4UP5A

Crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a chemical fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
85
Chain Sequence
GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
total genus 25
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up5A00
4S3OC 2ZETC 2MNZA 3DQVR 5D1MB 3EB5A 1WEMA 2K4DA 1WEOA 2ECNA 4LLBA 2LGKA 2JRJA 5JG6A 5TDRA 2VPGA 1WGMA 4IC3A 2ECVA 1JM7A 4B86C 4BHWA 1RMDA 2Y1NA 5G04B 3RTRB 5LKXA 3IHPA 2D8SA 2HYED 2MD7B 2YUCA 5B76A 2MA6A 1ZBDB 2ECTA 4O64A 3ZTGA 4A0CD 3KNVA 2CKLB 4ZDTA 1IYMA 3HCTA 4S3OB 2VJFB 4LJNA 4GNDA 3SOWA 1X4IA 3QZVA 2LGGA 4A4CA 5KH7A 2MNYA 3DPLR 4AYCB 2YW8A 3LQHA 1X4UA 3LRQA 1WE9A 3RPGC 3N9QA 4GNEA 5LKUA 3U5MA 3FL2A 4FO9A 3O35A 2AN6A 4Q6FA 4QF2A 2LV9A 4YBMA 4WZ3B 5I3LA 3L1XA 4N4FA 5AITA 3V43A 5FB1A 2F42A 2L75A 2EGPA 3KQIA 4UP5A 4TKPB 2NAAA 2XB1A 2YQMA 1U6GB 4P5OB 4FJCA 4UI9B 1WESA 4AP4A 2K1JA 3ZYQA 4WZ2A 2CT2A 4C9ZA 5H1TA 2KWNA 4AUQB 2M6MA 5B75A 1HYIA 4B7YC 4R2YA 2YYRA 4BBQA 2M1RA 1X4JA 1WEUA 2L80A 3RPGB 2EA6A 1WILA 2FUIA 1E4UA 3M63A 2VP7A 4CCGX 5B78A 2XEUA 4IC2A 2ECIA 5H1UA 2RSDA 2QICA 2YSMA 5TDWA 4I7DA 2YU4A 1K2FA 2YSJA 4PPEA 2VPEA 4L58A 2LQ6A 2KE1A 2KGIA 2JMJA 4LK9A 4A49A 4YBSA 2KWOA 5LKTA 2ECGA 4I7CA 5B79A 2UZGA 2F6NA 4YADA 3T7LA 2M3HA 2VJFA 3M62A 3ZVZB 1FBVA 4I7BA 1V87A 3ASLA 1XWHA 4YABA 2L5UA 2Y1MA 2VNFA 2LDRA 1WEPA 2M85A 5TBNA 2HDPA 2YT5A 2LXPC 2G45A 2KR4A 2MUMA 3HCUA 1LDJB 1JM7B 4CA1A 2KREA 2C2LA 3C5KA 2MD8C 2KWKA 3LQJA 4AYCA 4YBTA 3HCSA 2E6SA 2YREA 5DINA 2KGGA 3O34A 3GL6A 4V3LC 5DKAA 5FB0A 2EODA 5LKZA 2DX8A 4F52B 4ZUXU 5J3XA 3EB6A 3ZNIA 1VYXA 3ZPVE 2KU3A 2G43A 1F62A 3SOXA 2CKLA 2Y43A 1WEVA 5D1KB 2OXQC 1MM2A 4LADB 1N87A 3SHBA 5C11A 4YATA 3NG2A 1G25A 2JMDA 3N9OA 1T1HA 3PURA 5H9MA 5G05B 5TABA 2QJ0A 1BORA 2G6QA 3GV4A 1LDKC 2KYUA 1DVPA 2K17A 3SOUA 2VJEB 3O36A 3N9MA 3O70A 2CSYA 4X3GA 2PUYA 5FEYA 3PHDA 1WEWA 1WEEA 3PUQA 5TRBA 5KH3A 4FIPA 3I2DA 1Z2QA 1WIMA 2H0DB 2VJEA 3KV6A 2MA5A 5H1VA 2ECWA 5D1LB 1VFYA 2YQLA 3O7AA 3MHSA 2I50A 2ECJA 4R7EA 5FERA 4AVXA 2MIQA 1FP0A 2YURA 5LCWB 2VPBA 1WENA 3O33A 4QF3A 2KWJA 5EYAF 2YHOA 4YAXA 3LQIA 2K16A 3VK6A 2RI7A 3N9NA 1WFKA 3N9LA 3U5PA 2LGVA 3T6RA 4N3WA 3U5NA 1HYJA 2QIZA 5AIUA 3C6WA 2YHNA 3N9PA 2FUUA 4R8PK 2LRIC 5B8DA 4GNFA 3ZVYA 2CSZA 2H0DA 4UP0A 5G0FA 4V3KC 2LGLA 3ZPV1 2L0BA 4ZQLA 3O37A 2C2VS 1MM3A 5KH9A 3L1ZB 1Z6UA 4YC9A 2LN0A 2KIZA 4XI1A 3U5OA 2FSAA 1JOCA 4W4UA 2BAYA 3L11A 4LKAA 5B77A 1CHCA 2F6JA 4FK5A 2IDAA 4GB0A 2KFTA 4L7XA 4MSXA 3KV5A 2MT5A 4WA6A 1VD4A 2E6RA 3MHHA 1WEQA 1Z60A 2VPDA 4A4BA 2PNXA 2JMIA 4PTBA 4WZ0A 3HTKC 5C13A 4NN2A 3M99A 2L43A 4MVTA 2LXHC 4GNGA
chains in the Genus database with same CATH superfamily
3KDEC 3FM8C 4S3OC 2ZETC 2MNZA 2L7PA 3LDYA 3DQVR 5D1MB 3EB5A 1WEMA 2K4DA 1WEOA 2ECNA 4LLBA 2LGKA 2JRJA 3FAOA 5JG6A 5TDRA 2VPGA 1WGMA 4IC3A 2ECVA 1JM7A 4B86C 4BHWA 1RMDA 2Y1NA 5G04B 3RTRB 5LKXA 3IHPA 2D8SA 2HYED 2MD7B 2YUCA 5B76A 2MA6A 1ZBDB 2ECTA 4O64A 3ZTGA 4A0CD 3KNVA 2CKLB 4ZDTA 1IYMA 3HCTA 4S3OB 2VJFB 4LJNA 4GNDA 3SOWA 1X4IA 3QZVA 2LGGA 4A4CA 5KH7A 2MNYA 3DPLR 4AYCB 2YW8A 3LQHA 1X4UA 3LRQA 1WE9A 3RPGC 3N9QA 4GNEA 5LKUA 3U5MA 3FL2A 4FO9A 2JM3A 3O35A 2AN6A 4Q6FA 4QF2A 2LV9A 4YBMA 3LJUX 4WZ3B 5I3LA 3L1XA 2M13A 4N4FA 2FD4A 5AITA 3V43A 5FB1A 3T9KA 2F42A 2L75A 2EGPA 3KQIA 4UP5A 4TKPB 3O47A 2NAAA 2XB1A 2YQMA 1U6GB 4P5OB 4FJCA 4UI9B 1WESA 4AP4A 2K1JA 3ZYQA 2KKXA 4WZ2A 2CT2A 4C9ZA 5H1TA 2KWNA 4AUQB 2XP0A 2M6MA 5B75A 2JUNA 2KKYA 1HYIA 4B7YC 4R2YA 2CRWA 2YYRA 4BBQA 2M1RA 1X4JA 1WEUA 2L80A 3RPGB 2EA6A 1WILA 2FUIA 1E4UA 4Z0RA 3M63A 2VP7A 4CCGX 5B78A 2XEUA 4IC2A 2ECIA 3JUEA 5H1UA 2RSDA 1MBMA 2QICA 2YSMA 5TDWA 4I7DA 2YU4A 1K2FA 2YSJA 4PPEA 2VPEA 4L58A 2LQ6A 4Z0OA 2KE1A 2KGIA 5K3QA 2JMJA 4LK9A 4A49A 4YBSA 2KWOA 2XOZA 5LKTA 2ECGA 4I7CA 5B79A 2UZGA 2F6NA 4YADA 3T7LA 3FJUB 2M3HA 2VJFA 3M62A 3ZVZB 1FBVA 4I7BA 3M7KA 1V87A 3ASLA 1XWHA 4YABA 2L5UA 2Y1MA 2D8UA 2VNFA 2LDRA 1WEPA 2M85A 5TBNA 2HDPA 2YT5A 2LXPC 2G45A 2KR4A 2MUMA 3HCUA 4F1PA 1LDJB 1JM7B 4CA1A 2KREA 2C2LA 3C5KA 2DJAA 2MD8C 2KWKA 3LQJA 4AYCA 4YBTA 3HCSA 2E6SA 2YREA 5DINA 2KGGA 3O34A 3GL6A 4V3LC 5DKAA 5FB0A 2EODA 5LKZA 2DX8A 4F52B 4ZUXU 5J3XA 3Q1DA 3EB6A 3ZNIA 1VYXA 3ZPVE 2KU3A 3DWDA 2P57A 2G43A 1F62A 3SOXA 2CKLA 2Y43A 1WEVA 5D1KB 2OXQC 4O62A 1MM2A 2CRRA 2XOYA 4LADB 1N87A 3SHBA 5C11A 4YATA 3NG2A 1G25A 2JMDA 3N9OA 2FFWA 4OGEA 1T1HA 3PURA 5H9MA 5G05B 5TABA 2QJ0A 3FEHA 1BORA 2YVRA 3SUBA 2G6QA 2LAUA 3GV4A 3FANA 1LDKC 2KYUA 1DVPA 2K17A 2OWAA 3SOUA 2VJEB 3O36A 3N9MA 3O70A 2CSYA 4X3GA 4H9DA 2PUYA 5FEYA 3PHDA 3LVRE 1WEWA 1WEEA 3PUQA 5TRBA 5KH3A 4FIPA 3I2DA 1Z2QA 1WIMA 2H0DB 2VJEA 3KV6A 2MA5A 5H1VA 2ECWA 5D1LB 2E61A 1VFYA 2YQLA 3O7AA 3MHSA 2I50A 2ECJA 4R7EA 5FERA 4AVXA 2MIQA 1FP0A 2IQJA 2YURA 5LCWB 2VPBA 1WENA 3O33A 4QF3A 2KWJA 5EYAF 2YHOA 4YAXA 3LQIA 2DSMA 2K16A 5SVXA 3VK6A 2RI7A 3N9NA 1WFKA 2MKEA 2RR4A 5SVYA 3LVQE 3N9LA 3U5PA 2LGVA 3T6RA 4N3WA 3U5NA 1DCQA 1HYJA 2EGMA 2QIZA 4OGCA 5AIUA 2B0OE 3C6WA 2YHNA 3N9PA 2FUUA 4R8PK 2LRIC 5B8DA 4GNFA 3ZVYA 3MDBC 2CSZA 2H0DA 4UP0A 5G0FA 4V3KC 2LGLA 3ZPV1 2L0BA 4ZQLA 3O37A 2C2VS 1MM3A 5KH9A 3L1ZB 1Z6UA 2CONA 4QQ4A 2CSVA 4YC9A 2LN0A 3DDTA 2KIZA 4XI1A 3U5OA 2FSAA 1JOCA 4W4UA 2BAYA 3L11A 5SVIA 4LKAA 5B77A 1CHCA 2F6JA 4FK5A 3E2DA 2IDAA 4GB0A 2KFTA 4L7XA 4MSXA 3KV5A 2MT5A 4WA6A 1VD4A 3PLWA 2XOCA 2E6RA 3MHHA 2EXUA 1WEQA 1Z60A 5SVIB 3H7HA 2VPDA 4A4BA 2PNXA 2JMIA 4PTBA 4WZ0A 3HTKC 5C13A 4NN2A 3M99A 2L43A 4MVTA 2LXHC 4GNGA
chains in the Genus database with same CATH topology
4S3OC 2ZETC 2MNZA 3DQVR 5D1MB 3EB5A 1WEMA 2K4DA 1WEOA 2ECNA 4LLBA 2LGKA 2JRJA 5JG6A 5TDRA 2VPGA 1WGMA 4IC3A 2ECVA 1JM7A 4B86C 4BHWA 1RMDA 2Y1NA 5G04B 3RTRB 5LKXA 3IHPA 2D8SA 2HYED 2MD7B 2YUCA 5B76A 2MA6A 1ZBDB 2ECTA 4O64A 3ZTGA 4A0CD 3KNVA 2CKLB 4ZDTA 1IYMA 3HCTA 4S3OB 2VJFB 4LJNA 4GNDA 3SOWA 1X4IA 3QZVA 2LGGA 4A4CA 5KH7A 2MNYA 3DPLR 4AYCB 2YW8A 3LQHA 1X4UA 3LRQA 1WE9A 3RPGC 3N9QA 4GNEA 5LKUA 3U5MA 3FL2A 4FO9A 3O35A 2AN6A 4Q6FA 4QF2A 2LV9A 4YBMA 4WZ3B 5I3LA 3L1XA 4N4FA 5AITA 3V43A 5FB1A 2F42A 2L75A 2EGPA 3KQIA 4UP5A 4TKPB 2NAAA 2XB1A 2YQMA 1U6GB 4P5OB 4FJCA 4UI9B 1WESA 4AP4A 2K1JA 3ZYQA 4WZ2A 2CT2A 4C9ZA 5H1TA 2KWNA 4AUQB 2M6MA 5B75A 1HYIA 4B7YC 4R2YA 2YYRA 4BBQA 2M1RA 1X4JA 1WEUA 2L80A 3RPGB 2EA6A 1WILA 2FUIA 1E4UA 3M63A 2VP7A 4CCGX 5B78A 2XEUA 4IC2A 2ECIA 5H1UA 2RSDA 2QICA 2YSMA 5TDWA 4I7DA 2YU4A 1K2FA 2YSJA 4PPEA 2VPEA 4L58A 2LQ6A 2KE1A 2KGIA 2JMJA 4LK9A 4A49A 4YBSA 2KWOA 5LKTA 2ECGA 4I7CA 5B79A 2UZGA 2F6NA 4YADA 3T7LA 2M3HA 2VJFA 3M62A 3ZVZB 1FBVA 4I7BA 1V87A 3ASLA 1XWHA 4YABA 2L5UA 2Y1MA 2VNFA 2LDRA 1WEPA 2M85A 5TBNA 2HDPA 2YT5A 2LXPC 2G45A 2KR4A 2MUMA 3HCUA 1LDJB 1JM7B 4CA1A 2KREA 2C2LA 3C5KA 2MD8C 2KWKA 3LQJA 4AYCA 4YBTA 3HCSA 2E6SA 2YREA 5DINA 2KGGA 3O34A 3GL6A 4V3LC 5DKAA 5FB0A 2EODA 5LKZA 2DX8A 4F52B 4ZUXU 5J3XA 3EB6A 3ZNIA 1VYXA 3ZPVE 2KU3A 2G43A 1F62A 3SOXA 2CKLA 2Y43A 1WEVA 5D1KB 2OXQC 1MM2A 4LADB 1N87A 3SHBA 5C11A 4YATA 3NG2A 1G25A 2JMDA 3N9OA 1T1HA 3PURA 5H9MA 5G05B 5TABA 2QJ0A 1BORA 2G6QA 3GV4A 1LDKC 2KYUA 1DVPA 2K17A 3SOUA 2VJEB 3O36A 3N9MA 3O70A 2CSYA 4X3GA 2PUYA 5FEYA 3PHDA 1WEWA 1WEEA 3PUQA 5TRBA 5KH3A 4FIPA 3I2DA 1Z2QA 1WIMA 2H0DB 2VJEA 3KV6A 2MA5A 5H1VA 2ECWA 5D1LB 1VFYA 2YQLA 3O7AA 3MHSA 2I50A 2ECJA 4R7EA 5FERA 4AVXA 2MIQA 1FP0A 2YURA 5LCWB 2VPBA 1WENA 3O33A 4QF3A 2KWJA 5EYAF 2YHOA 4YAXA 3LQIA 2K16A 3VK6A 2RI7A 3N9NA 1WFKA 3N9LA 3U5PA 2LGVA 3T6RA 4N3WA 3U5NA 1HYJA 2QIZA 5AIUA 3C6WA 2YHNA 3N9PA 2FUUA 4R8PK 2LRIC 5B8DA 4GNFA 3ZVYA 2CSZA 2H0DA 4UP0A 5G0FA 4V3KC 2LGLA 3ZPV1 2L0BA 4ZQLA 3O37A 2C2VS 1MM3A 5KH9A 3L1ZB 1Z6UA 4YC9A 2LN0A 2KIZA 4XI1A 3U5OA 2FSAA 1JOCA 4W4UA 2BAYA 3L11A 4LKAA 5B77A 1CHCA 2F6JA 4FK5A 2IDAA 4GB0A 2KFTA 4L7XA 4MSXA 3KV5A 2MT5A 4WA6A 1VD4A 2E6RA 3MHHA 1WEQA 1Z60A 2VPDA 4A4BA 2PNXA 2JMIA 4PTBA 4WZ0A 3HTKC 5C13A 4NN2A 3M99A 2L43A 4MVTA 2LXHC 4GNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3O C;  2ZET C;  2MNZ A;  3DQV R;  5D1M B;  3EB5 A;  1WEM A;  2K4D A;  1WEO A;  2ECN A;  4LLB A;  2LGK A;  2JRJ A;  5JG6 A;  5TDR A;  2VPG A;  1WGM A;  4IC3 A;  2ECV A;  1JM7 A;  4B86 C;  4BHW A;  1RMD A;  2Y1N A;  5G04 B;  3RTR B;  5LKX A;  3IHP A;  2D8S A;  2HYE D;  2MD7 B;  2YUC A;  5B76 A;  2MA6 A;  1ZBD B;  2ECT A;  4O64 A;  3ZTG A;  4A0C D;  3KNV A;  2CKL B;  4ZDT A;  1IYM A;  3HCT A;  4S3O B;  2VJF B;  4LJN A;  4GND A;  3SOW A;  1X4I A;  3QZV A;  2LGG A;  4A4C A;  5KH7 A;  2MNY A;  3DPL R;  4AYC B;  2YW8 A;  3LQH A;  1X4U A;  3LRQ A;  1WE9 A;  3RPG C;  3N9Q A;  4GNE A;  5LKU A;  3U5M A;  3FL2 A;  4FO9 A;  3O35 A;  2AN6 A;  4Q6F A;  4QF2 A;  2LV9 A;  4YBM A;  4WZ3 B;  5I3L A;  3L1X A;  4N4F A;  5AIT A;  3V43 A;  5FB1 A;  2F42 A;  2L75 A;  2EGP A;  3KQI A;  4UP5 A;  4TKP B;  2NAA A;  2XB1 A;  2YQM A;  1U6G B;  4P5O B;  4FJC A;  4UI9 B;  1WES A;  4AP4 A;  2K1J A;  3ZYQ A;  4WZ2 A;  2CT2 A;  4C9Z A;  5H1T A;  2KWN A;  4AUQ B;  2M6M A;  5B75 A;  1HYI A;  4B7Y C;  4R2Y A;  2YYR A;  4BBQ A;  2M1R A;  1X4J A;  1WEU A;  2L80 A;  3RPG B;  2EA6 A;  1WIL A;  2FUI A;  1E4U A;  3M63 A;  2VP7 A;  4CCG X;  5B78 A;  2XEU A;  4IC2 A;  2ECI A;  5H1U A;  2RSD A;  2QIC A;  2YSM A;  5TDW A;  4I7D A;  2YU4 A;  1K2F A;  2YSJ A;  4PPE A;  2VPE A;  4L58 A;  2LQ6 A;  2KE1 A;  2KGI A;  2JMJ A;  4LK9 A;  4A49 A;  4YBS A;  2KWO A;  5LKT A;  2ECG A;  4I7C A;  5B79 A;  2UZG A;  2F6N A;  4YAD A;  3T7L A;  2M3H A;  2VJF A;  3M62 A;  3ZVZ B;  1FBV A;  4I7B A;  1V87 A;  3ASL A;  1XWH A;  4YAB A;  2L5U A;  2Y1M A;  2VNF A;  2LDR A;  1WEP A;  2M85 A;  5TBN A;  2HDP A;  2YT5 A;  2LXP C;  2G45 A;  2KR4 A;  2MUM A;  3HCU A;  1LDJ B;  1JM7 B;  4CA1 A;  2KRE A;  2C2L A;  3C5K A;  2MD8 C;  2KWK A;  3LQJ A;  4AYC A;  4YBT A;  3HCS A;  2E6S A;  2YRE A;  5DIN A;  2KGG A;  3O34 A;  3GL6 A;  4V3L C;  5DKA A;  5FB0 A;  2EOD A;  5LKZ A;  2DX8 A;  4F52 B;  4ZUX U;  5J3X A;  3EB6 A;  3ZNI A;  1VYX A;  3ZPV E;  2KU3 A;  2G43 A;  1F62 A;  3SOX A;  2CKL A;  2Y43 A;  1WEV A;  5D1K B;  2OXQ C;  1MM2 A;  4LAD B;  1N87 A;  3SHB A;  5C11 A;  4YAT A;  3NG2 A;  1G25 A;  2JMD A;  3N9O A;  1T1H A;  3PUR A;  5H9M A;  5G05 B;  5TAB A;  2QJ0 A;  1BOR A;  2G6Q A;  3GV4 A;  1LDK C;  2KYU A;  1DVP A;  2K17 A;  3SOU A;  2VJE B;  3O36 A;  3N9M A;  3O70 A;  2CSY A;  4X3G A;  2PUY A;  5FEY A;  3PHD A;  1WEW A;  1WEE A;  3PUQ A;  5TRB A;  5KH3 A;  4FIP A;  3I2D A;  1Z2Q A;  1WIM A;  2H0D B;  2VJE A;  3KV6 A;  2MA5 A;  5H1V A;  2ECW A;  5D1L B;  1VFY A;  2YQL A;  3O7A A;  3MHS A;  2I50 A;  2ECJ A;  4R7E A;  5FER A;  4AVX A;  2MIQ A;  1FP0 A;  2YUR A;  5LCW B;  2VPB A;  1WEN A;  3O33 A;  4QF3 A;  2KWJ A;  5EYA F;  2YHO A;  4YAX A;  3LQI A;  2K16 A;  3VK6 A;  2RI7 A;  3N9N A;  1WFK A;  3N9L A;  3U5P A;  2LGV A;  3T6R A;  4N3W A;  3U5N A;  1HYJ A;  2QIZ A;  5AIU A;  3C6W A;  2YHN A;  3N9P A;  2FUU A;  4R8P K;  2LRI C;  5B8D A;  4GNF A;  3ZVY A;  2CSZ A;  2H0D A;  4UP0 A;  5G0F A;  4V3K C;  2LGL A;  3ZPV 1;  2L0B A;  4ZQL A;  3O37 A;  2C2V S;  1MM3 A;  5KH9 A;  3L1Z B;  1Z6U A;  4YC9 A;  2LN0 A;  2KIZ A;  4XI1 A;  3U5O A;  2FSA A;  1JOC A;  4W4U A;  2BAY A;  3L11 A;  4LKA A;  5B77 A;  1CHC A;  2F6J A;  4FK5 A;  2IDA A;  4GB0 A;  2KFT A;  4L7X A;  4MSX A;  3KV5 A;  2MT5 A;  4WA6 A;  1VD4 A;  2E6R A;  3MHH A;  1WEQ A;  1Z60 A;  2VPD A;  4A4B A;  2PNX A;  2JMI A;  4PTB A;  4WZ0 A;  3HTK C;  5C13 A;  4NN2 A;  3M99 A;  2L43 A;  4MVT A;  2LXH C;  4GNG A; 
#chains in the Genus database with same CATH topology
 3KDE C;  3FM8 C;  4S3O C;  2ZET C;  2MNZ A;  2L7P A;  3LDY A;  3DQV R;  5D1M B;  3EB5 A;  1WEM A;  2K4D A;  1WEO A;  2ECN A;  4LLB A;  2LGK A;  2JRJ A;  3FAO A;  5JG6 A;  5TDR A;  2VPG A;  1WGM A;  4IC3 A;  2ECV A;  1JM7 A;  4B86 C;  4BHW A;  1RMD A;  2Y1N A;  5G04 B;  3RTR B;  5LKX A;  3IHP A;  2D8S A;  2HYE D;  2MD7 B;  2YUC A;  5B76 A;  2MA6 A;  1ZBD B;  2ECT A;  4O64 A;  3ZTG A;  4A0C D;  3KNV A;  2CKL B;  4ZDT A;  1IYM A;  3HCT A;  4S3O B;  2VJF B;  4LJN A;  4GND A;  3SOW A;  1X4I A;  3QZV A;  2LGG A;  4A4C A;  5KH7 A;  2MNY A;  3DPL R;  4AYC B;  2YW8 A;  3LQH A;  1X4U A;  3LRQ A;  1WE9 A;  3RPG C;  3N9Q A;  4GNE A;  5LKU A;  3U5M A;  3FL2 A;  4FO9 A;  2JM3 A;  3O35 A;  2AN6 A;  4Q6F A;  4QF2 A;  2LV9 A;  4YBM A;  3LJU X;  4WZ3 B;  5I3L A;  3L1X A;  2M13 A;  4N4F A;  2FD4 A;  5AIT A;  3V43 A;  5FB1 A;  3T9K A;  2F42 A;  2L75 A;  2EGP A;  3KQI A;  4UP5 A;  4TKP B;  3O47 A;  2NAA A;  2XB1 A;  2YQM A;  1U6G B;  4P5O B;  4FJC A;  4UI9 B;  1WES A;  4AP4 A;  2K1J A;  3ZYQ A;  2KKX A;  4WZ2 A;  2CT2 A;  4C9Z A;  5H1T A;  2KWN A;  4AUQ B;  2XP0 A;  2M6M A;  5B75 A;  2JUN A;  2KKY A;  1HYI A;  4B7Y C;  4R2Y A;  2CRW A;  2YYR A;  4BBQ A;  2M1R A;  1X4J A;  1WEU A;  2L80 A;  3RPG B;  2EA6 A;  1WIL A;  2FUI A;  1E4U A;  4Z0R A;  3M63 A;  2VP7 A;  4CCG X;  5B78 A;  2XEU A;  4IC2 A;  2ECI A;  3JUE A;  5H1U A;  2RSD A;  1MBM A;  2QIC A;  2YSM A;  5TDW A;  4I7D A;  2YU4 A;  1K2F A;  2YSJ A;  4PPE A;  2VPE A;  4L58 A;  2LQ6 A;  4Z0O A;  2KE1 A;  2KGI A;  5K3Q A;  2JMJ A;  4LK9 A;  4A49 A;  4YBS A;  2KWO A;  2XOZ A;  5LKT A;  2ECG A;  4I7C A;  5B79 A;  2UZG A;  2F6N A;  4YAD A;  3T7L A;  3FJU B;  2M3H A;  2VJF A;  3M62 A;  3ZVZ B;  1FBV A;  4I7B A;  3M7K A;  1V87 A;  3ASL A;  1XWH A;  4YAB A;  2L5U A;  2Y1M A;  2D8U A;  2VNF A;  2LDR A;  1WEP A;  2M85 A;  5TBN A;  2HDP A;  2YT5 A;  2LXP C;  2G45 A;  2KR4 A;  2MUM A;  3HCU A;  4F1P A;  1LDJ B;  1JM7 B;  4CA1 A;  2KRE A;  2C2L A;  3C5K A;  2DJA A;  2MD8 C;  2KWK A;  3LQJ A;  4AYC A;  4YBT A;  3HCS A;  2E6S A;  2YRE A;  5DIN A;  2KGG A;  3O34 A;  3GL6 A;  4V3L C;  5DKA A;  5FB0 A;  2EOD A;  5LKZ A;  2DX8 A;  4F52 B;  4ZUX U;  5J3X A;  3Q1D A;  3EB6 A;  3ZNI A;  1VYX A;  3ZPV E;  2KU3 A;  3DWD A;  2P57 A;  2G43 A;  1F62 A;  3SOX A;  2CKL A;  2Y43 A;  1WEV A;  5D1K B;  2OXQ C;  4O62 A;  1MM2 A;  2CRR A;  2XOY A;  4LAD B;  1N87 A;  3SHB A;  5C11 A;  4YAT A;  3NG2 A;  1G25 A;  2JMD A;  3N9O A;  2FFW A;  4OGE A;  1T1H A;  3PUR A;  5H9M A;  5G05 B;  5TAB A;  2QJ0 A;  3FEH A;  1BOR A;  2YVR A;  3SUB A;  2G6Q A;  2LAU A;  3GV4 A;  3FAN A;  1LDK C;  2KYU A;  1DVP A;  2K17 A;  2OWA A;  3SOU A;  2VJE B;  3O36 A;  3N9M A;  3O70 A;  2CSY A;  4X3G A;  4H9D A;  2PUY A;  5FEY A;  3PHD A;  3LVR E;  1WEW A;  1WEE A;  3PUQ A;  5TRB A;  5KH3 A;  4FIP A;  3I2D A;  1Z2Q A;  1WIM A;  2H0D B;  2VJE A;  3KV6 A;  2MA5 A;  5H1V A;  2ECW A;  5D1L B;  2E61 A;  1VFY A;  2YQL A;  3O7A A;  3MHS A;  2I50 A;  2ECJ A;  4R7E A;  5FER A;  4AVX A;  2MIQ A;  1FP0 A;  2IQJ A;  2YUR A;  5LCW B;  2VPB A;  1WEN A;  3O33 A;  4QF3 A;  2KWJ A;  5EYA F;  2YHO A;  4YAX A;  3LQI A;  2DSM A;  2K16 A;  5SVX A;  3VK6 A;  2RI7 A;  3N9N A;  1WFK A;  2MKE A;  2RR4 A;  5SVY A;  3LVQ E;  3N9L A;  3U5P A;  2LGV A;  3T6R A;  4N3W A;  3U5N A;  1DCQ A;  1HYJ A;  2EGM A;  2QIZ A;  4OGC A;  5AIU A;  2B0O E;  3C6W A;  2YHN A;  3N9P A;  2FUU A;  4R8P K;  2LRI C;  5B8D A;  4GNF A;  3ZVY A;  3MDB C;  2CSZ A;  2H0D A;  4UP0 A;  5G0F A;  4V3K C;  2LGL A;  3ZPV 1;  2L0B A;  4ZQL A;  3O37 A;  2C2V S;  1MM3 A;  5KH9 A;  3L1Z B;  1Z6U A;  2CON A;  4QQ4 A;  2CSV A;  4YC9 A;  2LN0 A;  3DDT A;  2KIZ A;  4XI1 A;  3U5O A;  2FSA A;  1JOC A;  4W4U A;  2BAY A;  3L11 A;  5SVI A;  4LKA A;  5B77 A;  1CHC A;  2F6J A;  4FK5 A;  3E2D A;  2IDA A;  4GB0 A;  2KFT A;  4L7X A;  4MSX A;  3KV5 A;  2MT5 A;  4WA6 A;  1VD4 A;  3PLW A;  2XOC A;  2E6R A;  3MHH A;  2EXU A;  1WEQ A;  1Z60 A;  5SVI B;  3H7H A;  2VPD A;  4A4B A;  2PNX A;  2JMI A;  4PTB A;  4WZ0 A;  3HTK C;  5C13 A;  4NN2 A;  3M99 A;  2L43 A;  4MVT A;  2LXH C;  4GNG A; 
#chains in the Genus database with same CATH homology
 4S3O C;  2ZET C;  2MNZ A;  3DQV R;  5D1M B;  3EB5 A;  1WEM A;  2K4D A;  1WEO A;  2ECN A;  4LLB A;  2LGK A;  2JRJ A;  5JG6 A;  5TDR A;  2VPG A;  1WGM A;  4IC3 A;  2ECV A;  1JM7 A;  4B86 C;  4BHW A;  1RMD A;  2Y1N A;  5G04 B;  3RTR B;  5LKX A;  3IHP A;  2D8S A;  2HYE D;  2MD7 B;  2YUC A;  5B76 A;  2MA6 A;  1ZBD B;  2ECT A;  4O64 A;  3ZTG A;  4A0C D;  3KNV A;  2CKL B;  4ZDT A;  1IYM A;  3HCT A;  4S3O B;  2VJF B;  4LJN A;  4GND A;  3SOW A;  1X4I A;  3QZV A;  2LGG A;  4A4C A;  5KH7 A;  2MNY A;  3DPL R;  4AYC B;  2YW8 A;  3LQH A;  1X4U A;  3LRQ A;  1WE9 A;  3RPG C;  3N9Q A;  4GNE A;  5LKU A;  3U5M A;  3FL2 A;  4FO9 A;  3O35 A;  2AN6 A;  4Q6F A;  4QF2 A;  2LV9 A;  4YBM A;  4WZ3 B;  5I3L A;  3L1X A;  4N4F A;  5AIT A;  3V43 A;  5FB1 A;  2F42 A;  2L75 A;  2EGP A;  3KQI A;  4UP5 A;  4TKP B;  2NAA A;  2XB1 A;  2YQM A;  1U6G B;  4P5O B;  4FJC A;  4UI9 B;  1WES A;  4AP4 A;  2K1J A;  3ZYQ A;  4WZ2 A;  2CT2 A;  4C9Z A;  5H1T A;  2KWN A;  4AUQ B;  2M6M A;  5B75 A;  1HYI A;  4B7Y C;  4R2Y A;  2YYR A;  4BBQ A;  2M1R A;  1X4J A;  1WEU A;  2L80 A;  3RPG B;  2EA6 A;  1WIL A;  2FUI A;  1E4U A;  3M63 A;  2VP7 A;  4CCG X;  5B78 A;  2XEU A;  4IC2 A;  2ECI A;  5H1U A;  2RSD A;  2QIC A;  2YSM A;  5TDW A;  4I7D A;  2YU4 A;  1K2F A;  2YSJ A;  4PPE A;  2VPE A;  4L58 A;  2LQ6 A;  2KE1 A;  2KGI A;  2JMJ A;  4LK9 A;  4A49 A;  4YBS A;  2KWO A;  5LKT A;  2ECG A;  4I7C A;  5B79 A;  2UZG A;  2F6N A;  4YAD A;  3T7L A;  2M3H A;  2VJF A;  3M62 A;  3ZVZ B;  1FBV A;  4I7B A;  1V87 A;  3ASL A;  1XWH A;  4YAB A;  2L5U A;  2Y1M A;  2VNF A;  2LDR A;  1WEP A;  2M85 A;  5TBN A;  2HDP A;  2YT5 A;  2LXP C;  2G45 A;  2KR4 A;  2MUM A;  3HCU A;  1LDJ B;  1JM7 B;  4CA1 A;  2KRE A;  2C2L A;  3C5K A;  2MD8 C;  2KWK A;  3LQJ A;  4AYC A;  4YBT A;  3HCS A;  2E6S A;  2YRE A;  5DIN A;  2KGG A;  3O34 A;  3GL6 A;  4V3L C;  5DKA A;  5FB0 A;  2EOD A;  5LKZ A;  2DX8 A;  4F52 B;  4ZUX U;  5J3X A;  3EB6 A;  3ZNI A;  1VYX A;  3ZPV E;  2KU3 A;  2G43 A;  1F62 A;  3SOX A;  2CKL A;  2Y43 A;  1WEV A;  5D1K B;  2OXQ C;  1MM2 A;  4LAD B;  1N87 A;  3SHB A;  5C11 A;  4YAT A;  3NG2 A;  1G25 A;  2JMD A;  3N9O A;  1T1H A;  3PUR A;  5H9M A;  5G05 B;  5TAB A;  2QJ0 A;  1BOR A;  2G6Q A;  3GV4 A;  1LDK C;  2KYU A;  1DVP A;  2K17 A;  3SOU A;  2VJE B;  3O36 A;  3N9M A;  3O70 A;  2CSY A;  4X3G A;  2PUY A;  5FEY A;  3PHD A;  1WEW A;  1WEE A;  3PUQ A;  5TRB A;  5KH3 A;  4FIP A;  3I2D A;  1Z2Q A;  1WIM A;  2H0D B;  2VJE A;  3KV6 A;  2MA5 A;  5H1V A;  2ECW A;  5D1L B;  1VFY A;  2YQL A;  3O7A A;  3MHS A;  2I50 A;  2ECJ A;  4R7E A;  5FER A;  4AVX A;  2MIQ A;  1FP0 A;  2YUR A;  5LCW B;  2VPB A;  1WEN A;  3O33 A;  4QF3 A;  2KWJ A;  5EYA F;  2YHO A;  4YAX A;  3LQI A;  2K16 A;  3VK6 A;  2RI7 A;  3N9N A;  1WFK A;  3N9L A;  3U5P A;  2LGV A;  3T6R A;  4N3W A;  3U5N A;  1HYJ A;  2QIZ A;  5AIU A;  3C6W A;  2YHN A;  3N9P A;  2FUU A;  4R8P K;  2LRI C;  5B8D A;  4GNF A;  3ZVY A;  2CSZ A;  2H0D A;  4UP0 A;  5G0F A;  4V3K C;  2LGL A;  3ZPV 1;  2L0B A;  4ZQL A;  3O37 A;  2C2V S;  1MM3 A;  5KH9 A;  3L1Z B;  1Z6U A;  4YC9 A;  2LN0 A;  2KIZ A;  4XI1 A;  3U5O A;  2FSA A;  1JOC A;  4W4U A;  2BAY A;  3L11 A;  4LKA A;  5B77 A;  1CHC A;  2F6J A;  4FK5 A;  2IDA A;  4GB0 A;  2KFT A;  4L7X A;  4MSX A;  3KV5 A;  2MT5 A;  4WA6 A;  1VD4 A;  2E6R A;  3MHH A;  1WEQ A;  1Z60 A;  2VPD A;  4A4B A;  2PNX A;  2JMI A;  4PTB A;  4WZ0 A;  3HTK C;  5C13 A;  4NN2 A;  3M99 A;  2L43 A;  4MVT A;  2LXH C;  4GNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...