4UP5A

Crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a chemical fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
85
Chain Sequence
GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up5A00
4GNEA 3L1XA 5D1LB 1WE9A 3GV4A 3RPGC 1FBVA 2KWNA 1WGMA 4QF2A 3O36A 4FJCA 5KH7A 4YBMA 5H1UA 2K17A 5TDRA 4PPEA 3HCSA 2HDPA 2VJEA 4BBQA 3HCUA 4UP5A 3KV6A 5LKXA 2JMDA 2MNZA 4FIPA 1VFYA 3O33A 1WEQA 2E6RA 4ZQLA 1RMDA 3C6WA 3SOUA 2PUYA 2FSAA 2CKLB 2ECIA 2LV9A 5C11A 4A49A 4LADB 4IC2A 2KWKA 3I2DA 2C2LA 4PTBA 4YABA 5G05B 3L1ZB 2D8SA 2XEUA 4R8PK 4O64A 2M3HA 2VJFA 1BORA 2MA5A 5LKUA 5H9MA 3N9NA 5D1MB 2RI7A 1CHCA 1DVPA 4UI9B 4B7YC 4V3LC 4MSXA 3KQIA 2ECGA 2YYRA 2L75A 3O34A 5DKAA 2XB1A 1VYXA 1WEMA 4ZUXU 5TABA 5C13A 4L7XA 4WZ2A 5B76A 3MHSA 4IC3A 2BAYA 3O7AA 3V43A 5B77A 5B78A 5DINA 4YAXA 4LKAA 2QJ0A 2YURA 2VPBA 3EB6A 5FB1A 1HYJA 4GNFA 3SOXA 3MHHA 3VK6A 5KH9A 2KGIA 5H1TA 2EODA 2L0BA 2LN0A 2RSDA 2VPGA 3ZPV1 3N9QA 3ZTGA 2MNYA 5B75A 2JMJA 4I7CA 2LRIC 2LXHC 2YSJA 2KWOA 2F42A 2M6MA 2KGGA 4NN2A 2G45A 4WZ3B 3N9MA 2MA6A 3N9PA 4UP0A 5G04B 4LLBA 1WESA 3ZYQA 3U5NA 4WA6A 4YATA 2CKLA 4AYCA 1MM3A 4YC9A 2MIQA 2LGVA 2KR4A 3T6RA 3U5MA 1WEVA 1WIMA 4AYCB 2CT2A 2MD8C 2YREA 2YQLA 2L5UA 1WEEA 1JM7A 3SOWA 3PURA 2C2VS 3IHPA 4QF3A 2K4DA 3PHDA 2L43A 3ZNIA 2NAAA 2LGKA 1K2FA 1JM7B 5TRBA 3EB5A 4BHWA 2LGGA 2YW8A 1WEOA 4I7BA 2L80A 1FP0A 4I7DA 1IYMA 2K1JA 3KNVA 2UZGA 2IDAA 2PNXA 2Y43A 2FUUA 5TDWA 1T1HA 4GNGA 4XI1A 2Y1NA 3O35A 3DQVR 2MT5A 2MUMA 2KIZA 2ECTA 3LQJA 2JRJA 4N4FA 5LKZA 5EYAF 3RTRB 4A0CD 1Z2QA 1X4JA 3O70A 2Y1MA 5FERA 3LQHA 1N87A 3N9LA 3HCTA 1WEUA 2F6JA 2CSYA 2F6NA 3HTKC 1LDJB 2KWJA 5LKTA 4AUQB 2I50A 1JOCA 1X4UA 2LXPC 2KU3A 1WILA 2ECJA 2VPDA 2CSZA 4P5OB 3DPLR 4AP4A 1WEPA 4AVXA 3U5PA 2LQ6A 4ZDTA 2QIZA 5FB0A 1MM2A 2KYUA 3GL6A 5G0FA 5LCWB 1LDKC 4R2YA 1Z6UA 3ZPVE 4FK5A 2K16A 4CCGX 2YU4A 2EGPA 3KV5A 4F52B 2OXQC 3PUQA 2YHOA 2G6QA 3SHBA 2YQMA 5I3LA 3NG2A 2KREA 2YT5A 4LJNA 2MD7B 4YBTA 4GNDA 2VJEB 1WFKA 2ECWA 4L58A 3T7LA 2LGLA 3M63A 3O37A 4YADA 4FO9A 3N9OA 4N3WA 4S3OB 5AITA 2YHNA 1Z60A 4B86C 2DX8A 2ECNA 4CA1A 2LDRA 2VNFA 3LRQA 3M62A 3QZVA 3RPGB 1U6GB 3FL2A 4W4UA 2KFTA 3ZVYA 3L11A 1VD4A 1WENA 4YBSA 2YUCA 1X4IA 2H0DA 2G43A 2VJFB 2VP7A 4A4CA 2EA6A 2HYED 3U5OA 4WZ0A 2YSMA 4R7EA 1G25A 2H0DB 2KE1A 3LQIA 3M99A 1V87A 1E4UA 5AIUA 4C9ZA 2E6SA 2ZETC 4GB0A 5B8DA 2QICA 2FUIA 3ZVZB 2JMIA 3ASLA 4X3GA 2M1RA 4A4BA 2M85A 1F62A 1HYIA 5TBNA 5H1VA 5KH3A 4MVTA 4Q6FA 5FEYA 2ECVA 1XWHA 4TKPB 1ZBDB 2VPEA 4V3KC 5JG6A 5B79A 4S3OC 4LK9A 1WEWA 3C5KA 2AN6A 5J3XA 5D1KB
chains in the Genus database with same CATH superfamily
2RR4A 2D8UA 4GNEA 3L1XA 2IQJA 5D1LB 1WE9A 3GV4A 3RPGC 2MKEA 1FBVA 2KWNA 1WGMA 2EGMA 4QF2A 3O36A 4FJCA 5KH7A 4YBMA 5H1UA 2K17A 5TDRA 4PPEA 3HCSA 2HDPA 4OGCA 2VJEA 1DCQA 4BBQA 3HCUA 4UP5A 3KV6A 5LKXA 2JMDA 2MNZA 2M13A 4FIPA 1VFYA 3O33A 1WEQA 2E6RA 4ZQLA 1RMDA 3C6WA 3SOUA 2PUYA 2FSAA 2OWAA 2CKLB 2ECIA 2LV9A 5C11A 4A49A 4LADB 4IC2A 2L7PA 2XOYA 2KWKA 3I2DA 2C2LA 4PTBA 4YABA 4F1PA 5G05B 3L1ZB 2D8SA 2XEUA 4R8PK 4O64A 2M3HA 2XP0A 2VJFA 2CSVA 1BORA 2MA5A 5LKUA 5H9MA 3LJUX 3N9NA 5D1MB 2RI7A 1CHCA 1DVPA 4UI9B 4B7YC 4V3LC 4MSXA 3KQIA 2ECGA 2LAUA 2YYRA 4OGEA 2L75A 3O34A 5DKAA 2XB1A 1VYXA 1WEMA 4ZUXU 5TABA 3LDYA 3DWDA 5C13A 4L7XA 5SVYA 4WZ2A 3LVRE 5B76A 3MHSA 2P57A 4IC3A 2BAYA 3O7AA 3V43A 4O62A 5B77A 5B78A 5DINA 4YAXA 4LKAA 2QJ0A 2YURA 2VPBA 2XOCA 3EB6A 5FB1A 1HYJA 4GNFA 3SOXA 3MHHA 3VK6A 5KH9A 2KGIA 5H1TA 2EODA 3T9KA 2L0BA 2LN0A 2RSDA 2VPGA 3ZPV1 3N9QA 3ZTGA 2MNYA 5B75A 2JMJA 4I7CA 2LRIC 2LXHC 2YSJA 2KWOA 2F42A 2M6MA 2KGGA 3PLWA 4NN2A 2FD4A 2G45A 4WZ3B 3N9MA 4Z0OA 2MA6A 3N9PA 4UP0A 5G04B 4LLBA 1WESA 3ZYQA 3DDTA 3U5NA 3E2DA 4WA6A 4YATA 2CKLA 4AYCA 1MM3A 4YC9A 2MIQA 2LGVA 2KR4A 3T6RA 3U5MA 1WEVA 1WIMA 4AYCB 2CT2A 2MD8C 2YREA 2YQLA 2EXUA 2L5UA 1WEEA 2CRRA 1JM7A 3SOWA 3PURA 2C2VS 3IHPA 4QF3A 2K4DA 3PHDA 2L43A 3ZNIA 2NAAA 2JUNA 2LGKA 1K2FA 1JM7B 5TRBA 3EB5A 4BHWA 2LGGA 2YW8A 1WEOA 4I7BA 2L80A 1FP0A 4I7DA 1IYMA 2K1JA 3KNVA 2UZGA 2IDAA 3FJUB 3H7HA 3MDBC 2PNXA 2Y43A 2FUUA 5TDWA 1T1HA 2CONA 4GNGA 4XI1A 2Y1NA 3O35A 3DQVR 2MT5A 2MUMA 3M7KA 2KIZA 2ECTA 3LQJA 3SUBA 2JRJA 4N4FA 5LKZA 5EYAF 2FFWA 3RTRB 4A0CD 1Z2QA 1X4JA 3O70A 2Y1MA 5FERA 3LQHA 1N87A 3N9LA 3HCTA 1WEUA 2F6JA 2CSYA 2F6NA 3HTKC 1LDJB 2KWJA 5LKTA 4AUQB 2I50A 2XOZA 1JOCA 1X4UA 2LXPC 2KU3A 1WILA 2ECJA 2VPDA 2CSZA 4P5OB 2CRWA 3DPLR 4AP4A 1WEPA 2KKYA 1MBMA 4AVXA 3U5PA 5K3QA 2LQ6A 4ZDTA 3O47A 2QIZA 5FB0A 1MM2A 2KYUA 3GL6A 5G0FA 5LCWB 1LDKC 4R2YA 1Z6UA 3ZPVE 4FK5A 2K16A 4CCGX 4H9DA 2YU4A 2EGPA 3KV5A 4F52B 5SVIA 2YVRA 2OXQC 3PUQA 2YHOA 2G6QA 3SHBA 3FANA 2YQMA 5I3LA 3NG2A 2DJAA 5SVIB 2KREA 2YT5A 4LJNA 2MD7B 3Q1DA 4YBTA 4GNDA 2VJEB 1WFKA 2ECWA 4L58A 4QQ4A 3T7LA 2LGLA 3M63A 3O37A 4YADA 4FO9A 3N9OA 4N3WA 4Z0RA 4S3OB 5AITA 2JM3A 2YHNA 1Z60A 4B86C 2DX8A 2ECNA 4CA1A 2LDRA 2VNFA 2KKXA 3LRQA 3M62A 3QZVA 3RPGB 1U6GB 3FL2A 4W4UA 2KFTA 5SVXA 3ZVYA 3L11A 1VD4A 1WENA 3JUEA 4YBSA 2YUCA 1X4IA 2H0DA 2G43A 2VJFB 2VP7A 4A4CA 2EA6A 2HYED 3U5OA 4WZ0A 2YSMA 4R7EA 1G25A 2H0DB 2KE1A 3LQIA 3M99A 1V87A 1E4UA 5AIUA 4C9ZA 2E6SA 3FM8C 2ZETC 4GB0A 5B8DA 3FEHA 2QICA 2FUIA 2E61A 3ZVZB 2JMIA 2DSMA 3ASLA 2M1RA 4X3GA 4A4BA 2M85A 1F62A 1HYIA 5TBNA 5H1VA 5KH3A 4MVTA 4Q6FA 3LVQE 5FEYA 2ECVA 1XWHA 4TKPB 1ZBDB 2VPEA 4V3KC 5JG6A 2B0OE 5B79A 4S3OC 4LK9A 1WEWA 3C5KA 3KDEC 2AN6A 5J3XA 3FAOA 5D1KB
chains in the Genus database with same CATH topology
4GNEA 3L1XA 5D1LB 1WE9A 3GV4A 3RPGC 1FBVA 2KWNA 1WGMA 4QF2A 3O36A 4FJCA 5KH7A 4YBMA 5H1UA 2K17A 5TDRA 4PPEA 3HCSA 2HDPA 2VJEA 4BBQA 3HCUA 4UP5A 3KV6A 5LKXA 2JMDA 2MNZA 4FIPA 1VFYA 3O33A 1WEQA 2E6RA 4ZQLA 1RMDA 3C6WA 3SOUA 2PUYA 2FSAA 2CKLB 2ECIA 2LV9A 5C11A 4A49A 4LADB 4IC2A 2KWKA 3I2DA 2C2LA 4PTBA 4YABA 5G05B 3L1ZB 2D8SA 2XEUA 4R8PK 4O64A 2M3HA 2VJFA 1BORA 2MA5A 5LKUA 5H9MA 3N9NA 5D1MB 2RI7A 1CHCA 1DVPA 4UI9B 4B7YC 4V3LC 4MSXA 3KQIA 2ECGA 2YYRA 2L75A 3O34A 5DKAA 2XB1A 1VYXA 1WEMA 4ZUXU 5TABA 5C13A 4L7XA 4WZ2A 5B76A 3MHSA 4IC3A 2BAYA 3O7AA 3V43A 5B77A 5B78A 5DINA 4YAXA 4LKAA 2QJ0A 2YURA 2VPBA 3EB6A 5FB1A 1HYJA 4GNFA 3SOXA 3MHHA 3VK6A 5KH9A 2KGIA 5H1TA 2EODA 2L0BA 2LN0A 2RSDA 2VPGA 3ZPV1 3N9QA 3ZTGA 2MNYA 5B75A 2JMJA 4I7CA 2LRIC 2LXHC 2YSJA 2KWOA 2F42A 2M6MA 2KGGA 4NN2A 2G45A 4WZ3B 3N9MA 2MA6A 3N9PA 4UP0A 5G04B 4LLBA 1WESA 3ZYQA 3U5NA 4WA6A 4YATA 2CKLA 4AYCA 1MM3A 4YC9A 2MIQA 2LGVA 2KR4A 3T6RA 3U5MA 1WEVA 1WIMA 4AYCB 2CT2A 2MD8C 2YREA 2YQLA 2L5UA 1WEEA 1JM7A 3SOWA 3PURA 2C2VS 3IHPA 4QF3A 2K4DA 3PHDA 2L43A 3ZNIA 2NAAA 2LGKA 1K2FA 1JM7B 5TRBA 3EB5A 4BHWA 2LGGA 2YW8A 1WEOA 4I7BA 2L80A 1FP0A 4I7DA 1IYMA 2K1JA 3KNVA 2UZGA 2IDAA 2PNXA 2Y43A 2FUUA 5TDWA 1T1HA 4GNGA 4XI1A 2Y1NA 3O35A 3DQVR 2MT5A 2MUMA 2KIZA 2ECTA 3LQJA 2JRJA 4N4FA 5LKZA 5EYAF 3RTRB 4A0CD 1Z2QA 1X4JA 3O70A 2Y1MA 5FERA 3LQHA 1N87A 3N9LA 3HCTA 1WEUA 2F6JA 2CSYA 2F6NA 3HTKC 1LDJB 2KWJA 5LKTA 4AUQB 2I50A 1JOCA 1X4UA 2LXPC 2KU3A 1WILA 2ECJA 2VPDA 2CSZA 4P5OB 3DPLR 4AP4A 1WEPA 4AVXA 3U5PA 2LQ6A 4ZDTA 2QIZA 5FB0A 1MM2A 2KYUA 3GL6A 5G0FA 5LCWB 1LDKC 4R2YA 1Z6UA 3ZPVE 4FK5A 2K16A 4CCGX 2YU4A 2EGPA 3KV5A 4F52B 2OXQC 3PUQA 2YHOA 2G6QA 3SHBA 2YQMA 5I3LA 3NG2A 2KREA 2YT5A 4LJNA 2MD7B 4YBTA 4GNDA 2VJEB 1WFKA 2ECWA 4L58A 3T7LA 2LGLA 3M63A 3O37A 4YADA 4FO9A 3N9OA 4N3WA 4S3OB 5AITA 2YHNA 1Z60A 4B86C 2DX8A 2ECNA 4CA1A 2LDRA 2VNFA 3LRQA 3M62A 3QZVA 3RPGB 1U6GB 3FL2A 4W4UA 2KFTA 3ZVYA 3L11A 1VD4A 1WENA 4YBSA 2YUCA 1X4IA 2H0DA 2G43A 2VJFB 2VP7A 4A4CA 2EA6A 2HYED 3U5OA 4WZ0A 2YSMA 4R7EA 1G25A 2H0DB 2KE1A 3LQIA 3M99A 1V87A 1E4UA 5AIUA 4C9ZA 2E6SA 2ZETC 4GB0A 5B8DA 2QICA 2FUIA 3ZVZB 2JMIA 3ASLA 4X3GA 2M1RA 4A4BA 2M85A 1F62A 1HYIA 5TBNA 5H1VA 5KH3A 4MVTA 4Q6FA 5FEYA 2ECVA 1XWHA 4TKPB 1ZBDB 2VPEA 4V3KC 5JG6A 5B79A 4S3OC 4LK9A 1WEWA 3C5KA 2AN6A 5J3XA 5D1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNE A;  3L1X A;  5D1L B;  1WE9 A;  3GV4 A;  3RPG C;  1FBV A;  2KWN A;  1WGM A;  4QF2 A;  3O36 A;  4FJC A;  5KH7 A;  4YBM A;  5H1U A;  2K17 A;  5TDR A;  4PPE A;  3HCS A;  2HDP A;  2VJE A;  4BBQ A;  3HCU A;  4UP5 A;  3KV6 A;  5LKX A;  2JMD A;  2MNZ A;  4FIP A;  1VFY A;  3O33 A;  1WEQ A;  2E6R A;  4ZQL A;  1RMD A;  3C6W A;  3SOU A;  2PUY A;  2FSA A;  2CKL B;  2ECI A;  2LV9 A;  5C11 A;  4A49 A;  4LAD B;  4IC2 A;  2KWK A;  3I2D A;  2C2L A;  4PTB A;  4YAB A;  5G05 B;  3L1Z B;  2D8S A;  2XEU A;  4R8P K;  4O64 A;  2M3H A;  2VJF A;  1BOR A;  2MA5 A;  5LKU A;  5H9M A;  3N9N A;  5D1M B;  2RI7 A;  1CHC A;  1DVP A;  4UI9 B;  4B7Y C;  4V3L C;  4MSX A;  3KQI A;  2ECG A;  2YYR A;  2L75 A;  3O34 A;  5DKA A;  2XB1 A;  1VYX A;  1WEM A;  4ZUX U;  5TAB A;  5C13 A;  4L7X A;  4WZ2 A;  5B76 A;  3MHS A;  4IC3 A;  2BAY A;  3O7A A;  3V43 A;  5B77 A;  5B78 A;  5DIN A;  4YAX A;  4LKA A;  2QJ0 A;  2YUR A;  2VPB A;  3EB6 A;  5FB1 A;  1HYJ A;  4GNF A;  3SOX A;  3MHH A;  3VK6 A;  5KH9 A;  2KGI A;  5H1T A;  2EOD A;  2L0B A;  2LN0 A;  2RSD A;  2VPG A;  3ZPV 1;  3N9Q A;  3ZTG A;  2MNY A;  5B75 A;  2JMJ A;  4I7C A;  2LRI C;  2LXH C;  2YSJ A;  2KWO A;  2F42 A;  2M6M A;  2KGG A;  4NN2 A;  2G45 A;  4WZ3 B;  3N9M A;  2MA6 A;  3N9P A;  4UP0 A;  5G04 B;  4LLB A;  1WES A;  3ZYQ A;  3U5N A;  4WA6 A;  4YAT A;  2CKL A;  4AYC A;  1MM3 A;  4YC9 A;  2MIQ A;  2LGV A;  2KR4 A;  3T6R A;  3U5M A;  1WEV A;  1WIM A;  4AYC B;  2CT2 A;  2MD8 C;  2YRE A;  2YQL A;  2L5U A;  1WEE A;  1JM7 A;  3SOW A;  3PUR A;  2C2V S;  3IHP A;  4QF3 A;  2K4D A;  3PHD A;  2L43 A;  3ZNI A;  2NAA A;  2LGK A;  1K2F A;  1JM7 B;  5TRB A;  3EB5 A;  4BHW A;  2LGG A;  2YW8 A;  1WEO A;  4I7B A;  2L80 A;  1FP0 A;  4I7D A;  1IYM A;  2K1J A;  3KNV A;  2UZG A;  2IDA A;  2PNX A;  2Y43 A;  2FUU A;  5TDW A;  1T1H A;  4GNG A;  4XI1 A;  2Y1N A;  3O35 A;  3DQV R;  2MT5 A;  2MUM A;  2KIZ A;  2ECT A;  3LQJ A;  2JRJ A;  4N4F A;  5LKZ A;  5EYA F;  3RTR B;  4A0C D;  1Z2Q A;  1X4J A;  3O70 A;  2Y1M A;  5FER A;  3LQH A;  1N87 A;  3N9L A;  3HCT A;  1WEU A;  2F6J A;  2CSY A;  2F6N A;  3HTK C;  1LDJ B;  2KWJ A;  5LKT A;  4AUQ B;  2I50 A;  1JOC A;  1X4U A;  2LXP C;  2KU3 A;  1WIL A;  2ECJ A;  2VPD A;  2CSZ A;  4P5O B;  3DPL R;  4AP4 A;  1WEP A;  4AVX A;  3U5P A;  2LQ6 A;  4ZDT A;  2QIZ A;  5FB0 A;  1MM2 A;  2KYU A;  3GL6 A;  5G0F A;  5LCW B;  1LDK C;  4R2Y A;  1Z6U A;  3ZPV E;  4FK5 A;  2K16 A;  4CCG X;  2YU4 A;  2EGP A;  3KV5 A;  4F52 B;  2OXQ C;  3PUQ A;  2YHO A;  2G6Q A;  3SHB A;  2YQM A;  5I3L A;  3NG2 A;  2KRE A;  2YT5 A;  4LJN A;  2MD7 B;  4YBT A;  4GND A;  2VJE B;  1WFK A;  2ECW A;  4L58 A;  3T7L A;  2LGL A;  3M63 A;  3O37 A;  4YAD A;  4FO9 A;  3N9O A;  4N3W A;  4S3O B;  5AIT A;  2YHN A;  1Z60 A;  4B86 C;  2DX8 A;  2ECN A;  4CA1 A;  2LDR A;  2VNF A;  3LRQ A;  3M62 A;  3QZV A;  3RPG B;  1U6G B;  3FL2 A;  4W4U A;  2KFT A;  3ZVY A;  3L11 A;  1VD4 A;  1WEN A;  4YBS A;  2YUC A;  1X4I A;  2H0D A;  2G43 A;  2VJF B;  2VP7 A;  4A4C A;  2EA6 A;  2HYE D;  3U5O A;  4WZ0 A;  2YSM A;  4R7E A;  1G25 A;  2H0D B;  2KE1 A;  3LQI A;  3M99 A;  1V87 A;  1E4U A;  5AIU A;  4C9Z A;  2E6S A;  2ZET C;  4GB0 A;  5B8D A;  2QIC A;  2FUI A;  3ZVZ B;  2JMI A;  3ASL A;  4X3G A;  2M1R A;  4A4B A;  2M85 A;  1F62 A;  1HYI A;  5TBN A;  5H1V A;  5KH3 A;  4MVT A;  4Q6F A;  5FEY A;  2ECV A;  1XWH A;  4TKP B;  1ZBD B;  2VPE A;  4V3K C;  5JG6 A;  5B79 A;  4S3O C;  4LK9 A;  1WEW A;  3C5K A;  2AN6 A;  5J3X A;  5D1K B; 
#chains in the Genus database with same CATH topology
 2RR4 A;  2D8U A;  4GNE A;  3L1X A;  2IQJ A;  5D1L B;  1WE9 A;  3GV4 A;  3RPG C;  2MKE A;  1FBV A;  2KWN A;  1WGM A;  2EGM A;  4QF2 A;  3O36 A;  4FJC A;  5KH7 A;  4YBM A;  5H1U A;  2K17 A;  5TDR A;  4PPE A;  3HCS A;  2HDP A;  4OGC A;  2VJE A;  1DCQ A;  4BBQ A;  3HCU A;  4UP5 A;  3KV6 A;  5LKX A;  2JMD A;  2MNZ A;  2M13 A;  4FIP A;  1VFY A;  3O33 A;  1WEQ A;  2E6R A;  4ZQL A;  1RMD A;  3C6W A;  3SOU A;  2PUY A;  2FSA A;  2OWA A;  2CKL B;  2ECI A;  2LV9 A;  5C11 A;  4A49 A;  4LAD B;  4IC2 A;  2L7P A;  2XOY A;  2KWK A;  3I2D A;  2C2L A;  4PTB A;  4YAB A;  4F1P A;  5G05 B;  3L1Z B;  2D8S A;  2XEU A;  4R8P K;  4O64 A;  2M3H A;  2XP0 A;  2VJF A;  2CSV A;  1BOR A;  2MA5 A;  5LKU A;  5H9M A;  3LJU X;  3N9N A;  5D1M B;  2RI7 A;  1CHC A;  1DVP A;  4UI9 B;  4B7Y C;  4V3L C;  4MSX A;  3KQI A;  2ECG A;  2LAU A;  2YYR A;  4OGE A;  2L75 A;  3O34 A;  5DKA A;  2XB1 A;  1VYX A;  1WEM A;  4ZUX U;  5TAB A;  3LDY A;  3DWD A;  5C13 A;  4L7X A;  5SVY A;  4WZ2 A;  3LVR E;  5B76 A;  3MHS A;  2P57 A;  4IC3 A;  2BAY A;  3O7A A;  3V43 A;  4O62 A;  5B77 A;  5B78 A;  5DIN A;  4YAX A;  4LKA A;  2QJ0 A;  2YUR A;  2VPB A;  2XOC A;  3EB6 A;  5FB1 A;  1HYJ A;  4GNF A;  3SOX A;  3MHH A;  3VK6 A;  5KH9 A;  2KGI A;  5H1T A;  2EOD A;  3T9K A;  2L0B A;  2LN0 A;  2RSD A;  2VPG A;  3ZPV 1;  3N9Q A;  3ZTG A;  2MNY A;  5B75 A;  2JMJ A;  4I7C A;  2LRI C;  2LXH C;  2YSJ A;  2KWO A;  2F42 A;  2M6M A;  2KGG A;  3PLW A;  4NN2 A;  2FD4 A;  2G45 A;  4WZ3 B;  3N9M A;  4Z0O A;  2MA6 A;  3N9P A;  4UP0 A;  5G04 B;  4LLB A;  1WES A;  3ZYQ A;  3DDT A;  3U5N A;  3E2D A;  4WA6 A;  4YAT A;  2CKL A;  4AYC A;  1MM3 A;  4YC9 A;  2MIQ A;  2LGV A;  2KR4 A;  3T6R A;  3U5M A;  1WEV A;  1WIM A;  4AYC B;  2CT2 A;  2MD8 C;  2YRE A;  2YQL A;  2EXU A;  2L5U A;  1WEE A;  2CRR A;  1JM7 A;  3SOW A;  3PUR A;  2C2V S;  3IHP A;  4QF3 A;  2K4D A;  3PHD A;  2L43 A;  3ZNI A;  2NAA A;  2JUN A;  2LGK A;  1K2F A;  1JM7 B;  5TRB A;  3EB5 A;  4BHW A;  2LGG A;  2YW8 A;  1WEO A;  4I7B A;  2L80 A;  1FP0 A;  4I7D A;  1IYM A;  2K1J A;  3KNV A;  2UZG A;  2IDA A;  3FJU B;  3H7H A;  3MDB C;  2PNX A;  2Y43 A;  2FUU A;  5TDW A;  1T1H A;  2CON A;  4GNG A;  4XI1 A;  2Y1N A;  3O35 A;  3DQV R;  2MT5 A;  2MUM A;  3M7K A;  2KIZ A;  2ECT A;  3LQJ A;  3SUB A;  2JRJ A;  4N4F A;  5LKZ A;  5EYA F;  2FFW A;  3RTR B;  4A0C D;  1Z2Q A;  1X4J A;  3O70 A;  2Y1M A;  5FER A;  3LQH A;  1N87 A;  3N9L A;  3HCT A;  1WEU A;  2F6J A;  2CSY A;  2F6N A;  3HTK C;  1LDJ B;  2KWJ A;  5LKT A;  4AUQ B;  2I50 A;  2XOZ A;  1JOC A;  1X4U A;  2LXP C;  2KU3 A;  1WIL A;  2ECJ A;  2VPD A;  2CSZ A;  4P5O B;  2CRW A;  3DPL R;  4AP4 A;  1WEP A;  2KKY A;  1MBM A;  4AVX A;  3U5P A;  5K3Q A;  2LQ6 A;  4ZDT A;  3O47 A;  2QIZ A;  5FB0 A;  1MM2 A;  2KYU A;  3GL6 A;  5G0F A;  5LCW B;  1LDK C;  4R2Y A;  1Z6U A;  3ZPV E;  4FK5 A;  2K16 A;  4CCG X;  4H9D A;  2YU4 A;  2EGP A;  3KV5 A;  4F52 B;  5SVI A;  2YVR A;  2OXQ C;  3PUQ A;  2YHO A;  2G6Q A;  3SHB A;  3FAN A;  2YQM A;  5I3L A;  3NG2 A;  2DJA A;  5SVI B;  2KRE A;  2YT5 A;  4LJN A;  2MD7 B;  3Q1D A;  4YBT A;  4GND A;  2VJE B;  1WFK A;  2ECW A;  4L58 A;  4QQ4 A;  3T7L A;  2LGL A;  3M63 A;  3O37 A;  4YAD A;  4FO9 A;  3N9O A;  4N3W A;  4Z0R A;  4S3O B;  5AIT A;  2JM3 A;  2YHN A;  1Z60 A;  4B86 C;  2DX8 A;  2ECN A;  4CA1 A;  2LDR A;  2VNF A;  2KKX A;  3LRQ A;  3M62 A;  3QZV A;  3RPG B;  1U6G B;  3FL2 A;  4W4U A;  2KFT A;  5SVX A;  3ZVY A;  3L11 A;  1VD4 A;  1WEN A;  3JUE A;  4YBS A;  2YUC A;  1X4I A;  2H0D A;  2G43 A;  2VJF B;  2VP7 A;  4A4C A;  2EA6 A;  2HYE D;  3U5O A;  4WZ0 A;  2YSM A;  4R7E A;  1G25 A;  2H0D B;  2KE1 A;  3LQI A;  3M99 A;  1V87 A;  1E4U A;  5AIU A;  4C9Z A;  2E6S A;  3FM8 C;  2ZET C;  4GB0 A;  5B8D A;  3FEH A;  2QIC A;  2FUI A;  2E61 A;  3ZVZ B;  2JMI A;  2DSM A;  3ASL A;  2M1R A;  4X3G A;  4A4B A;  2M85 A;  1F62 A;  1HYI A;  5TBN A;  5H1V A;  5KH3 A;  4MVT A;  4Q6F A;  3LVQ E;  5FEY A;  2ECV A;  1XWH A;  4TKP B;  1ZBD B;  2VPE A;  4V3K C;  5JG6 A;  2B0O E;  5B79 A;  4S3O C;  4LK9 A;  1WEW A;  3C5K A;  3KDE C;  2AN6 A;  5J3X A;  3FAO A;  5D1K B; 
#chains in the Genus database with same CATH homology
 4GNE A;  3L1X A;  5D1L B;  1WE9 A;  3GV4 A;  3RPG C;  1FBV A;  2KWN A;  1WGM A;  4QF2 A;  3O36 A;  4FJC A;  5KH7 A;  4YBM A;  5H1U A;  2K17 A;  5TDR A;  4PPE A;  3HCS A;  2HDP A;  2VJE A;  4BBQ A;  3HCU A;  4UP5 A;  3KV6 A;  5LKX A;  2JMD A;  2MNZ A;  4FIP A;  1VFY A;  3O33 A;  1WEQ A;  2E6R A;  4ZQL A;  1RMD A;  3C6W A;  3SOU A;  2PUY A;  2FSA A;  2CKL B;  2ECI A;  2LV9 A;  5C11 A;  4A49 A;  4LAD B;  4IC2 A;  2KWK A;  3I2D A;  2C2L A;  4PTB A;  4YAB A;  5G05 B;  3L1Z B;  2D8S A;  2XEU A;  4R8P K;  4O64 A;  2M3H A;  2VJF A;  1BOR A;  2MA5 A;  5LKU A;  5H9M A;  3N9N A;  5D1M B;  2RI7 A;  1CHC A;  1DVP A;  4UI9 B;  4B7Y C;  4V3L C;  4MSX A;  3KQI A;  2ECG A;  2YYR A;  2L75 A;  3O34 A;  5DKA A;  2XB1 A;  1VYX A;  1WEM A;  4ZUX U;  5TAB A;  5C13 A;  4L7X A;  4WZ2 A;  5B76 A;  3MHS A;  4IC3 A;  2BAY A;  3O7A A;  3V43 A;  5B77 A;  5B78 A;  5DIN A;  4YAX A;  4LKA A;  2QJ0 A;  2YUR A;  2VPB A;  3EB6 A;  5FB1 A;  1HYJ A;  4GNF A;  3SOX A;  3MHH A;  3VK6 A;  5KH9 A;  2KGI A;  5H1T A;  2EOD A;  2L0B A;  2LN0 A;  2RSD A;  2VPG A;  3ZPV 1;  3N9Q A;  3ZTG A;  2MNY A;  5B75 A;  2JMJ A;  4I7C A;  2LRI C;  2LXH C;  2YSJ A;  2KWO A;  2F42 A;  2M6M A;  2KGG A;  4NN2 A;  2G45 A;  4WZ3 B;  3N9M A;  2MA6 A;  3N9P A;  4UP0 A;  5G04 B;  4LLB A;  1WES A;  3ZYQ A;  3U5N A;  4WA6 A;  4YAT A;  2CKL A;  4AYC A;  1MM3 A;  4YC9 A;  2MIQ A;  2LGV A;  2KR4 A;  3T6R A;  3U5M A;  1WEV A;  1WIM A;  4AYC B;  2CT2 A;  2MD8 C;  2YRE A;  2YQL A;  2L5U A;  1WEE A;  1JM7 A;  3SOW A;  3PUR A;  2C2V S;  3IHP A;  4QF3 A;  2K4D A;  3PHD A;  2L43 A;  3ZNI A;  2NAA A;  2LGK A;  1K2F A;  1JM7 B;  5TRB A;  3EB5 A;  4BHW A;  2LGG A;  2YW8 A;  1WEO A;  4I7B A;  2L80 A;  1FP0 A;  4I7D A;  1IYM A;  2K1J A;  3KNV A;  2UZG A;  2IDA A;  2PNX A;  2Y43 A;  2FUU A;  5TDW A;  1T1H A;  4GNG A;  4XI1 A;  2Y1N A;  3O35 A;  3DQV R;  2MT5 A;  2MUM A;  2KIZ A;  2ECT A;  3LQJ A;  2JRJ A;  4N4F A;  5LKZ A;  5EYA F;  3RTR B;  4A0C D;  1Z2Q A;  1X4J A;  3O70 A;  2Y1M A;  5FER A;  3LQH A;  1N87 A;  3N9L A;  3HCT A;  1WEU A;  2F6J A;  2CSY A;  2F6N A;  3HTK C;  1LDJ B;  2KWJ A;  5LKT A;  4AUQ B;  2I50 A;  1JOC A;  1X4U A;  2LXP C;  2KU3 A;  1WIL A;  2ECJ A;  2VPD A;  2CSZ A;  4P5O B;  3DPL R;  4AP4 A;  1WEP A;  4AVX A;  3U5P A;  2LQ6 A;  4ZDT A;  2QIZ A;  5FB0 A;  1MM2 A;  2KYU A;  3GL6 A;  5G0F A;  5LCW B;  1LDK C;  4R2Y A;  1Z6U A;  3ZPV E;  4FK5 A;  2K16 A;  4CCG X;  2YU4 A;  2EGP A;  3KV5 A;  4F52 B;  2OXQ C;  3PUQ A;  2YHO A;  2G6Q A;  3SHB A;  2YQM A;  5I3L A;  3NG2 A;  2KRE A;  2YT5 A;  4LJN A;  2MD7 B;  4YBT A;  4GND A;  2VJE B;  1WFK A;  2ECW A;  4L58 A;  3T7L A;  2LGL A;  3M63 A;  3O37 A;  4YAD A;  4FO9 A;  3N9O A;  4N3W A;  4S3O B;  5AIT A;  2YHN A;  1Z60 A;  4B86 C;  2DX8 A;  2ECN A;  4CA1 A;  2LDR A;  2VNF A;  3LRQ A;  3M62 A;  3QZV A;  3RPG B;  1U6G B;  3FL2 A;  4W4U A;  2KFT A;  3ZVY A;  3L11 A;  1VD4 A;  1WEN A;  4YBS A;  2YUC A;  1X4I A;  2H0D A;  2G43 A;  2VJF B;  2VP7 A;  4A4C A;  2EA6 A;  2HYE D;  3U5O A;  4WZ0 A;  2YSM A;  4R7E A;  1G25 A;  2H0D B;  2KE1 A;  3LQI A;  3M99 A;  1V87 A;  1E4U A;  5AIU A;  4C9Z A;  2E6S A;  2ZET C;  4GB0 A;  5B8D A;  2QIC A;  2FUI A;  3ZVZ B;  2JMI A;  3ASL A;  4X3G A;  2M1R A;  4A4B A;  2M85 A;  1F62 A;  1HYI A;  5TBN A;  5H1V A;  5KH3 A;  4MVT A;  4Q6F A;  5FEY A;  2ECV A;  1XWH A;  4TKP B;  1ZBD B;  2VPE A;  4V3K C;  5JG6 A;  5B79 A;  4S3O C;  4LK9 A;  1WEW A;  3C5K A;  2AN6 A;  5J3X A;  5D1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...