4UP5A

Crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a chemical fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
85
Chain Sequence
b'GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up5A00
4UP0A 2LRIC 5H9MA 2LGVA 3C5KA 2RI7A 2L80A 4S3OC 4FIPA 2MIQA 2K17A 4AP4A 3IHPA 5C13A 2VJEB 4IC2A 2G6QA 4QF3A 2KWNA 3VK6A 2LDRA 1X4IA 5H1UA 1U6GB 1HYIA 5AIUA 2FSAA 2VPGA 3RPGB 4BBQA 3FL2A 1JM7B 4A0CD 2VP7A 4C9ZA 2G43A 3N9OA 2VJFB 5KH7A 4A49A 4MSXA 4CCGX 1N87A 5LCWB 2YU4A 2YURA 2ZETC 4V3LC 2ECGA 4F52B 4Q6FA 2JMDA 2KR4A 2FUIA 2KU3A 1DVPA 2YYRA 1BORA 4GB0A 4GNFA 4V3KC 2ECWA 5EYAF 3KQIA 5B79A 3HCUA 3ZPVE 2EGPA 5J3XA 5FEYA 4XI1A 2M3HA 5FERA 1ZBDB 2K1JA 1RMDA 3ZYQA 1WEOA 4AYCB 3ZVZB 2CKLB 2JRJA 2MD8C 4R7EA 2E6RA 2KYUA 3MHSA 5TDRA 2YQLA 4B7YC 2MA6A 2Y1MA 4I7BA 1V87A 3O34A 4A4CA 5B8DA 1WE9A 4WA6A 2LN0A 2KWOA 2LXHC 3N9QA 2KWKA 1MM3A 4FO9A 1XWHA 1G25A 4GNEA 2KGIA 4YBMA 2YHNA 5TABA 1HYJA 5DKAA 3O36A 3O37A 2L0BA 2H0DB 2F42A 1WEEA 1VYXA 1VFYA 3L11A 2YSJA 1LDJB 4ZQLA 2ECJA 4GNDA 2YW8A 3T6RA 4LJNA 2LV9A 1WEPA 2RSDA 3LQJA 1JOCA 3KV5A 2EODA 2KGGA 3V43A 2ECNA 4R2YA 2FUUA 2OXQC 2LGGA 4B86C 2CT2A 5C11A 3N9MA 1Z6UA 3SHBA 2YREA 2F6NA 3EB5A 4AVXA 5FB1A 4LKAA 3NG2A 2MUMA 3ZNIA 1Z2QA 1F62A 2Y43A 3RTRB 4MVTA 4O64A 5FB0A 3O70A 5G04B 2VPDA 3O35A 3DPLR 3MHHA 2LGLA 1WESA 3RPGC 1LDKC 5KH3A 2MA5A 4R8PK 2L75A 2MNYA 1WFKA 4YATA 2CSYA 4WZ0A 2HYED 4I7DA 3U5PA 5TRBA 2ECIA 5B78A 3DQVR 2VJEA 3LQIA 4TKPB 4I7CA 4AUQB 3EB6A 2NAAA 4P5OB 3U5OA 1JM7A 2F6JA 2MD7B 2JMIA 2LGKA 5LKZA 2QICA 4PTBA 2VJFA 2JMJA 3L1ZB 5H1VA 1Z60A 5LKTA 4FJCA 3N9PA 1T1HA 4X3GA 2QJ0A 4L58A 1WEWA 3N9LA 2IDAA 3LRQA 3SOWA 3C6WA 2G45A 3PHDA 4FK5A 2QIZA 1WGMA 4S3OB 3T7LA 2PUYA 3ASLA 2E6SA 1WEMA 2Y1NA 5AITA 1K2FA 2LQ6A 3PUQA 3M63A 2YQMA 5TBNA 3GL6A 5D1LB 4AYCA 1FP0A 2CKLA 2VPBA 2MT5A 4YADA 2KE1A 3O7AA 4GNGA 5JG6A 1FBVA 5D1KB 3U5NA 3U5MA 1X4UA 1E4UA 3KNVA 3HTKC 4BHWA 1IYMA 5B76A 5G05B 3M62A 4LADB 4WZ2A 2BAYA 3HCTA 1WENA 3KV6A 2HDPA 4UP5A 5TDWA 3PURA 1WIMA 3M99A 2D8SA 2VPEA 3I2DA 2YHOA 2H0DA 2KREA 2C2VS 4A4BA 4ZUXU 2M6MA 2K4DA 3LQHA 4NN2A 4YAXA 1CHCA 2AN6A 4QF2A 2K16A 3ZTGA 4CA1A 4YBSA 2YT5A 2MNZA 2XEUA 5H1TA 2DX8A 2YUCA 4YBTA 2M85A 1MM2A 4N3WA 3L1XA 2VNFA 4UI9B 4W4UA 4N4FA 2YSMA 3ZPV1 5KH9A 2EA6A 2LXPC 2CSZA 3N9NA 4YC9A 4LK9A 5G0FA 5LKUA 1WEQA 1X4JA 3QZVA 3HCSA 4LLBA 3SOUA 4ZDTA 2L43A 2UZGA 5B77A 5I3LA 4YABA 5DINA 5B75A 5D1MB 3O33A 4IC3A 3ZVYA 2KFTA 2KIZA 1VD4A 5LKXA 4L7XA 1WEVA 2KWJA 2L5UA 2M1RA 2PNXA 2I50A 4PPEA 1WILA 3SOXA 2ECTA 2ECVA 2XB1A 3GV4A 4WZ3B 1WEUA 2C2LA
chains in the Genus database with same CATH superfamily
3T9KA 2FFWA 4UP0A 2LRIC 5H9MA 2LGVA 3C5KA 2RI7A 2L80A 4S3OC 4FIPA 3LDYA 2MIQA 2K17A 2XP0A 4AP4A 3IHPA 5C13A 4QF3A 2VJEB 2G6QA 4IC2A 2KWNA 3VK6A 2LDRA 1X4IA 5H1UA 1U6GB 3FAOA 1HYIA 5AIUA 2FSAA 2VPGA 3RPGB 4BBQA 3FL2A 1JM7B 4A0CD 3LJUX 4F1PA 3FJUB 2VP7A 4C9ZA 2G43A 3N9OA 2VJFB 5KH7A 4A49A 4MSXA 4CCGX 1N87A 5LCWB 2YU4A 2YURA 2ZETC 4V3LC 2ECGA 4F52B 4Q6FA 2JMDA 2KR4A 2FUIA 4OGCA 2KU3A 2XOCA 1DVPA 2YYRA 1BORA 4GB0A 4GNFA 4V3KC 2ECWA 5EYAF 3KQIA 5B79A 3HCUA 3ZPVE 2EGPA 5J3XA 5FEYA 4XI1A 2M3HA 5FERA 1ZBDB 2K1JA 1RMDA 3ZYQA 1WEOA 2JUNA 4AYCB 3ZVZB 2CKLB 2JRJA 2MD8C 4R7EA 2RR4A 2E6RA 2KYUA 3MHSA 5TDRA 2YQLA 4B7YC 2MA6A 2Y1MA 4I7BA 1V87A 3O34A 3JUEA 4A4CA 5B8DA 1WE9A 4WA6A 2LN0A 4QQ4A 2KWOA 2LXHC 3N9QA 2KWKA 1MM3A 4FO9A 1XWHA 4OGEA 1G25A 4GNEA 2KGIA 4YBMA 3DDTA 3FM8C 2YHNA 5TABA 1HYJA 2OWAA 5DKAA 3O36A 3FEHA 3O37A 2L0BA 2H0DB 2EXUA 2M13A 2F42A 2DSMA 1WEEA 1VYXA 4O62A 1VFYA 3L11A 2YSJA 3KDEC 1LDJB 4ZQLA 2ECJA 3H7HA 4GNDA 3O47A 2B0OE 2YW8A 5SVIA 3T6RA 4LJNA 3FANA 2LV9A 1WEPA 3DWDA 2RSDA 3LQJA 1JOCA 3KV5A 2EODA 2KGGA 3V43A 2ECNA 4R2YA 2FUUA 2OXQC 3M7KA 2LGGA 4B86C 2CT2A 2DJAA 5C11A 3N9MA 1Z6UA 3SHBA 2YREA 2F6NA 3EB5A 3PLWA 4AVXA 5FB1A 4LKAA 2MKEA 3NG2A 2D8UA 2MUMA 3ZNIA 1Z2QA 1F62A 2Y43A 3RTRB 4MVTA 4O64A 5FB0A 3O70A 5G04B 2VPDA 3O35A 2CRWA 3MHHA 3DPLR 2LGLA 1WESA 3RPGC 1LDKC 5KH3A 2MA5A 4R8PK 2L75A 2MNYA 3Q1DA 1WFKA 4YATA 2CSYA 4WZ0A 2HYED 4I7DA 3U5PA 5TRBA 2ECIA 5B78A 3DQVR 2VJEA 3LQIA 2CSVA 2L7PA 4TKPB 4I7CA 4AUQB 1DCQA 3EB6A 2P57A 2NAAA 4P5OB 3U5OA 2YVRA 1JM7A 2F6JA 2MD7B 2EGMA 2JMIA 2LGKA 5LKZA 2QICA 4PTBA 2VJFA 2XOZA 3SUBA 2JMJA 3L1ZB 5H1VA 1Z60A 5LKTA 2XOYA 4FJCA 3N9PA 1T1HA 4X3GA 2QJ0A 4L58A 1WEWA 3LVQE 3N9LA 2IDAA 3LRQA 3SOWA 3C6WA 2G45A 3PHDA 4FK5A 2QIZA 1WGMA 4S3OB 3T7LA 2PUYA 3ASLA 2E6SA 1WEMA 2CONA 2Y1NA 5AITA 1K2FA 3MDBC 2LQ6A 3PUQA 3M63A 2YQMA 5TBNA 3GL6A 5D1LB 4AYCA 1FP0A 2CKLA 2VPBA 2MT5A 2JM3A 4YADA 2KE1A 2KKXA 3O7AA 4GNGA 5JG6A 1FBVA 5D1KB 3U5NA 3U5MA 1X4UA 1E4UA 3KNVA 3HTKC 4BHWA 1IYMA 5B76A 3M62A 4LADB 5G05B 4H9DA 4WZ2A 2BAYA 3HCTA 1WENA 3KV6A 2HDPA 4UP5A 5TDWA 3PURA 1WIMA 3M99A 5SVXA 2D8SA 2VPEA 3LVRE 3I2DA 2YHOA 2H0DA 5SVYA 2KREA 2C2VS 4A4BA 2E61A 2M6MA 4ZUXU 2K4DA 3LQHA 4NN2A 4YAXA 1CHCA 2AN6A 2IQJA 4QF2A 2K16A 3ZTGA 4CA1A 4YBSA 2YT5A 2MNZA 2XEUA 5H1TA 2DX8A 2YUCA 4Z0OA 4YBTA 2M85A 1MM2A 4N3WA 1MBMA 2FD4A 2VNFA 3L1XA 4UI9B 4W4UA 4N4FA 2YSMA 5SVIB 3ZPV1 5KH9A 2EA6A 2LXPC 2CSZA 3N9NA 4YC9A 4LK9A 5G0FA 5LKUA 1WEQA 1X4JA 3QZVA 3HCSA 4LLBA 3SOUA 4ZDTA 2CRRA 2L43A 2UZGA 5B77A 5I3LA 2LAUA 4YABA 5DINA 5B75A 5D1MB 3O33A 4IC3A 3ZVYA 2KFTA 2KIZA 1VD4A 5LKXA 4L7XA 1WEVA 2KWJA 2L5UA 2M1RA 2PNXA 5K3QA 4Z0RA 2I50A 2KKYA 4PPEA 1WILA 3SOXA 2ECTA 3E2DA 2ECVA 2XB1A 3GV4A 4WZ3B 1WEUA 2C2LA
chains in the Genus database with same CATH topology
4UP0A 2LRIC 5H9MA 2LGVA 3C5KA 2RI7A 2L80A 4S3OC 4FIPA 2MIQA 2K17A 4AP4A 3IHPA 5C13A 2VJEB 4IC2A 2G6QA 4QF3A 2KWNA 3VK6A 2LDRA 1X4IA 5H1UA 1U6GB 1HYIA 5AIUA 2FSAA 2VPGA 3RPGB 4BBQA 3FL2A 1JM7B 4A0CD 2VP7A 4C9ZA 2G43A 3N9OA 2VJFB 5KH7A 4A49A 4MSXA 4CCGX 1N87A 5LCWB 2YU4A 2YURA 2ZETC 4V3LC 2ECGA 4F52B 4Q6FA 2JMDA 2KR4A 2FUIA 2KU3A 1DVPA 2YYRA 1BORA 4GB0A 4GNFA 4V3KC 2ECWA 5EYAF 3KQIA 5B79A 3HCUA 3ZPVE 2EGPA 5J3XA 5FEYA 4XI1A 2M3HA 5FERA 1ZBDB 2K1JA 1RMDA 3ZYQA 1WEOA 4AYCB 3ZVZB 2CKLB 2JRJA 2MD8C 4R7EA 2E6RA 2KYUA 3MHSA 5TDRA 2YQLA 4B7YC 2MA6A 2Y1MA 4I7BA 1V87A 3O34A 4A4CA 5B8DA 1WE9A 4WA6A 2LN0A 2KWOA 2LXHC 3N9QA 2KWKA 1MM3A 4FO9A 1XWHA 1G25A 4GNEA 2KGIA 4YBMA 2YHNA 5TABA 1HYJA 5DKAA 3O36A 3O37A 2L0BA 2H0DB 2F42A 1WEEA 1VYXA 1VFYA 3L11A 2YSJA 1LDJB 4ZQLA 2ECJA 4GNDA 2YW8A 3T6RA 4LJNA 2LV9A 1WEPA 2RSDA 3LQJA 1JOCA 3KV5A 2EODA 2KGGA 3V43A 2ECNA 4R2YA 2FUUA 2OXQC 2LGGA 4B86C 2CT2A 5C11A 3N9MA 1Z6UA 3SHBA 2YREA 2F6NA 3EB5A 4AVXA 5FB1A 4LKAA 3NG2A 2MUMA 3ZNIA 1Z2QA 1F62A 2Y43A 3RTRB 4MVTA 4O64A 5FB0A 3O70A 5G04B 2VPDA 3O35A 3DPLR 3MHHA 2LGLA 1WESA 3RPGC 1LDKC 5KH3A 2MA5A 4R8PK 2L75A 2MNYA 1WFKA 4YATA 2CSYA 4WZ0A 2HYED 4I7DA 3U5PA 5TRBA 2ECIA 5B78A 3DQVR 2VJEA 3LQIA 4TKPB 4I7CA 4AUQB 3EB6A 2NAAA 4P5OB 3U5OA 1JM7A 2F6JA 2MD7B 2JMIA 2LGKA 5LKZA 2QICA 4PTBA 2VJFA 2JMJA 3L1ZB 5H1VA 1Z60A 5LKTA 4FJCA 3N9PA 1T1HA 4X3GA 2QJ0A 4L58A 1WEWA 3N9LA 2IDAA 3LRQA 3SOWA 3C6WA 2G45A 3PHDA 4FK5A 2QIZA 1WGMA 4S3OB 3T7LA 2PUYA 3ASLA 2E6SA 1WEMA 2Y1NA 5AITA 1K2FA 2LQ6A 3PUQA 3M63A 2YQMA 5TBNA 3GL6A 5D1LB 4AYCA 1FP0A 2CKLA 2VPBA 2MT5A 4YADA 2KE1A 3O7AA 4GNGA 5JG6A 1FBVA 5D1KB 3U5NA 3U5MA 1X4UA 1E4UA 3KNVA 3HTKC 4BHWA 1IYMA 5B76A 5G05B 3M62A 4LADB 4WZ2A 2BAYA 3HCTA 1WENA 3KV6A 2HDPA 4UP5A 5TDWA 3PURA 1WIMA 3M99A 2D8SA 2VPEA 3I2DA 2YHOA 2H0DA 2KREA 2C2VS 4A4BA 4ZUXU 2M6MA 2K4DA 3LQHA 4NN2A 4YAXA 1CHCA 2AN6A 4QF2A 2K16A 3ZTGA 4CA1A 4YBSA 2YT5A 2MNZA 2XEUA 5H1TA 2DX8A 2YUCA 4YBTA 2M85A 1MM2A 4N3WA 3L1XA 2VNFA 4UI9B 4W4UA 4N4FA 2YSMA 3ZPV1 5KH9A 2EA6A 2LXPC 2CSZA 3N9NA 4YC9A 4LK9A 5G0FA 5LKUA 1WEQA 1X4JA 3QZVA 3HCSA 4LLBA 3SOUA 4ZDTA 2L43A 2UZGA 5B77A 5I3LA 4YABA 5DINA 5B75A 5D1MB 3O33A 4IC3A 3ZVYA 2KFTA 2KIZA 1VD4A 5LKXA 4L7XA 1WEVA 2KWJA 2L5UA 2M1RA 2PNXA 2I50A 4PPEA 1WILA 3SOXA 2ECTA 2ECVA 2XB1A 3GV4A 4WZ3B 1WEUA 2C2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP0 A;  2LRI C;  5H9M A;  2LGV A;  3C5K A;  2RI7 A;  2L80 A;  4S3O C;  4FIP A;  2MIQ A;  2K17 A;  4AP4 A;  3IHP A;  5C13 A;  2VJE B;  4IC2 A;  2G6Q A;  4QF3 A;  2KWN A;  3VK6 A;  2LDR A;  1X4I A;  5H1U A;  1U6G B;  1HYI A;  5AIU A;  2FSA A;  2VPG A;  3RPG B;  4BBQ A;  3FL2 A;  1JM7 B;  4A0C D;  2VP7 A;  4C9Z A;  2G43 A;  3N9O A;  2VJF B;  5KH7 A;  4A49 A;  4MSX A;  4CCG X;  1N87 A;  5LCW B;  2YU4 A;  2YUR A;  2ZET C;  4V3L C;  2ECG A;  4F52 B;  4Q6F A;  2JMD A;  2KR4 A;  2FUI A;  2KU3 A;  1DVP A;  2YYR A;  1BOR A;  4GB0 A;  4GNF A;  4V3K C;  2ECW A;  5EYA F;  3KQI A;  5B79 A;  3HCU A;  3ZPV E;  2EGP A;  5J3X A;  5FEY A;  4XI1 A;  2M3H A;  5FER A;  1ZBD B;  2K1J A;  1RMD A;  3ZYQ A;  1WEO A;  4AYC B;  3ZVZ B;  2CKL B;  2JRJ A;  2MD8 C;  4R7E A;  2E6R A;  2KYU A;  3MHS A;  5TDR A;  2YQL A;  4B7Y C;  2MA6 A;  2Y1M A;  4I7B A;  1V87 A;  3O34 A;  4A4C A;  5B8D A;  1WE9 A;  4WA6 A;  2LN0 A;  2KWO A;  2LXH C;  3N9Q A;  2KWK A;  1MM3 A;  4FO9 A;  1XWH A;  1G25 A;  4GNE A;  2KGI A;  4YBM A;  2YHN A;  5TAB A;  1HYJ A;  5DKA A;  3O36 A;  3O37 A;  2L0B A;  2H0D B;  2F42 A;  1WEE A;  1VYX A;  1VFY A;  3L11 A;  2YSJ A;  1LDJ B;  4ZQL A;  2ECJ A;  4GND A;  2YW8 A;  3T6R A;  4LJN A;  2LV9 A;  1WEP A;  2RSD A;  3LQJ A;  1JOC A;  3KV5 A;  2EOD A;  2KGG A;  3V43 A;  2ECN A;  4R2Y A;  2FUU A;  2OXQ C;  2LGG A;  4B86 C;  2CT2 A;  5C11 A;  3N9M A;  1Z6U A;  3SHB A;  2YRE A;  2F6N A;  3EB5 A;  4AVX A;  5FB1 A;  4LKA A;  3NG2 A;  2MUM A;  3ZNI A;  1Z2Q A;  1F62 A;  2Y43 A;  3RTR B;  4MVT A;  4O64 A;  5FB0 A;  3O70 A;  5G04 B;  2VPD A;  3O35 A;  3DPL R;  3MHH A;  2LGL A;  1WES A;  3RPG C;  1LDK C;  5KH3 A;  2MA5 A;  4R8P K;  2L75 A;  2MNY A;  1WFK A;  4YAT A;  2CSY A;  4WZ0 A;  2HYE D;  4I7D A;  3U5P A;  5TRB A;  2ECI A;  5B78 A;  3DQV R;  2VJE A;  3LQI A;  4TKP B;  4I7C A;  4AUQ B;  3EB6 A;  2NAA A;  4P5O B;  3U5O A;  1JM7 A;  2F6J A;  2MD7 B;  2JMI A;  2LGK A;  5LKZ A;  2QIC A;  4PTB A;  2VJF A;  2JMJ A;  3L1Z B;  5H1V A;  1Z60 A;  5LKT A;  4FJC A;  3N9P A;  1T1H A;  4X3G A;  2QJ0 A;  4L58 A;  1WEW A;  3N9L A;  2IDA A;  3LRQ A;  3SOW A;  3C6W A;  2G45 A;  3PHD A;  4FK5 A;  2QIZ A;  1WGM A;  4S3O B;  3T7L A;  2PUY A;  3ASL A;  2E6S A;  1WEM A;  2Y1N A;  5AIT A;  1K2F A;  2LQ6 A;  3PUQ A;  3M63 A;  2YQM A;  5TBN A;  3GL6 A;  5D1L B;  4AYC A;  1FP0 A;  2CKL A;  2VPB A;  2MT5 A;  4YAD A;  2KE1 A;  3O7A A;  4GNG A;  5JG6 A;  1FBV A;  5D1K B;  3U5N A;  3U5M A;  1X4U A;  1E4U A;  3KNV A;  3HTK C;  4BHW A;  1IYM A;  5B76 A;  5G05 B;  3M62 A;  4LAD B;  4WZ2 A;  2BAY A;  3HCT A;  1WEN A;  3KV6 A;  2HDP A;  4UP5 A;  5TDW A;  3PUR A;  1WIM A;  3M99 A;  2D8S A;  2VPE A;  3I2D A;  2YHO A;  2H0D A;  2KRE A;  2C2V S;  4A4B A;  4ZUX U;  2M6M A;  2K4D A;  3LQH A;  4NN2 A;  4YAX A;  1CHC A;  2AN6 A;  4QF2 A;  2K16 A;  3ZTG A;  4CA1 A;  4YBS A;  2YT5 A;  2MNZ A;  2XEU A;  5H1T A;  2DX8 A;  2YUC A;  4YBT A;  2M85 A;  1MM2 A;  4N3W A;  3L1X A;  2VNF A;  4UI9 B;  4W4U A;  4N4F A;  2YSM A;  3ZPV 1;  5KH9 A;  2EA6 A;  2LXP C;  2CSZ A;  3N9N A;  4YC9 A;  4LK9 A;  5G0F A;  5LKU A;  1WEQ A;  1X4J A;  3QZV A;  3HCS A;  4LLB A;  3SOU A;  4ZDT A;  2L43 A;  2UZG A;  5B77 A;  5I3L A;  4YAB A;  5DIN A;  5B75 A;  5D1M B;  3O33 A;  4IC3 A;  3ZVY A;  2KFT A;  2KIZ A;  1VD4 A;  5LKX A;  4L7X A;  1WEV A;  2KWJ A;  2L5U A;  2M1R A;  2PNX A;  2I50 A;  4PPE A;  1WIL A;  3SOX A;  2ECT A;  2ECV A;  2XB1 A;  3GV4 A;  4WZ3 B;  1WEU A;  2C2L A; 
#chains in the Genus database with same CATH topology
 3T9K A;  2FFW A;  4UP0 A;  2LRI C;  5H9M A;  2LGV A;  3C5K A;  2RI7 A;  2L80 A;  4S3O C;  4FIP A;  3LDY A;  2MIQ A;  2K17 A;  2XP0 A;  4AP4 A;  3IHP A;  5C13 A;  4QF3 A;  2VJE B;  2G6Q A;  4IC2 A;  2KWN A;  3VK6 A;  2LDR A;  1X4I A;  5H1U A;  1U6G B;  3FAO A;  1HYI A;  5AIU A;  2FSA A;  2VPG A;  3RPG B;  4BBQ A;  3FL2 A;  1JM7 B;  4A0C D;  3LJU X;  4F1P A;  3FJU B;  2VP7 A;  4C9Z A;  2G43 A;  3N9O A;  2VJF B;  5KH7 A;  4A49 A;  4MSX A;  4CCG X;  1N87 A;  5LCW B;  2YU4 A;  2YUR A;  2ZET C;  4V3L C;  2ECG A;  4F52 B;  4Q6F A;  2JMD A;  2KR4 A;  2FUI A;  4OGC A;  2KU3 A;  2XOC A;  1DVP A;  2YYR A;  1BOR A;  4GB0 A;  4GNF A;  4V3K C;  2ECW A;  5EYA F;  3KQI A;  5B79 A;  3HCU A;  3ZPV E;  2EGP A;  5J3X A;  5FEY A;  4XI1 A;  2M3H A;  5FER A;  1ZBD B;  2K1J A;  1RMD A;  3ZYQ A;  1WEO A;  2JUN A;  4AYC B;  3ZVZ B;  2CKL B;  2JRJ A;  2MD8 C;  4R7E A;  2RR4 A;  2E6R A;  2KYU A;  3MHS A;  5TDR A;  2YQL A;  4B7Y C;  2MA6 A;  2Y1M A;  4I7B A;  1V87 A;  3O34 A;  3JUE A;  4A4C A;  5B8D A;  1WE9 A;  4WA6 A;  2LN0 A;  4QQ4 A;  2KWO A;  2LXH C;  3N9Q A;  2KWK A;  1MM3 A;  4FO9 A;  1XWH A;  4OGE A;  1G25 A;  4GNE A;  2KGI A;  4YBM A;  3DDT A;  3FM8 C;  2YHN A;  5TAB A;  1HYJ A;  2OWA A;  5DKA A;  3O36 A;  3FEH A;  3O37 A;  2L0B A;  2H0D B;  2EXU A;  2M13 A;  2F42 A;  2DSM A;  1WEE A;  1VYX A;  4O62 A;  1VFY A;  3L11 A;  2YSJ A;  3KDE C;  1LDJ B;  4ZQL A;  2ECJ A;  3H7H A;  4GND A;  3O47 A;  2B0O E;  2YW8 A;  5SVI A;  3T6R A;  4LJN A;  3FAN A;  2LV9 A;  1WEP A;  3DWD A;  2RSD A;  3LQJ A;  1JOC A;  3KV5 A;  2EOD A;  2KGG A;  3V43 A;  2ECN A;  4R2Y A;  2FUU A;  2OXQ C;  3M7K A;  2LGG A;  4B86 C;  2CT2 A;  2DJA A;  5C11 A;  3N9M A;  1Z6U A;  3SHB A;  2YRE A;  2F6N A;  3EB5 A;  3PLW A;  4AVX A;  5FB1 A;  4LKA A;  2MKE A;  3NG2 A;  2D8U A;  2MUM A;  3ZNI A;  1Z2Q A;  1F62 A;  2Y43 A;  3RTR B;  4MVT A;  4O64 A;  5FB0 A;  3O70 A;  5G04 B;  2VPD A;  3O35 A;  2CRW A;  3MHH A;  3DPL R;  2LGL A;  1WES A;  3RPG C;  1LDK C;  5KH3 A;  2MA5 A;  4R8P K;  2L75 A;  2MNY A;  3Q1D A;  1WFK A;  4YAT A;  2CSY A;  4WZ0 A;  2HYE D;  4I7D A;  3U5P A;  5TRB A;  2ECI A;  5B78 A;  3DQV R;  2VJE A;  3LQI A;  2CSV A;  2L7P A;  4TKP B;  4I7C A;  4AUQ B;  1DCQ A;  3EB6 A;  2P57 A;  2NAA A;  4P5O B;  3U5O A;  2YVR A;  1JM7 A;  2F6J A;  2MD7 B;  2EGM A;  2JMI A;  2LGK A;  5LKZ A;  2QIC A;  4PTB A;  2VJF A;  2XOZ A;  3SUB A;  2JMJ A;  3L1Z B;  5H1V A;  1Z60 A;  5LKT A;  2XOY A;  4FJC A;  3N9P A;  1T1H A;  4X3G A;  2QJ0 A;  4L58 A;  1WEW A;  3LVQ E;  3N9L A;  2IDA A;  3LRQ A;  3SOW A;  3C6W A;  2G45 A;  3PHD A;  4FK5 A;  2QIZ A;  1WGM A;  4S3O B;  3T7L A;  2PUY A;  3ASL A;  2E6S A;  1WEM A;  2CON A;  2Y1N A;  5AIT A;  1K2F A;  3MDB C;  2LQ6 A;  3PUQ A;  3M63 A;  2YQM A;  5TBN A;  3GL6 A;  5D1L B;  4AYC A;  1FP0 A;  2CKL A;  2VPB A;  2MT5 A;  2JM3 A;  4YAD A;  2KE1 A;  2KKX A;  3O7A A;  4GNG A;  5JG6 A;  1FBV A;  5D1K B;  3U5N A;  3U5M A;  1X4U A;  1E4U A;  3KNV A;  3HTK C;  4BHW A;  1IYM A;  5B76 A;  3M62 A;  4LAD B;  5G05 B;  4H9D A;  4WZ2 A;  2BAY A;  3HCT A;  1WEN A;  3KV6 A;  2HDP A;  4UP5 A;  5TDW A;  3PUR A;  1WIM A;  3M99 A;  5SVX A;  2D8S A;  2VPE A;  3LVR E;  3I2D A;  2YHO A;  2H0D A;  5SVY A;  2KRE A;  2C2V S;  4A4B A;  2E61 A;  2M6M A;  4ZUX U;  2K4D A;  3LQH A;  4NN2 A;  4YAX A;  1CHC A;  2AN6 A;  2IQJ A;  4QF2 A;  2K16 A;  3ZTG A;  4CA1 A;  4YBS A;  2YT5 A;  2MNZ A;  2XEU A;  5H1T A;  2DX8 A;  2YUC A;  4Z0O A;  4YBT A;  2M85 A;  1MM2 A;  4N3W A;  1MBM A;  2FD4 A;  2VNF A;  3L1X A;  4UI9 B;  4W4U A;  4N4F A;  2YSM A;  5SVI B;  3ZPV 1;  5KH9 A;  2EA6 A;  2LXP C;  2CSZ A;  3N9N A;  4YC9 A;  4LK9 A;  5G0F A;  5LKU A;  1WEQ A;  1X4J A;  3QZV A;  3HCS A;  4LLB A;  3SOU A;  4ZDT A;  2CRR A;  2L43 A;  2UZG A;  5B77 A;  5I3L A;  2LAU A;  4YAB A;  5DIN A;  5B75 A;  5D1M B;  3O33 A;  4IC3 A;  3ZVY A;  2KFT A;  2KIZ A;  1VD4 A;  5LKX A;  4L7X A;  1WEV A;  2KWJ A;  2L5U A;  2M1R A;  2PNX A;  5K3Q A;  4Z0R A;  2I50 A;  2KKY A;  4PPE A;  1WIL A;  3SOX A;  2ECT A;  3E2D A;  2ECV A;  2XB1 A;  3GV4 A;  4WZ3 B;  1WEU A;  2C2L A; 
#chains in the Genus database with same CATH homology
 4UP0 A;  2LRI C;  5H9M A;  2LGV A;  3C5K A;  2RI7 A;  2L80 A;  4S3O C;  4FIP A;  2MIQ A;  2K17 A;  4AP4 A;  3IHP A;  5C13 A;  2VJE B;  4IC2 A;  2G6Q A;  4QF3 A;  2KWN A;  3VK6 A;  2LDR A;  1X4I A;  5H1U A;  1U6G B;  1HYI A;  5AIU A;  2FSA A;  2VPG A;  3RPG B;  4BBQ A;  3FL2 A;  1JM7 B;  4A0C D;  2VP7 A;  4C9Z A;  2G43 A;  3N9O A;  2VJF B;  5KH7 A;  4A49 A;  4MSX A;  4CCG X;  1N87 A;  5LCW B;  2YU4 A;  2YUR A;  2ZET C;  4V3L C;  2ECG A;  4F52 B;  4Q6F A;  2JMD A;  2KR4 A;  2FUI A;  2KU3 A;  1DVP A;  2YYR A;  1BOR A;  4GB0 A;  4GNF A;  4V3K C;  2ECW A;  5EYA F;  3KQI A;  5B79 A;  3HCU A;  3ZPV E;  2EGP A;  5J3X A;  5FEY A;  4XI1 A;  2M3H A;  5FER A;  1ZBD B;  2K1J A;  1RMD A;  3ZYQ A;  1WEO A;  4AYC B;  3ZVZ B;  2CKL B;  2JRJ A;  2MD8 C;  4R7E A;  2E6R A;  2KYU A;  3MHS A;  5TDR A;  2YQL A;  4B7Y C;  2MA6 A;  2Y1M A;  4I7B A;  1V87 A;  3O34 A;  4A4C A;  5B8D A;  1WE9 A;  4WA6 A;  2LN0 A;  2KWO A;  2LXH C;  3N9Q A;  2KWK A;  1MM3 A;  4FO9 A;  1XWH A;  1G25 A;  4GNE A;  2KGI A;  4YBM A;  2YHN A;  5TAB A;  1HYJ A;  5DKA A;  3O36 A;  3O37 A;  2L0B A;  2H0D B;  2F42 A;  1WEE A;  1VYX A;  1VFY A;  3L11 A;  2YSJ A;  1LDJ B;  4ZQL A;  2ECJ A;  4GND A;  2YW8 A;  3T6R A;  4LJN A;  2LV9 A;  1WEP A;  2RSD A;  3LQJ A;  1JOC A;  3KV5 A;  2EOD A;  2KGG A;  3V43 A;  2ECN A;  4R2Y A;  2FUU A;  2OXQ C;  2LGG A;  4B86 C;  2CT2 A;  5C11 A;  3N9M A;  1Z6U A;  3SHB A;  2YRE A;  2F6N A;  3EB5 A;  4AVX A;  5FB1 A;  4LKA A;  3NG2 A;  2MUM A;  3ZNI A;  1Z2Q A;  1F62 A;  2Y43 A;  3RTR B;  4MVT A;  4O64 A;  5FB0 A;  3O70 A;  5G04 B;  2VPD A;  3O35 A;  3DPL R;  3MHH A;  2LGL A;  1WES A;  3RPG C;  1LDK C;  5KH3 A;  2MA5 A;  4R8P K;  2L75 A;  2MNY A;  1WFK A;  4YAT A;  2CSY A;  4WZ0 A;  2HYE D;  4I7D A;  3U5P A;  5TRB A;  2ECI A;  5B78 A;  3DQV R;  2VJE A;  3LQI A;  4TKP B;  4I7C A;  4AUQ B;  3EB6 A;  2NAA A;  4P5O B;  3U5O A;  1JM7 A;  2F6J A;  2MD7 B;  2JMI A;  2LGK A;  5LKZ A;  2QIC A;  4PTB A;  2VJF A;  2JMJ A;  3L1Z B;  5H1V A;  1Z60 A;  5LKT A;  4FJC A;  3N9P A;  1T1H A;  4X3G A;  2QJ0 A;  4L58 A;  1WEW A;  3N9L A;  2IDA A;  3LRQ A;  3SOW A;  3C6W A;  2G45 A;  3PHD A;  4FK5 A;  2QIZ A;  1WGM A;  4S3O B;  3T7L A;  2PUY A;  3ASL A;  2E6S A;  1WEM A;  2Y1N A;  5AIT A;  1K2F A;  2LQ6 A;  3PUQ A;  3M63 A;  2YQM A;  5TBN A;  3GL6 A;  5D1L B;  4AYC A;  1FP0 A;  2CKL A;  2VPB A;  2MT5 A;  4YAD A;  2KE1 A;  3O7A A;  4GNG A;  5JG6 A;  1FBV A;  5D1K B;  3U5N A;  3U5M A;  1X4U A;  1E4U A;  3KNV A;  3HTK C;  4BHW A;  1IYM A;  5B76 A;  5G05 B;  3M62 A;  4LAD B;  4WZ2 A;  2BAY A;  3HCT A;  1WEN A;  3KV6 A;  2HDP A;  4UP5 A;  5TDW A;  3PUR A;  1WIM A;  3M99 A;  2D8S A;  2VPE A;  3I2D A;  2YHO A;  2H0D A;  2KRE A;  2C2V S;  4A4B A;  4ZUX U;  2M6M A;  2K4D A;  3LQH A;  4NN2 A;  4YAX A;  1CHC A;  2AN6 A;  4QF2 A;  2K16 A;  3ZTG A;  4CA1 A;  4YBS A;  2YT5 A;  2MNZ A;  2XEU A;  5H1T A;  2DX8 A;  2YUC A;  4YBT A;  2M85 A;  1MM2 A;  4N3W A;  3L1X A;  2VNF A;  4UI9 B;  4W4U A;  4N4F A;  2YSM A;  3ZPV 1;  5KH9 A;  2EA6 A;  2LXP C;  2CSZ A;  3N9N A;  4YC9 A;  4LK9 A;  5G0F A;  5LKU A;  1WEQ A;  1X4J A;  3QZV A;  3HCS A;  4LLB A;  3SOU A;  4ZDT A;  2L43 A;  2UZG A;  5B77 A;  5I3L A;  4YAB A;  5DIN A;  5B75 A;  5D1M B;  3O33 A;  4IC3 A;  3ZVY A;  2KFT A;  2KIZ A;  1VD4 A;  5LKX A;  4L7X A;  1WEV A;  2KWJ A;  2L5U A;  2M1R A;  2PNX A;  2I50 A;  4PPE A;  1WIL A;  3SOX A;  2ECT A;  2ECV A;  2XB1 A;  3GV4 A;  4WZ3 B;  1WEU A;  2C2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...