 2YW8A 3HTKC 3M63A 5TRBA 4AVXA 4B7YC 3NG2A 5B78A 4ZQLA 4MSXA 1VD4A 3PHDA 2MD7B 3N9NA 2AN6A 2F6JA 1K2FA 4B86C 2KFTA 4O64A 4YC9A 4AP4A 1JOCA 4QF3A 5B77A 1DVPA 2CSZA 3U5MA 5C13A 5C11A 5D1LB 2RI7A 4LJNA 1WGMA 2LGKA 5G0FA 1HYIA 1X4IA 4WZ3B 3HCUA 2F42A 3M99A 2KU3A 2LGGA 1BORA 4CCGX 3U5OA 4N4FA 2YSMA 2LXHC 1WEEA 5H1UA 4L58A 3VK6A 2XB1A 5KH3A 3M62A 2KREA 2L43A 2YURA 5LKXA 2QJ0A 2LGVA 5G04B 3DQVR 4LLBA 5EYAF 2FUIA 4A0CD 2FSAA 3L1XA 4IC3A 2VPEA 4V3LC 5LKZA 4YABA 3PURA 4R7EA 4FO9A 5LKTA 1CHCA 1RMDA 4V3KC 2M85A 2ECIA 1E4UA 4WA6A 2Y1NA 2YYRA 2G45A 2KYUA 2ECVA 3T7LA 3SOUA 2VJEB 2VPBA 2L75A 4L7XA 2VPDA 5KH7A 3SOXA 3I2DA 4MVTA 2LN0A 3ZTGA 2ECGA 1MM3A 2BAYA 2EGPA 2YHNA 1Z6UA 2YQMA 2CT2A 3L11A 5DKAA 1WFKA 3SOWA 2NAAA 4AUQB 4YBSA 3O7AA 1LDKC 2UZGA 3KNVA 4I7BA 2YT5A 3IHPA 3RTRB 4LK9A 4UI9B 3ZYQA 4P5OB 4Q6FA 3ZPVE 1VYXA 2ECNA 1Z60A 2E6RA 2KWNA 1F62A 1WEMA 3U5PA 2LRIC 2MA6A 2YREA 3O34A 4GNGA 2K1JA 5B8DA 2LGLA 4W4UA 1WENA 4UP0A 4YAXA 4BHWA 5I3LA 2Y1MA 3RPGB 3RPGC 2VPGA 1WILA 4WZ2A 5FB0A 2JMIA 4C9ZA 2LDRA 2M1RA 5TABA 4YBMA 2IDAA 2DX8A 2Y43A 4TKPB 4S3OB 4S3OC 1N87A 3QZVA 1XWHA 4R8PK 2MT5A 2VJEA 3ASLA 4A4CA 2L5UA 2KR4A 2EA6A 2HYED 5LKUA 5B76A 2PUYA 3LQJA 2KGIA 2HDPA 4QF2A 1X4UA 4FJCA 3N9PA 4IC2A 5H1TA 1HYJA 4YATA 3HCTA 1WE9A 2MD8C 5KH9A 4X3GA 1WEVA 3EB5A 2EODA 2FUUA 4N3WA 3SHBA 3ZNIA 2I50A 3FL2A 2M6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGG A;  3N9O A;  4FIP A;  2C2L A;  1WEU A;  3LRQ A;  4PTB A;  1FP0 A;  2KWO A;  3ZPV 1;  2XEU A;  2YUC A;  2LQ6 A;  1V87 A;  3O37 A;  1WEQ A;  5FEY A;  5TDW A;  2MUM A;  5TBN A;  2VJF B;  1U6G B;  2KE1 A;  2K4D A;  1WEW A;  4CA1 A;  5FB1 A;  4PPE A;  1Z2Q A;  3N9M A;  4GND A;  4I7C A;  4YBT A;  2ECT A;  4LKA A;  4UP5 A;  3N9Q A;  2QIZ A;  5TDR A;  4AYC B;  2ECJ A;  2YSJ A;  5J3X A;  5JG6 A;  5AIU A;  4LAD B;  4BBQ A;  2E6S A;  3O35 A;  4GNE A;  3O33 A;  4YAD A;  2D8S A;  5D1K B;  5B79 A;  2MA5 A;  4A4B A;  5LCW B;  5B75 A;  2F6N A;  1ZBD B;  3MHH A;  3ZVY A;  2YQL A;  3LQI A;  3T6R A;  4I7D A;  3V43 A;  2H0D B;  2CKL B;  1JM7 B;  2JMJ A;  1FBV A;  2KWJ A;  5G05 B;  2M3H A;  3O36 A;  3O70 A;  2MNZ A;  2JMD A;  3KV6 A;  5DIN A;  2KIZ A;  1T1H A;  1IYM A;  2VP7 A;  2VNF A;  2YHO A;  3GL6 A;  1G25 A;  2K16 A;  2C2V S;  1VFY A;  3C6W A;  1MM2 A;  2MIQ A;  5H9M A;  2VJF A;  3GV4 A;  2K17 A;  5AIT A;  4ZDT A;  5FER A;  2KWK A;  4A49 A;  2OXQ C;  2LV9 A;  2L80 A;  4FK5 A;  2G43 A;  2ZET C;  2MNY A;  2YU4 A;  1WES A;  4NN2 A;  4F52 B;  4AYC A;  3C5K A;  4XI1 A;  3MHS A;  3N9L A;  2LXP C;  3KV5 A;  3L1Z B;  4GNF A;  4R2Y A;  1WEP A;  1LDJ B;  4GB0 A;  2L0B A;  3PUQ A;  1X4J A;  2JRJ A;  1WEO A;  2ECW A;  1WIM A;  3U5N A;  5D1M B;  2PNX A;  4ZUX U;  2CSY A;  2G6Q A;  2RSD A;  3DPL R;  3HCS A;  4WZ0 A;  3ZVZ B;  3KQI A;  2H0D A;  2CKL A;  1JM7 A;  3LQH A;  3EB6 A;  5H1V A;  2QIC A;  2YW8 A;  3HTK C;  3M63 A;  5TRB A;  4AVX A;  4B7Y C;  3NG2 A;  5B78 A;  4ZQL A;  4MSX A;  1VD4 A;  3PHD A;  2MD7 B;  3N9N A;  2AN6 A;  2F6J A;  1K2F A;  4B86 C;  2KFT A;  4O64 A;  4YC9 A;  4AP4 A;  1JOC A;  4QF3 A;  5B77 A;  1DVP A;  2CSZ A;  3U5M A;  5C13 A;  5C11 A;  5D1L B;  2RI7 A;  4LJN A;  1WGM A;  2LGK A;  5G0F A;  1HYI A;  1X4I A;  4WZ3 B;  3HCU A;  2F42 A;  3M99 A;  2KU3 A;  2LGG A;  1BOR A;  4CCG X;  3U5O A;  4N4F A;  2YSM A;  2LXH C;  1WEE A;  5H1U A;  4L58 A;  3VK6 A;  2XB1 A;  5KH3 A;  3M62 A;  2KRE A;  2L43 A;  2YUR A;  5LKX A;  2QJ0 A;  2LGV A;  5G04 B;  3DQV R;  4LLB A;  5EYA F;  2FUI A;  4A0C D;  2FSA A;  3L1X A;  4IC3 A;  2VPE A;  4V3L C;  5LKZ A;  4YAB A;  3PUR A;  4R7E A;  4FO9 A;  5LKT A;  1CHC A;  1RMD A;  4V3K C;  2M85 A;  2ECI A;  1E4U A;  4WA6 A;  2Y1N A;  2YYR A;  2G45 A;  2KYU A;  2ECV A;  3T7L A;  3SOU A;  2VJE B;  2VPB A;  2L75 A;  4L7X A;  2VPD A;  5KH7 A;  3SOX A;  3I2D A;  4MVT A;  2LN0 A;  3ZTG A;  2ECG A;  1MM3 A;  2BAY A;  2EGP A;  2YHN A;  1Z6U A;  2YQM A;  2CT2 A;  3L11 A;  5DKA A;  1WFK A;  3SOW A;  2NAA A;  4AUQ B;  4YBS A;  3O7A A;  1LDK C;  2UZG A;  3KNV A;  4I7B A;  2YT5 A;  3IHP A;  3RTR B;  4LK9 A;  4UI9 B;  3ZYQ A;  4P5O B;  4Q6F A;  3ZPV E;  1VYX A;  2ECN A;  1Z60 A;  2E6R A;  2KWN A;  1F62 A;  1WEM A;  3U5P A;  2LRI C;  2MA6 A;  2YRE A;  3O34 A;  4GNG A;  2K1J A;  5B8D A;  2LGL A;  4W4U A;  1WEN A;  4UP0 A;  4YAX A;  4BHW A;  5I3L A;  2Y1M A;  3RPG B;  3RPG C;  2VPG A;  1WIL A;  4WZ2 A;  5FB0 A;  2JMI A;  4C9Z A;  2LDR A;  2M1R A;  5TAB A;  4YBM A;  2IDA A;  2DX8 A;  2Y43 A;  4TKP B;  4S3O B;  4S3O C;  1N87 A;  3QZV A;  1XWH A;  4R8P K;  2MT5 A;  2VJE A;  3ASL A;  4A4C A;  2L5U A;  2KR4 A;  2EA6 A;  2HYE D;  5LKU A;  5B76 A;  2PUY A;  3LQJ A;  2KGI A;  2HDP A;  4QF2 A;  1X4U A;  4FJC A;  3N9P A;  4IC2 A;  5H1T A;  1HYJ A;  4YAT A;  3HCT A;  1WE9 A;  2MD8 C;  5KH9 A;  4X3G A;  1WEV A;  3EB5 A;  2EOD A;  2FUU A;  4N3W A;  3SHB A;  3ZNI A;  2I50 A;  3FL2 A;  2M6M A; 
#chains in the Genus database with same CATH topology
 4OGE A;  2FFW A;  2KGG A;  3N9O A;  4FIP A;  2C2L A;  1WEU A;  2KKY A;  2RR4 A;  3LRQ A;  4PTB A;  1FP0 A;  2KWO A;  3ZPV 1;  2XEU A;  2YUC A;  2LQ6 A;  4F1P A;  1V87 A;  3O37 A;  5SVY A;  1WEQ A;  4OGC A;  5FEY A;  5TDW A;  2MUM A;  5TBN A;  2VJF B;  1U6G B;  2KE1 A;  2K4D A;  3LDY A;  1WEW A;  4CA1 A;  5FB1 A;  4PPE A;  1Z2Q A;  3N9M A;  4GND A;  4I7C A;  4YBT A;  2ECT A;  2JM3 A;  4LKA A;  4UP5 A;  3N9Q A;  5SVI A;  2QIZ A;  5TDR A;  4AYC B;  2ECJ A;  2YSJ A;  5J3X A;  5JG6 A;  5AIU A;  4LAD B;  4BBQ A;  2E6S A;  2EXU A;  3O35 A;  3E2D A;  4GNE A;  3O33 A;  4YAD A;  2P57 A;  2D8S A;  3FJU B;  5D1K B;  5B79 A;  2MA5 A;  4A4B A;  5LCW B;  5B75 A;  2F6N A;  1ZBD B;  3MHH A;  3ZVY A;  2YQL A;  3LQI A;  2KKX A;  3T6R A;  2LAU A;  4I7D A;  3V43 A;  2DJA A;  2H0D B;  2CKL B;  1JM7 B;  2JMJ A;  1FBV A;  2KWJ A;  3O36 A;  2M3H A;  3O70 A;  5G05 B;  2MNZ A;  2JMD A;  2L7P A;  3KV6 A;  1MBM A;  2KIZ A;  5DIN A;  1T1H A;  1IYM A;  2VP7 A;  3FEH A;  2VNF A;  2YHO A;  3GL6 A;  1G25 A;  2K16 A;  2C2V S;  1VFY A;  3C6W A;  1MM2 A;  2E61 A;  2MIQ A;  5H9M A;  2VJF A;  2D8U A;  3GV4 A;  2K17 A;  5AIT A;  4ZDT A;  5FER A;  2KWK A;  4A49 A;  2OXQ C;  2LV9 A;  2L80 A;  4QQ4 A;  4FK5 A;  2G43 A;  2ZET C;  2MNY A;  2YU4 A;  1WES A;  2CON A;  3PLW A;  4NN2 A;  4AYC A;  4F52 B;  3C5K A;  4XI1 A;  3MHS A;  3FAO A;  3N9L A;  2LXP C;  3KV5 A;  3L1Z B;  4GNF A;  4R2Y A;  1WEP A;  1LDJ B;  4GB0 A;  2L0B A;  3PUQ A;  1X4J A;  2JRJ A;  1WEO A;  2ECW A;  1WIM A;  3U5N A;  5D1M B;  2PNX A;  4ZUX U;  2CSY A;  2G6Q A;  2RSD A;  3DPL R;  3HCS A;  4WZ0 A;  3ZVZ B;  3KQI A;  2H0D A;  2CKL A;  1JM7 A;  3LQH A;  2FD4 A;  3EB6 A;  5H1V A;  2QIC A;  2YW8 A;  3HTK C;  3M63 A;  5TRB A;  4AVX A;  4B7Y C;  3NG2 A;  5B78 A;  4ZQL A;  4MSX A;  1VD4 A;  3PHD A;  1DCQ A;  2MD7 B;  3N9N A;  2AN6 A;  2F6J A;  1K2F A;  4B86 C;  2KFT A;  4O64 A;  4O62 A;  4YC9 A;  4AP4 A;  1JOC A;  4QF3 A;  4H9D A;  5B77 A;  1DVP A;  2CSZ A;  3U5M A;  2OWA A;  3FM8 C;  5C13 A;  5C11 A;  5D1L B;  2RI7 A;  4LJN A;  1WGM A;  2LGK A;  5G0F A;  1HYI A;  2YVR A;  1X4I A;  4WZ3 B;  3HCU A;  2F42 A;  3M99 A;  2KU3 A;  2LGG A;  2XOY A;  1BOR A;  4CCG X;  3U5O A;  4N4F A;  2MKE A;  2LXH C;  2YSM A;  4Z0O A;  1WEE A;  5H1U A;  3MDB C;  3LVQ E;  4L58 A;  3VK6 A;  2XB1 A;  5KH3 A;  3M62 A;  2KRE A;  2L43 A;  2YUR A;  5LKX A;  2QJ0 A;  2LGV A;  5G04 B;  3DQV R;  4LLB A;  5EYA F;  2FUI A;  4A0C D;  2FSA A;  3L1X A;  4IC3 A;  2VPE A;  4V3L C;  5LKZ A;  4YAB A;  3PUR A;  4R7E A;  4FO9 A;  5LKT A;  1CHC A;  1RMD A;  4V3K C;  2M85 A;  2ECI A;  1E4U A;  4WA6 A;  2Y1N A;  2YYR A;  2G45 A;  2KYU A;  2ECV A;  3T7L A;  3SOU A;  2VJE B;  2VPB A;  2L75 A;  4L7X A;  2VPD A;  5KH7 A;  3SOX A;  3I2D A;  4MVT A;  3T9K A;  2LN0 A;  3ZTG A;  2ECG A;  3Q1D A;  1MM3 A;  2BAY A;  2EGP A;  2YHN A;  4Z0R A;  1Z6U A;  2YQM A;  2CT2 A;  3M7K A;  2XP0 A;  3L11 A;  2CRR A;  5DKA A;  1WFK A;  2XOC A;  3SOW A;  2NAA A;  4AUQ B;  2XOZ A;  4YBS A;  3O7A A;  1LDK C;  2UZG A;  3KNV A;  4I7B A;  2YT5 A;  3IHP A;  3RTR B;  3DWD A;  3KDE C;  4LK9 A;  4UI9 B;  3ZYQ A;  4P5O B;  4Q6F A;  3ZPV E;  3LJU X;  1VYX A;  2ECN A;  1Z60 A;  2E6R A;  2KWN A;  1F62 A;  1WEM A;  3U5P A;  5SVX A;  2LRI C;  2EGM A;  2MA6 A;  2YRE A;  3O34 A;  4GNG A;  2K1J A;  5B8D A;  2LGL A;  4W4U A;  1WEN A;  3SUB A;  4UP0 A;  4YAX A;  4BHW A;  5I3L A;  2Y1M A;  3RPG B;  3RPG C;  2VPG A;  1WIL A;  4WZ2 A;  5FB0 A;  2CRW A;  2JMI A;  4C9Z A;  2LDR A;  2M1R A;  5TAB A;  4YBM A;  2IDA A;  2DX8 A;  2Y43 A;  4TKP B;  2B0O E;  4S3O B;  4S3O C;  1N87 A;  3QZV A;  1XWH A;  4R8P K;  2MT5 A;  5K3Q A;  2VJE A;  3ASL A;  4A4C A;  2L5U A;  2CSV A;  2KR4 A;  2DSM A;  2EA6 A;  3JUE A;  2HYE D;  5LKU A;  5B76 A;  2PUY A;  5SVI B;  3LQJ A;  2KGI A;  2HDP A;  4QF2 A;  1X4U A;  4FJC A;  3N9P A;  4IC2 A;  3LVR E;  5H1T A;  1HYJ A;  3H7H A;  4YAT A;  3HCT A;  1WE9 A;  2MD8 C;  2JUN A;  3O47 A;  5KH9 A;  2M13 A;  4X3G A;  1WEV A;  3DDT A;  2EOD A;  2FUU A;  4N3W A;  3EB5 A;  3SHB A;  3ZNI A;  3FAN A;  2I50 A;  3FL2 A;  2M6M A;  2IQJ A; 
#chains in the Genus database with same CATH homology
 2KGG A;  3N9O A;  4FIP A;  2C2L A;  1WEU A;  3LRQ A;  4PTB A;  1FP0 A;  2KWO A;  3ZPV 1;  2XEU A;  2YUC A;  2LQ6 A;  1V87 A;  3O37 A;  1WEQ A;  5FEY A;  5TDW A;  2MUM A;  5TBN A;  2VJF B;  1U6G B;  2KE1 A;  2K4D A;  1WEW A;  4CA1 A;  5FB1 A;  4PPE A;  1Z2Q A;  3N9M A;  4GND A;  4I7C A;  4YBT A;  2ECT A;  4LKA A;  4UP5 A;  3N9Q A;  2QIZ A;  5TDR A;  4AYC B;  2ECJ A;  2YSJ A;  5J3X A;  5JG6 A;  5AIU A;  4LAD B;  4BBQ A;  2E6S A;  3O35 A;  4GNE A;  3O33 A;  4YAD A;  2D8S A;  5D1K B;  5B79 A;  2MA5 A;  4A4B A;  5LCW B;  5B75 A;  2F6N A;  1ZBD B;  3MHH A;  3ZVY A;  2YQL A;  3LQI A;  3T6R A;  4I7D A;  3V43 A;  2H0D B;  2CKL B;  1JM7 B;  2JMJ A;  1FBV A;  2KWJ A;  5G05 B;  2M3H A;  3O36 A;  3O70 A;  2MNZ A;  2JMD A;  3KV6 A;  5DIN A;  2KIZ A;  1T1H A;  1IYM A;  2VP7 A;  2VNF A;  2YHO A;  3GL6 A;  1G25 A;  2K16 A;  2C2V S;  1VFY A;  3C6W A;  1MM2 A;  2MIQ A;  5H9M A;  2VJF A;  3GV4 A;  2K17 A;  5AIT A;  4ZDT A;  5FER A;  2KWK A;  4A49 A;  2OXQ C;  2LV9 A;  2L80 A;  4FK5 A;  2G43 A;  2ZET C;  2MNY A;  2YU4 A;  1WES A;  4NN2 A;  4F52 B;  4AYC A;  3C5K A;  4XI1 A;  3MHS A;  3N9L A;  2LXP C;  3KV5 A;  3L1Z B;  4GNF A;  4R2Y A;  1WEP A;  1LDJ B;  4GB0 A;  2L0B A;  3PUQ A;  1X4J A;  2JRJ A;  1WEO A;  2ECW A;  1WIM A;  3U5N A;  5D1M B;  2PNX A;  4ZUX U;  2CSY A;  2G6Q A;  2RSD A;  3DPL R;  3HCS A;  4WZ0 A;  3ZVZ B;  3KQI A;  2H0D A;  2CKL A;  1JM7 A;  3LQH A;  3EB6 A;  5H1V A;  2QIC A;  2YW8 A;  3HTK C;  3M63 A;  5TRB A;  4AVX A;  4B7Y C;  3NG2 A;  5B78 A;  4ZQL A;  4MSX A;  1VD4 A;  3PHD A;  2MD7 B;  3N9N A;  2AN6 A;  2F6J A;  1K2F A;  4B86 C;  2KFT A;  4O64 A;  4YC9 A;  4AP4 A;  1JOC A;  4QF3 A;  5B77 A;  1DVP A;  2CSZ A;  3U5M A;  5C13 A;  5C11 A;  5D1L B;  2RI7 A;  4LJN A;  1WGM A;  2LGK A;  5G0F A;  1HYI A;  1X4I A;  4WZ3 B;  3HCU A;  2F42 A;  3M99 A;  2KU3 A;  2LGG A;  1BOR A;  4CCG X;  3U5O A;  4N4F A;  2YSM A;  2LXH C;  1WEE A;  5H1U A;  4L58 A;  3VK6 A;  2XB1 A;  5KH3 A;  3M62 A;  2KRE A;  2L43 A;  2YUR A;  5LKX A;  2QJ0 A;  2LGV A;  5G04 B;  3DQV R;  4LLB A;  5EYA F;  2FUI A;  4A0C D;  2FSA A;  3L1X A;  4IC3 A;  2VPE A;  4V3L C;  5LKZ A;  4YAB A;  3PUR A;  4R7E A;  4FO9 A;  5LKT A;  1CHC A;  1RMD A;  4V3K C;  2M85 A;  2ECI A;  1E4U A;  4WA6 A;  2Y1N A;  2YYR A;  2G45 A;  2KYU A;  2ECV A;  3T7L A;  3SOU A;  2VJE B;  2VPB A;  2L75 A;  4L7X A;  2VPD A;  5KH7 A;  3SOX A;  3I2D A;  4MVT A;  2LN0 A;  3ZTG A;  2ECG A;  1MM3 A;  2BAY A;  2EGP A;  2YHN A;  1Z6U A;  2YQM A;  2CT2 A;  3L11 A;  5DKA A;  1WFK A;  3SOW A;  2NAA A;  4AUQ B;  4YBS A;  3O7A A;  1LDK C;  2UZG A;  3KNV A;  4I7B A;  2YT5 A;  3IHP A;  3RTR B;  4LK9 A;  4UI9 B;  3ZYQ A;  4P5O B;  4Q6F A;  3ZPV E;  1VYX A;  2ECN A;  1Z60 A;  2E6R A;  2KWN A;  1F62 A;  1WEM A;  3U5P A;  2LRI C;  2MA6 A;  2YRE A;  3O34 A;  4GNG A;  2K1J A;  5B8D A;  2LGL A;  4W4U A;  1WEN A;  4UP0 A;  4YAX A;  4BHW A;  5I3L A;  2Y1M A;  3RPG B;  3RPG C;  2VPG A;  1WIL A;  4WZ2 A;  5FB0 A;  2JMI A;  4C9Z A;  2LDR A;  2M1R A;  5TAB A;  4YBM A;  2IDA A;  2DX8 A;  2Y43 A;  4TKP B;  4S3O B;  4S3O C;  1N87 A;  3QZV A;  1XWH A;  4R8P K;  2MT5 A;  2VJE A;  3ASL A;  4A4C A;  2L5U A;  2KR4 A;  2EA6 A;  2HYE D;  5LKU A;  5B76 A;  2PUY A;  3LQJ A;  2KGI A;  2HDP A;  4QF2 A;  1X4U A;  4FJC A;  3N9P A;  4IC2 A;  5H1T A;  1HYJ A;  4YAT A;  3HCT A;  1WE9 A;  2MD8 C;  5KH9 A;  4X3G A;  1WEV A;  3EB5 A;  2EOD A;  2FUU A;  4N3W A;  3SHB A;  3ZNI A;  2I50 A;  3FL2 A;  2M6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...