4UP5A

Crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a chemical fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
85
Chain Sequence
GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up5A00
3SOXA 3MHSA 1U6GB 2VP7A 2LXPC 3VK6A 2L5UA 1JM7A 2YREA 3N9OA 2Y43A 2NAAA 2LV9A 2L43A 2M1RA 3U5PA 5B79A 5I3LA 3ASLA 2ECTA 4AUQB 1RMDA 1JOCA 2M6MA 5H9MA 5KH3A 1WESA 1CHCA 4P5OB 1IYMA 2KGIA 3V43A 4ZDTA 5TBNA 2PNXA 3ZYQA 1Z60A 1FBVA 5KH9A 5LCWB 1WEVA 3T6RA 5JG6A 2ECIA 3ZVZB 4PTBA 2LGGA 2ECJA 5AIUA 2CKLA 2KWNA 2LXHC 5H1UA 2YW8A 4C9ZA 3HCTA 3KV5A 3EB5A 5G05B 2MIQA 4I7BA 1JM7B 4WZ0A 4AP4A 4TKPB 5B77A 3L1ZB 1WE9A 4I7CA 3N9NA 2YSJA 2VJEA 3SOUA 4I7DA 3M99A 5D1KB 2PUYA 2LGLA 1LDKC 3HTKC 1ZBDB 3GL6A 4A0CD 5B75A 5J3XA 4AYCA 4IC3A 4YAXA 4FIPA 2VPGA 3RTRB 4PPEA 3O37A 2VPEA 3DPLR 1WENA 2ECVA 5AITA 3N9PA 2F6NA 2MT5A 2M3HA 2KWJA 2C2VS 2XEUA 3IHPA 3M62A 2FUIA 3L11A 5C11A 5D1MB 4YBMA 4V3LC 1WGMA 4GB0A 1G25A 2H0DB 1WEPA 2ECWA 4N4FA 5FB1A 5LKTA 3N9QA 3O70A 4ZUXU 5EYAF 4YBSA 1HYJA 5TRBA 2MNZA 2YU4A 5LKZA 2K1JA 2C2LA 3PUQA 2QICA 2VJFA 3QZVA 4LADB 4O64A 1FP0A 4R8PK 4GNDA 3GV4A 4FO9A 2LQ6A 2ECGA 1K2FA 2LN0A 1V87A 5FEYA 2L80A 2YQLA 3I2DA 2BAYA 2K16A 3O36A 1XWHA 1LDJB 2YHOA 1WFKA 2XB1A 2FSAA 2MD8C 1MM3A 2YHNA 2F42A 2JMJA 1HYIA 2KU3A 5LKUA 2QJ0A 2E6RA 3PHDA 1Z2QA 2E6SA 3SHBA 2KREA 1VD4A 4L7XA 3PURA 2FUUA 2JRJA 5TABA 4UI9B 3T7LA 4F52B 2G43A 2JMIA 4LK9A 4W4UA 4N3WA 2L75A 2QIZA 1F62A 5DKAA 2VPBA 4FJCA 5B8DA 2KYUA 3SOWA 4BBQA 1BORA 1WIMA 1WEUA 2JMDA 3ZVYA 1WEMA 2RSDA 2CKLB 2KR4A 4L58A 2M85A 2CSZA 2EODA 3HCUA 2VPDA 1WILA 3RPGB 3ZTGA 4V3KC 2KFTA 3U5MA 3O33A 3NG2A 5TDWA 4B86C 3LQJA 2Y1NA 2CSYA 5FERA 2G45A 2K17A 2EGPA 2CT2A 2KWKA 3U5NA 2YSMA 5DINA 4CCGX 5C13A 2YUCA 3C5KA 2VJEB 4B7YC 2LDRA 1DVPA 2AN6A 1VFYA 4YADA 4S3OB 4CA1A 4X3GA 5H1VA 4AYCB 2MNYA 4Q6FA 4MVTA 3U5OA 3O35A 2MA6A 4FK5A 2LGKA 2YT5A 3ZPVE 1Z6UA 2G6QA 4A49A 2HYED 2VNFA 2EA6A 2ECNA 3MHHA 2YQMA 3ZNIA 4R2YA 5B78A 4MSXA 5B76A 4GNEA 1WEEA 3KNVA 5D1LB 4R7EA 3RPGC 5FB0A 4UP5A 2KIZA 5TDRA 2DX8A 4BHWA 1N87A 5H1TA 3M63A 2KWOA 2MA5A 5G04B 4QF3A 5G0FA 1WEWA 4WZ2A 2H0DA 2LRIC 3HCSA 4YATA 4LLBA 4YC9A 1X4JA 1WEQA 3C6WA 4A4BA 1X4IA 2ZETC 4LJNA 4A4CA 4YABA 3N9MA 3LRQA 4GNFA 2VJFB 4S3OC 2KE1A 3LQIA 4YBTA 2YURA 2I50A 3LQHA 2MUMA 4XI1A 4IC2A 2L0BA 3KQIA 2KGGA 4UP0A 2D8SA 3O34A 3L1XA 4NN2A 2F6JA 3N9LA 2MD7B 5KH7A 4LKAA 2RI7A 3DQVR 3KV6A 2OXQC 3ZPV1 2K4DA 1MM2A 2Y1MA 3EB6A 1T1HA 2YYRA 3O7AA 2UZGA 4WZ3B 1VYXA 4GNGA 4AVXA 4WA6A 1E4UA 3FL2A 5LKXA 2IDAA 4ZQLA 1X4UA 2LGVA 2HDPA 1WEOA 4QF2A
chains in the Genus database with same CATH superfamily
3SOXA 3MHSA 1U6GB 2VP7A 2LXPC 3VK6A 2L5UA 1JM7A 2CRRA 2YREA 3N9OA 2Y43A 2NAAA 2LV9A 2L43A 2M1RA 3U5PA 2CONA 5B79A 5I3LA 3ASLA 2ECTA 4AUQB 1RMDA 1JOCA 2M6MA 5H9MA 5KH3A 1WESA 1CHCA 2FD4A 4P5OB 1IYMA 2KGIA 3V43A 1MBMA 4OGEA 4ZDTA 5TBNA 2PNXA 3ZYQA 1Z60A 1FBVA 5KH9A 5LCWB 1WEVA 3T6RA 5JG6A 2ECIA 3ZVZB 4PTBA 2LGGA 2JUNA 2ECJA 5AIUA 2CKLA 2KWNA 2LXHC 5H1UA 2YW8A 3E2DA 4QQ4A 4C9ZA 3HCTA 3KV5A 3DWDA 3EB5A 5G05B 2MIQA 4I7BA 1JM7B 4WZ0A 4AP4A 2MKEA 4TKPB 5B77A 3L1ZB 1WE9A 4I7CA 3N9NA 4H9DA 2YSJA 4F1PA 2VJEA 2LAUA 3SOUA 4I7DA 3M99A 5D1KB 3LVQE 3KDEC 2PUYA 2LGLA 1LDKC 3HTKC 1ZBDB 3GL6A 3FM8C 4A0CD 5B75A 5J3XA 4AYCA 4IC3A 4YAXA 4FIPA 2VPGA 3RTRB 4PPEA 3O37A 2VPEA 3DPLR 1WENA 2ECVA 3DDTA 5AITA 3N9PA 2F6NA 2MT5A 2M3HA 2KWJA 2C2VS 2XEUA 3IHPA 3M62A 2FUIA 3L11A 5C11A 5D1MB 4YBMA 4V3LC 1WGMA 4GB0A 1G25A 2H0DB 1WEPA 2ECWA 4N4FA 5FB1A 5LKTA 1DCQA 3N9QA 3O70A 4ZUXU 4OGCA 5EYAF 5SVXA 4YBSA 2XOZA 1HYJA 5TRBA 4Z0OA 2MNZA 2YU4A 5LKZA 3FEHA 2K1JA 2C2LA 3PUQA 2QICA 2VJFA 3QZVA 2KKYA 2M13A 4LADB 4O64A 1FP0A 3M7KA 4R8PK 4GNDA 3GV4A 4FO9A 5SVYA 2LQ6A 2ECGA 3FJUB 1K2FA 2LN0A 1V87A 2B0OE 5SVIB 5FEYA 2L80A 2YQLA 3I2DA 2BAYA 2K16A 2JM3A 3O36A 1XWHA 2E61A 1LDJB 2YHOA 1WFKA 2RR4A 2FSAA 2XB1A 2MD8C 1MM3A 2YHNA 2F42A 2JMJA 3H7HA 2KU3A 5LKUA 1HYIA 2XP0A 2QJ0A 2E6RA 3PHDA 1Z2QA 2E6SA 3SHBA 2KREA 3LDYA 1VD4A 4L7XA 3PURA 2FUUA 2JRJA 5TABA 3T9KA 2IQJA 4UI9B 3T7LA 3LVRE 4F52B 2G43A 2JMIA 4LK9A 4W4UA 4N3WA 2L75A 2QIZA 1F62A 5DKAA 2VPBA 4FJCA 5B8DA 2KYUA 3JUEA 3FANA 3SOWA 4BBQA 1BORA 1WIMA 1WEUA 2JMDA 3ZVYA 1WEMA 2RSDA 2CKLB 2CRWA 2KR4A 4L58A 2M85A 2EODA 2CSZA 2EXUA 3HCUA 2VPDA 1WILA 3Q1DA 3RPGB 3ZTGA 4V3KC 2KFTA 3U5MA 3O33A 3NG2A 5TDWA 4B86C 3LQJA 2Y1NA 2CSYA 5FERA 2G45A 2K17A 2EGPA 2CT2A 2KWKA 3U5NA 2DJAA 2DSMA 2YSMA 5DINA 4CCGX 5C13A 2YUCA 3C5KA 2VJEB 4B7YC 2LDRA 1DVPA 2AN6A 1VFYA 4YADA 4S3OB 3PLWA 4CA1A 4X3GA 5H1VA 4AYCB 2MNYA 3LJUX 4Q6FA 4MVTA 3U5OA 3O35A 2MA6A 4FK5A 2LGKA 2YT5A 3ZPVE 1Z6UA 2G6QA 4A49A 2HYED 2VNFA 2EA6A 2ECNA 3MHHA 2YQMA 3ZNIA 4R2YA 5B78A 4MSXA 5B76A 4GNEA 1WEEA 3KNVA 5D1LB 4R7EA 3RPGC 5FB0A 4UP5A 2KIZA 5TDRA 2DX8A 2D8UA 4BHWA 3SUBA 1N87A 5H1TA 3M63A 2L7PA 2CSVA 2KWOA 2MA5A 5G04B 4QF3A 5G0FA 1WEWA 4WZ2A 2FFWA 2H0DA 2LRIC 3HCSA 4YATA 4LLBA 4YC9A 1X4JA 1WEQA 3C6WA 4A4BA 1X4IA 2ZETC 4LJNA 4A4CA 4YABA 3N9MA 3LRQA 4GNFA 2VJFB 4S3OC 2KE1A 3LQIA 4YBTA 2YURA 2I50A 3LQHA 2MUMA 4XI1A 2EGMA 2XOYA 3MDBC 4IC2A 2L0BA 3KQIA 2KGGA 4UP0A 4Z0RA 2D8SA 3O34A 3L1XA 4NN2A 2F6JA 3N9LA 2MD7B 2KKXA 5KH7A 4LKAA 2RI7A 3DQVR 3KV6A 5K3QA 2OXQC 3ZPV1 2K4DA 1MM2A 3FAOA 2Y1MA 3EB6A 1T1HA 2YYRA 2YVRA 2UZGA 3O7AA 2P57A 4WZ3B 1VYXA 4GNGA 4AVXA 4WA6A 3O47A 1E4UA 3FL2A 5SVIA 5LKXA 2IDAA 2XOCA 4ZQLA 1X4UA 2LGVA 2HDPA 2OWAA 4O62A 1WEOA 4QF2A
chains in the Genus database with same CATH topology
3SOXA 3MHSA 1U6GB 2VP7A 2LXPC 3VK6A 2L5UA 1JM7A 2YREA 3N9OA 2Y43A 2NAAA 2LV9A 2L43A 2M1RA 3U5PA 5B79A 5I3LA 3ASLA 2ECTA 4AUQB 1RMDA 1JOCA 2M6MA 5H9MA 5KH3A 1WESA 1CHCA 4P5OB 1IYMA 2KGIA 3V43A 4ZDTA 5TBNA 2PNXA 3ZYQA 1Z60A 1FBVA 5KH9A 5LCWB 1WEVA 3T6RA 5JG6A 2ECIA 3ZVZB 4PTBA 2LGGA 2ECJA 5AIUA 2CKLA 2KWNA 2LXHC 5H1UA 2YW8A 4C9ZA 3HCTA 3KV5A 3EB5A 5G05B 2MIQA 4I7BA 1JM7B 4WZ0A 4AP4A 4TKPB 5B77A 3L1ZB 1WE9A 4I7CA 3N9NA 2YSJA 2VJEA 3SOUA 4I7DA 3M99A 5D1KB 2PUYA 2LGLA 1LDKC 3HTKC 1ZBDB 3GL6A 4A0CD 5B75A 5J3XA 4AYCA 4IC3A 4YAXA 4FIPA 2VPGA 3RTRB 4PPEA 3O37A 2VPEA 3DPLR 1WENA 2ECVA 5AITA 3N9PA 2F6NA 2MT5A 2M3HA 2KWJA 2C2VS 2XEUA 3IHPA 3M62A 2FUIA 3L11A 5C11A 5D1MB 4YBMA 4V3LC 1WGMA 4GB0A 1G25A 2H0DB 1WEPA 2ECWA 4N4FA 5FB1A 5LKTA 3N9QA 3O70A 4ZUXU 5EYAF 4YBSA 1HYJA 5TRBA 2MNZA 2YU4A 5LKZA 2K1JA 2C2LA 3PUQA 2QICA 2VJFA 3QZVA 4LADB 4O64A 1FP0A 4R8PK 4GNDA 3GV4A 4FO9A 2LQ6A 2ECGA 1K2FA 2LN0A 1V87A 5FEYA 2L80A 2YQLA 3I2DA 2BAYA 2K16A 3O36A 1XWHA 1LDJB 2YHOA 1WFKA 2XB1A 2FSAA 2MD8C 1MM3A 2YHNA 2F42A 2JMJA 1HYIA 2KU3A 5LKUA 2QJ0A 2E6RA 3PHDA 1Z2QA 2E6SA 3SHBA 2KREA 1VD4A 4L7XA 3PURA 2FUUA 2JRJA 5TABA 4UI9B 3T7LA 4F52B 2G43A 2JMIA 4LK9A 4W4UA 4N3WA 2L75A 2QIZA 1F62A 5DKAA 2VPBA 4FJCA 5B8DA 2KYUA 3SOWA 4BBQA 1BORA 1WIMA 1WEUA 2JMDA 3ZVYA 1WEMA 2RSDA 2CKLB 2KR4A 4L58A 2M85A 2CSZA 2EODA 3HCUA 2VPDA 1WILA 3RPGB 3ZTGA 4V3KC 2KFTA 3U5MA 3O33A 3NG2A 5TDWA 4B86C 3LQJA 2Y1NA 2CSYA 5FERA 2G45A 2K17A 2EGPA 2CT2A 2KWKA 3U5NA 2YSMA 5DINA 4CCGX 5C13A 2YUCA 3C5KA 2VJEB 4B7YC 2LDRA 1DVPA 2AN6A 1VFYA 4YADA 4S3OB 4CA1A 4X3GA 5H1VA 4AYCB 2MNYA 4Q6FA 4MVTA 3U5OA 3O35A 2MA6A 4FK5A 2LGKA 2YT5A 3ZPVE 1Z6UA 2G6QA 4A49A 2HYED 2VNFA 2EA6A 2ECNA 3MHHA 2YQMA 3ZNIA 4R2YA 5B78A 4MSXA 5B76A 4GNEA 1WEEA 3KNVA 5D1LB 4R7EA 3RPGC 5FB0A 4UP5A 2KIZA 5TDRA 2DX8A 4BHWA 1N87A 5H1TA 3M63A 2KWOA 2MA5A 5G04B 4QF3A 5G0FA 1WEWA 4WZ2A 2H0DA 2LRIC 3HCSA 4YATA 4LLBA 4YC9A 1X4JA 1WEQA 3C6WA 4A4BA 1X4IA 2ZETC 4LJNA 4A4CA 4YABA 3N9MA 3LRQA 4GNFA 2VJFB 4S3OC 2KE1A 3LQIA 4YBTA 2YURA 2I50A 3LQHA 2MUMA 4XI1A 4IC2A 2L0BA 3KQIA 2KGGA 4UP0A 2D8SA 3O34A 3L1XA 4NN2A 2F6JA 3N9LA 2MD7B 5KH7A 4LKAA 2RI7A 3DQVR 3KV6A 2OXQC 3ZPV1 2K4DA 1MM2A 2Y1MA 3EB6A 1T1HA 2YYRA 3O7AA 2UZGA 4WZ3B 1VYXA 4GNGA 4AVXA 4WA6A 1E4UA 3FL2A 5LKXA 2IDAA 4ZQLA 1X4UA 2LGVA 2HDPA 1WEOA 4QF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOX A;  3MHS A;  1U6G B;  2VP7 A;  2LXP C;  3VK6 A;  2L5U A;  1JM7 A;  2YRE A;  3N9O A;  2Y43 A;  2NAA A;  2LV9 A;  2L43 A;  2M1R A;  3U5P A;  5B79 A;  5I3L A;  3ASL A;  2ECT A;  4AUQ B;  1RMD A;  1JOC A;  2M6M A;  5H9M A;  5KH3 A;  1WES A;  1CHC A;  4P5O B;  1IYM A;  2KGI A;  3V43 A;  4ZDT A;  5TBN A;  2PNX A;  3ZYQ A;  1Z60 A;  1FBV A;  5KH9 A;  5LCW B;  1WEV A;  3T6R A;  5JG6 A;  2ECI A;  3ZVZ B;  4PTB A;  2LGG A;  2ECJ A;  5AIU A;  2CKL A;  2KWN A;  2LXH C;  5H1U A;  2YW8 A;  4C9Z A;  3HCT A;  3KV5 A;  3EB5 A;  5G05 B;  2MIQ A;  4I7B A;  1JM7 B;  4WZ0 A;  4AP4 A;  4TKP B;  5B77 A;  3L1Z B;  1WE9 A;  4I7C A;  3N9N A;  2YSJ A;  2VJE A;  3SOU A;  4I7D A;  3M99 A;  5D1K B;  2PUY A;  2LGL A;  1LDK C;  3HTK C;  1ZBD B;  3GL6 A;  4A0C D;  5B75 A;  5J3X A;  4AYC A;  4IC3 A;  4YAX A;  4FIP A;  2VPG A;  3RTR B;  4PPE A;  3O37 A;  2VPE A;  3DPL R;  1WEN A;  2ECV A;  5AIT A;  3N9P A;  2F6N A;  2MT5 A;  2M3H A;  2KWJ A;  2C2V S;  2XEU A;  3IHP A;  3M62 A;  2FUI A;  3L11 A;  5C11 A;  5D1M B;  4YBM A;  4V3L C;  1WGM A;  4GB0 A;  1G25 A;  2H0D B;  1WEP A;  2ECW A;  4N4F A;  5FB1 A;  5LKT A;  3N9Q A;  3O70 A;  4ZUX U;  5EYA F;  4YBS A;  1HYJ A;  5TRB A;  2MNZ A;  2YU4 A;  5LKZ A;  2K1J A;  2C2L A;  3PUQ A;  2QIC A;  2VJF A;  3QZV A;  4LAD B;  4O64 A;  1FP0 A;  4R8P K;  4GND A;  3GV4 A;  4FO9 A;  2LQ6 A;  2ECG A;  1K2F A;  2LN0 A;  1V87 A;  5FEY A;  2L80 A;  2YQL A;  3I2D A;  2BAY A;  2K16 A;  3O36 A;  1XWH A;  1LDJ B;  2YHO A;  1WFK A;  2XB1 A;  2FSA A;  2MD8 C;  1MM3 A;  2YHN A;  2F42 A;  2JMJ A;  1HYI A;  2KU3 A;  5LKU A;  2QJ0 A;  2E6R A;  3PHD A;  1Z2Q A;  2E6S A;  3SHB A;  2KRE A;  1VD4 A;  4L7X A;  3PUR A;  2FUU A;  2JRJ A;  5TAB A;  4UI9 B;  3T7L A;  4F52 B;  2G43 A;  2JMI A;  4LK9 A;  4W4U A;  4N3W A;  2L75 A;  2QIZ A;  1F62 A;  5DKA A;  2VPB A;  4FJC A;  5B8D A;  2KYU A;  3SOW A;  4BBQ A;  1BOR A;  1WIM A;  1WEU A;  2JMD A;  3ZVY A;  1WEM A;  2RSD A;  2CKL B;  2KR4 A;  4L58 A;  2M85 A;  2CSZ A;  2EOD A;  3HCU A;  2VPD A;  1WIL A;  3RPG B;  3ZTG A;  4V3K C;  2KFT A;  3U5M A;  3O33 A;  3NG2 A;  5TDW A;  4B86 C;  3LQJ A;  2Y1N A;  2CSY A;  5FER A;  2G45 A;  2K17 A;  2EGP A;  2CT2 A;  2KWK A;  3U5N A;  2YSM A;  5DIN A;  4CCG X;  5C13 A;  2YUC A;  3C5K A;  2VJE B;  4B7Y C;  2LDR A;  1DVP A;  2AN6 A;  1VFY A;  4YAD A;  4S3O B;  4CA1 A;  4X3G A;  5H1V A;  4AYC B;  2MNY A;  4Q6F A;  4MVT A;  3U5O A;  3O35 A;  2MA6 A;  4FK5 A;  2LGK A;  2YT5 A;  3ZPV E;  1Z6U A;  2G6Q A;  4A49 A;  2HYE D;  2VNF A;  2EA6 A;  2ECN A;  3MHH A;  2YQM A;  3ZNI A;  4R2Y A;  5B78 A;  4MSX A;  5B76 A;  4GNE A;  1WEE A;  3KNV A;  5D1L B;  4R7E A;  3RPG C;  5FB0 A;  4UP5 A;  2KIZ A;  5TDR A;  2DX8 A;  4BHW A;  1N87 A;  5H1T A;  3M63 A;  2KWO A;  2MA5 A;  5G04 B;  4QF3 A;  5G0F A;  1WEW A;  4WZ2 A;  2H0D A;  2LRI C;  3HCS A;  4YAT A;  4LLB A;  4YC9 A;  1X4J A;  1WEQ A;  3C6W A;  4A4B A;  1X4I A;  2ZET C;  4LJN A;  4A4C A;  4YAB A;  3N9M A;  3LRQ A;  4GNF A;  2VJF B;  4S3O C;  2KE1 A;  3LQI A;  4YBT A;  2YUR A;  2I50 A;  3LQH A;  2MUM A;  4XI1 A;  4IC2 A;  2L0B A;  3KQI A;  2KGG A;  4UP0 A;  2D8S A;  3O34 A;  3L1X A;  4NN2 A;  2F6J A;  3N9L A;  2MD7 B;  5KH7 A;  4LKA A;  2RI7 A;  3DQV R;  3KV6 A;  2OXQ C;  3ZPV 1;  2K4D A;  1MM2 A;  2Y1M A;  3EB6 A;  1T1H A;  2YYR A;  3O7A A;  2UZG A;  4WZ3 B;  1VYX A;  4GNG A;  4AVX A;  4WA6 A;  1E4U A;  3FL2 A;  5LKX A;  2IDA A;  4ZQL A;  1X4U A;  2LGV A;  2HDP A;  1WEO A;  4QF2 A; 
#chains in the Genus database with same CATH topology
 3SOX A;  3MHS A;  1U6G B;  2VP7 A;  2LXP C;  3VK6 A;  2L5U A;  1JM7 A;  2CRR A;  2YRE A;  3N9O A;  2Y43 A;  2NAA A;  2LV9 A;  2L43 A;  2M1R A;  3U5P A;  2CON A;  5B79 A;  5I3L A;  3ASL A;  2ECT A;  4AUQ B;  1RMD A;  1JOC A;  2M6M A;  5H9M A;  5KH3 A;  1WES A;  1CHC A;  2FD4 A;  4P5O B;  1IYM A;  2KGI A;  3V43 A;  1MBM A;  4OGE A;  4ZDT A;  5TBN A;  2PNX A;  3ZYQ A;  1Z60 A;  1FBV A;  5KH9 A;  5LCW B;  1WEV A;  3T6R A;  5JG6 A;  2ECI A;  3ZVZ B;  4PTB A;  2LGG A;  2JUN A;  2ECJ A;  5AIU A;  2CKL A;  2KWN A;  2LXH C;  5H1U A;  2YW8 A;  3E2D A;  4QQ4 A;  4C9Z A;  3HCT A;  3KV5 A;  3DWD A;  3EB5 A;  5G05 B;  2MIQ A;  4I7B A;  1JM7 B;  4WZ0 A;  4AP4 A;  2MKE A;  4TKP B;  5B77 A;  3L1Z B;  1WE9 A;  4I7C A;  3N9N A;  4H9D A;  2YSJ A;  4F1P A;  2VJE A;  2LAU A;  3SOU A;  4I7D A;  3M99 A;  5D1K B;  3LVQ E;  3KDE C;  2PUY A;  2LGL A;  1LDK C;  3HTK C;  1ZBD B;  3GL6 A;  3FM8 C;  4A0C D;  5B75 A;  5J3X A;  4AYC A;  4IC3 A;  4YAX A;  4FIP A;  2VPG A;  3RTR B;  4PPE A;  3O37 A;  2VPE A;  3DPL R;  1WEN A;  2ECV A;  3DDT A;  5AIT A;  3N9P A;  2F6N A;  2MT5 A;  2M3H A;  2KWJ A;  2C2V S;  2XEU A;  3IHP A;  3M62 A;  2FUI A;  3L11 A;  5C11 A;  5D1M B;  4YBM A;  4V3L C;  1WGM A;  4GB0 A;  1G25 A;  2H0D B;  1WEP A;  2ECW A;  4N4F A;  5FB1 A;  5LKT A;  1DCQ A;  3N9Q A;  3O70 A;  4ZUX U;  4OGC A;  5EYA F;  5SVX A;  4YBS A;  2XOZ A;  1HYJ A;  5TRB A;  4Z0O A;  2MNZ A;  2YU4 A;  5LKZ A;  3FEH A;  2K1J A;  2C2L A;  3PUQ A;  2QIC A;  2VJF A;  3QZV A;  2KKY A;  2M13 A;  4LAD B;  4O64 A;  1FP0 A;  3M7K A;  4R8P K;  4GND A;  3GV4 A;  4FO9 A;  5SVY A;  2LQ6 A;  2ECG A;  3FJU B;  1K2F A;  2LN0 A;  1V87 A;  2B0O E;  5SVI B;  5FEY A;  2L80 A;  2YQL A;  3I2D A;  2BAY A;  2K16 A;  2JM3 A;  3O36 A;  1XWH A;  2E61 A;  1LDJ B;  2YHO A;  1WFK A;  2RR4 A;  2FSA A;  2XB1 A;  2MD8 C;  1MM3 A;  2YHN A;  2F42 A;  2JMJ A;  3H7H A;  2KU3 A;  5LKU A;  1HYI A;  2XP0 A;  2QJ0 A;  2E6R A;  3PHD A;  1Z2Q A;  2E6S A;  3SHB A;  2KRE A;  3LDY A;  1VD4 A;  4L7X A;  3PUR A;  2FUU A;  2JRJ A;  5TAB A;  3T9K A;  2IQJ A;  4UI9 B;  3T7L A;  3LVR E;  4F52 B;  2G43 A;  2JMI A;  4LK9 A;  4W4U A;  4N3W A;  2L75 A;  2QIZ A;  1F62 A;  5DKA A;  2VPB A;  4FJC A;  5B8D A;  2KYU A;  3JUE A;  3FAN A;  3SOW A;  4BBQ A;  1BOR A;  1WIM A;  1WEU A;  2JMD A;  3ZVY A;  1WEM A;  2RSD A;  2CKL B;  2CRW A;  2KR4 A;  4L58 A;  2M85 A;  2EOD A;  2CSZ A;  2EXU A;  3HCU A;  2VPD A;  1WIL A;  3Q1D A;  3RPG B;  3ZTG A;  4V3K C;  2KFT A;  3U5M A;  3O33 A;  3NG2 A;  5TDW A;  4B86 C;  3LQJ A;  2Y1N A;  2CSY A;  5FER A;  2G45 A;  2K17 A;  2EGP A;  2CT2 A;  2KWK A;  3U5N A;  2DJA A;  2DSM A;  2YSM A;  5DIN A;  4CCG X;  5C13 A;  2YUC A;  3C5K A;  2VJE B;  4B7Y C;  2LDR A;  1DVP A;  2AN6 A;  1VFY A;  4YAD A;  4S3O B;  3PLW A;  4CA1 A;  4X3G A;  5H1V A;  4AYC B;  2MNY A;  3LJU X;  4Q6F A;  4MVT A;  3U5O A;  3O35 A;  2MA6 A;  4FK5 A;  2LGK A;  2YT5 A;  3ZPV E;  1Z6U A;  2G6Q A;  4A49 A;  2HYE D;  2VNF A;  2EA6 A;  2ECN A;  3MHH A;  2YQM A;  3ZNI A;  4R2Y A;  5B78 A;  4MSX A;  5B76 A;  4GNE A;  1WEE A;  3KNV A;  5D1L B;  4R7E A;  3RPG C;  5FB0 A;  4UP5 A;  2KIZ A;  5TDR A;  2DX8 A;  2D8U A;  4BHW A;  3SUB A;  1N87 A;  5H1T A;  3M63 A;  2L7P A;  2CSV A;  2KWO A;  2MA5 A;  5G04 B;  4QF3 A;  5G0F A;  1WEW A;  4WZ2 A;  2FFW A;  2H0D A;  2LRI C;  3HCS A;  4YAT A;  4LLB A;  4YC9 A;  1X4J A;  1WEQ A;  3C6W A;  4A4B A;  1X4I A;  2ZET C;  4LJN A;  4A4C A;  4YAB A;  3N9M A;  3LRQ A;  4GNF A;  2VJF B;  4S3O C;  2KE1 A;  3LQI A;  4YBT A;  2YUR A;  2I50 A;  3LQH A;  2MUM A;  4XI1 A;  2EGM A;  2XOY A;  3MDB C;  4IC2 A;  2L0B A;  3KQI A;  2KGG A;  4UP0 A;  4Z0R A;  2D8S A;  3O34 A;  3L1X A;  4NN2 A;  2F6J A;  3N9L A;  2MD7 B;  2KKX A;  5KH7 A;  4LKA A;  2RI7 A;  3DQV R;  3KV6 A;  5K3Q A;  2OXQ C;  3ZPV 1;  2K4D A;  1MM2 A;  3FAO A;  2Y1M A;  3EB6 A;  1T1H A;  2YYR A;  2YVR A;  2UZG A;  3O7A A;  2P57 A;  4WZ3 B;  1VYX A;  4GNG A;  4AVX A;  4WA6 A;  3O47 A;  1E4U A;  3FL2 A;  5SVI A;  5LKX A;  2IDA A;  2XOC A;  4ZQL A;  1X4U A;  2LGV A;  2HDP A;  2OWA A;  4O62 A;  1WEO A;  4QF2 A; 
#chains in the Genus database with same CATH homology
 3SOX A;  3MHS A;  1U6G B;  2VP7 A;  2LXP C;  3VK6 A;  2L5U A;  1JM7 A;  2YRE A;  3N9O A;  2Y43 A;  2NAA A;  2LV9 A;  2L43 A;  2M1R A;  3U5P A;  5B79 A;  5I3L A;  3ASL A;  2ECT A;  4AUQ B;  1RMD A;  1JOC A;  2M6M A;  5H9M A;  5KH3 A;  1WES A;  1CHC A;  4P5O B;  1IYM A;  2KGI A;  3V43 A;  4ZDT A;  5TBN A;  2PNX A;  3ZYQ A;  1Z60 A;  1FBV A;  5KH9 A;  5LCW B;  1WEV A;  3T6R A;  5JG6 A;  2ECI A;  3ZVZ B;  4PTB A;  2LGG A;  2ECJ A;  5AIU A;  2CKL A;  2KWN A;  2LXH C;  5H1U A;  2YW8 A;  4C9Z A;  3HCT A;  3KV5 A;  3EB5 A;  5G05 B;  2MIQ A;  4I7B A;  1JM7 B;  4WZ0 A;  4AP4 A;  4TKP B;  5B77 A;  3L1Z B;  1WE9 A;  4I7C A;  3N9N A;  2YSJ A;  2VJE A;  3SOU A;  4I7D A;  3M99 A;  5D1K B;  2PUY A;  2LGL A;  1LDK C;  3HTK C;  1ZBD B;  3GL6 A;  4A0C D;  5B75 A;  5J3X A;  4AYC A;  4IC3 A;  4YAX A;  4FIP A;  2VPG A;  3RTR B;  4PPE A;  3O37 A;  2VPE A;  3DPL R;  1WEN A;  2ECV A;  5AIT A;  3N9P A;  2F6N A;  2MT5 A;  2M3H A;  2KWJ A;  2C2V S;  2XEU A;  3IHP A;  3M62 A;  2FUI A;  3L11 A;  5C11 A;  5D1M B;  4YBM A;  4V3L C;  1WGM A;  4GB0 A;  1G25 A;  2H0D B;  1WEP A;  2ECW A;  4N4F A;  5FB1 A;  5LKT A;  3N9Q A;  3O70 A;  4ZUX U;  5EYA F;  4YBS A;  1HYJ A;  5TRB A;  2MNZ A;  2YU4 A;  5LKZ A;  2K1J A;  2C2L A;  3PUQ A;  2QIC A;  2VJF A;  3QZV A;  4LAD B;  4O64 A;  1FP0 A;  4R8P K;  4GND A;  3GV4 A;  4FO9 A;  2LQ6 A;  2ECG A;  1K2F A;  2LN0 A;  1V87 A;  5FEY A;  2L80 A;  2YQL A;  3I2D A;  2BAY A;  2K16 A;  3O36 A;  1XWH A;  1LDJ B;  2YHO A;  1WFK A;  2XB1 A;  2FSA A;  2MD8 C;  1MM3 A;  2YHN A;  2F42 A;  2JMJ A;  1HYI A;  2KU3 A;  5LKU A;  2QJ0 A;  2E6R A;  3PHD A;  1Z2Q A;  2E6S A;  3SHB A;  2KRE A;  1VD4 A;  4L7X A;  3PUR A;  2FUU A;  2JRJ A;  5TAB A;  4UI9 B;  3T7L A;  4F52 B;  2G43 A;  2JMI A;  4LK9 A;  4W4U A;  4N3W A;  2L75 A;  2QIZ A;  1F62 A;  5DKA A;  2VPB A;  4FJC A;  5B8D A;  2KYU A;  3SOW A;  4BBQ A;  1BOR A;  1WIM A;  1WEU A;  2JMD A;  3ZVY A;  1WEM A;  2RSD A;  2CKL B;  2KR4 A;  4L58 A;  2M85 A;  2CSZ A;  2EOD A;  3HCU A;  2VPD A;  1WIL A;  3RPG B;  3ZTG A;  4V3K C;  2KFT A;  3U5M A;  3O33 A;  3NG2 A;  5TDW A;  4B86 C;  3LQJ A;  2Y1N A;  2CSY A;  5FER A;  2G45 A;  2K17 A;  2EGP A;  2CT2 A;  2KWK A;  3U5N A;  2YSM A;  5DIN A;  4CCG X;  5C13 A;  2YUC A;  3C5K A;  2VJE B;  4B7Y C;  2LDR A;  1DVP A;  2AN6 A;  1VFY A;  4YAD A;  4S3O B;  4CA1 A;  4X3G A;  5H1V A;  4AYC B;  2MNY A;  4Q6F A;  4MVT A;  3U5O A;  3O35 A;  2MA6 A;  4FK5 A;  2LGK A;  2YT5 A;  3ZPV E;  1Z6U A;  2G6Q A;  4A49 A;  2HYE D;  2VNF A;  2EA6 A;  2ECN A;  3MHH A;  2YQM A;  3ZNI A;  4R2Y A;  5B78 A;  4MSX A;  5B76 A;  4GNE A;  1WEE A;  3KNV A;  5D1L B;  4R7E A;  3RPG C;  5FB0 A;  4UP5 A;  2KIZ A;  5TDR A;  2DX8 A;  4BHW A;  1N87 A;  5H1T A;  3M63 A;  2KWO A;  2MA5 A;  5G04 B;  4QF3 A;  5G0F A;  1WEW A;  4WZ2 A;  2H0D A;  2LRI C;  3HCS A;  4YAT A;  4LLB A;  4YC9 A;  1X4J A;  1WEQ A;  3C6W A;  4A4B A;  1X4I A;  2ZET C;  4LJN A;  4A4C A;  4YAB A;  3N9M A;  3LRQ A;  4GNF A;  2VJF B;  4S3O C;  2KE1 A;  3LQI A;  4YBT A;  2YUR A;  2I50 A;  3LQH A;  2MUM A;  4XI1 A;  4IC2 A;  2L0B A;  3KQI A;  2KGG A;  4UP0 A;  2D8S A;  3O34 A;  3L1X A;  4NN2 A;  2F6J A;  3N9L A;  2MD7 B;  5KH7 A;  4LKA A;  2RI7 A;  3DQV R;  3KV6 A;  2OXQ C;  3ZPV 1;  2K4D A;  1MM2 A;  2Y1M A;  3EB6 A;  1T1H A;  2YYR A;  3O7A A;  2UZG A;  4WZ3 B;  1VYX A;  4GNG A;  4AVX A;  4WA6 A;  1E4U A;  3FL2 A;  5LKX A;  2IDA A;  4ZQL A;  1X4U A;  2LGV A;  2HDP A;  1WEO A;  4QF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...