3I2DA

Crystal structure of s. cerevisiae sumo e3 ligase siz1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
286
structure length
280
Chain Sequence
TNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDETSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase SIZ1
publication title Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 59
structure length 280
sequence length 286
ec nomenclature ec 6.-.-.-:
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i2dA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3i2dA02
5J3XA 4YADA 4LADB 2KWOA 2MD7B 2KE1A 2VJEA 4GNFA 4YBSA 2JMDA 5B77A 3SOUA 3RPGC 3M63A 4GB0A 2ECJA 5D1MB 5KH7A 3RTRB 2YSMA 2LDRA 2YT5A 3DPLR 4NN2A 5C11A 5JG6A 2M6MA 3C6WA 4V3LC 3ZTGA 4V3KC 1FBVA 1XWHA 2XEUA 2Y1NA 4WZ2A 1F62A 2ECVA 2KWKA 2K4DA 3SOWA 3ZYQA 5KH9A 2LQ6A 2PUYA 2YW8A 2LGGA 4YATA 1MM2A 4UP5A 1ZBDB 2E6RA 4X3GA 2F6JA 4R2YA 4R8PK 3HTKC 3T6RA 3MHHA 1JOCA 2M3HA 4AP4A 2YYRA 3U5PA 2ECWA 5G05B 5LKUA 4A4CA 2KR4A 3N9QA 3C5KA 3MHSA 2I50A 4IC3A 2YQLA 5H1TA 2RSDA 4LJNA 2LXHC 3FL2A 2KFTA 3LQJA 4TKPB 2YU4A 4FK5A 2YURA 2L75A 4ZQLA 2MUMA 2LXPC 1FP0A 1VFYA 2LGKA 2MA6A 2VJFB 5KH3A 2G6QA 3ZVYA 2BAYA 2F42A 3O35A 3M62A 3O36A 4QF2A 2VJFA 2RI7A 2Y1MA 3VK6A 1JM7B 5G0FA 2VPGA 4UI9B 5TDWA 4UP0A 2VPDA 1JM7A 2EA6A 3KV5A 2FSAA 3GV4A 4ZDTA 1T1HA 3I2DA 2UZGA 2FUIA 3KV6A 4MSXA 4L7XA 5D1KB 2C2VS 2JMIA 4GNDA 1Z2QA 5D1LB 4S3OB 2MD8C 1WE9A 4O64A 4YC9A 3HCTA 3L11A 1VYXA 1BORA 4BBQA 1VD4A 5C13A 2CKLB 2KREA 3O7AA 2CKLA 4N3WA 4A0CD 4XI1A 2G45A 3O70A 5DKAA 2FUUA 4YAXA 4AVXA 4WZ3B 2LN0A 1WILA 2MNYA 4A4BA 2QICA 1WFKA 1N87A 3O33A 3HCSA 5AITA 4PTBA 1V87A 2CT2A 4GNEA 4B7YC 2KGIA 3L1XA 2EODA 1WGMA 2ECNA 3O34A 5FERA 2K16A 5FB0A 3HCUA 4R7EA 3QZVA 4Q6FA 2ECGA 2EGPA 2YHNA 2QIZA 1E4UA 4S3OC 3PURA 1Z6UA 4B86C 4AYCB 2M1RA 4A49A 2YHOA 5TABA 1MM3A 4AYCA 1WEWA 1WENA 5TBNA 1IYMA 4F52B 3LQHA 3EB6A 2OXQC 3L1ZB 2JMJA 2KWJA 1WEOA 2ECTA 2VP7A 4N4FA 5LKXA 4YABA 3LRQA 5FB1A 1K2FA 2YUCA 4C9ZA 2JRJA 3PHDA 5B79A 2VNFA 5G04B 4W4UA 5B75A 2HDPA 2LV9A 4LK9A 3N9PA 2PNXA 2KIZA 3PUQA 3N9MA 2KGGA 2LGVA 3ASLA 2G43A 3U5OA 4QF3A 2LRIC 2L0BA 2NAAA 3DQVR 5B78A 2DX8A 4IC2A 1CHCA 4LKAA 4AUQB 2CSZA 4BHWA 5DINA 2KWNA 3NG2A 4FIPA 4ZUXU 5H9MA 3V43A 1LDKC 2XB1A 1Z60A 5FEYA 4CCGX 3T7LA 2MT5A 1WESA 1WEEA 2Y43A 1U6GB 2KYUA 2YREA 4YBMA 4GNGA 1WIMA 4FJCA 5I3LA 2IDAA 3GL6A 2L5UA 3SOXA 4L58A 3LQIA 3N9LA 3ZNIA 1WEVA 5LCWB 5TDRA 2LGLA 3EB5A 3KQIA 4FO9A 4P5OB 5TRBA 5B8DA 3U5NA 2ECIA 4MVTA 2VPEA 1HYIA 2MIQA 3ZPV1 4LLBA 5H1UA 1WEQA 4I7CA 3RPGB 2E6SA 2MNZA 3N9OA 3N9NA 2VPBA 3ZPVE 1LDJB 5EYAF 3ZVZB 4I7DA 3KNVA 4WZ0A 4YBTA 2F6NA 5H1VA 2MA5A 3O37A 2M85A 2YQMA 1X4UA 5LKTA 2K17A 1DVPA 2AN6A 4WA6A 1WEPA 2L43A 4CA1A 1G25A 4PPEA 3IHPA 1X4IA 2C2LA 1X4JA 2ZETC 1WEUA 1RMDA 2K1JA 2QJ0A 3U5MA 2KU3A 5AIUA 2H0DB 3M99A 2HYED 3SHBA 1HYJA 2L80A 2D8SA 2CSYA 2H0DA 2VJEB 4I7BA 5B76A 1WEMA 5LKZA 2YSJA
chains in the Genus database with same CATH superfamily
4YADA 3ZFFA 4LADB 1MZ6A 2A71A 3AP5A 5HCBA 2W1WA 2KWOA 1SACA 1OHFA 2XL9A 2ZCWA 3MO4A 2ZGLA 2PLV2 5A3UA 2VJEA 1R64A 3CIHA 4FXGB 1GWMA 4KWKA 3H1WA 5FZ7A 2YROA 4Q4W3 4JHTA 1X82A 2DYCA 5A7PA 2WFF1 1ASJ1 4YW1A 2BWCA 3WVJA 2A73B 2ARBA 2RS11 3M63A 4GB0A 3TEXA 1G8WA 4MOAA 5D1MB 4CXWA 1DFQA 1QOSA 3LDKA 3RTRB 1TQ5A 1W9SA 3H7YA 2NMNA 1QMJA 1FXZA 3ZM8A 4A7ZA 4NIGA 3F2ZA 1C8NA 1PGW1 3SXWA 4PT6A 1R1ZA 4X8NA 4AI2A 1E5SA 1VB2A 3K3OA 2WUHA 3FJSA 3PMEA 5FZ3A 2JG9C 1MVQA 3OBZA 4A41A 2M6MA 4JDMA 4V3KC 1SLCA 1GICA 2ZHLA 4AG4A 3S0MA 1W8UA 2V5DA 2VO5A 1VBC1 2XJVA 2XONA 2ZACA 4RFT0 1JOPA 1UD1A 4BQ4A 1JTZX 5CFDC 1X33A 4AHYA 5JR2A 1F4HA 2B46X 2DFBA 2YUEA 1HJGA 4E4DX 3AMHA 5A70A 1CAXB 1YRZA 3E97A 5T52A 2C9KA 4AVSA 4AEJA 2P2KA 2AEZA 2CRRA 4YVWA 1DBNA 5IVBA 3FFQA 2YW8A 5A3TA 1HRV3 4YATA 1EPZA 3SEPA 5L19A 3K46A 2IFWA 1O4YA 3O0WA 2GZWA 4PQ9A 3FWEA 4R4XA 1JZ4A 1NA1A 3JQWA 1NXMA 3K77A 3KQ4B 4WZCA 4UW6A 4QPGC 4AP4A 1W6NB 4LXLA 2WAOA 1OOPB 3LFMA 1NUKA 4FPGA 4Q26A 4YVSB 1K5MA 1COV3 3TWIA 4EN7B 5A3WA 4DEVA 1DG6A 2JDKA 2YXSA 2DCZA 1WA4A 2G9GA 3OYWB 4RHV3 4OQ9A 4Q27A 4XHXA 1F5FA 1RUE1 2BNNA 4CE8A 4IC3A 5FZHA 2G43A 3AFGA 5FP3A 3WG1A 2P1BA 3ZN6A 4CPBA 1OFSA 4BCUA 5KHHA 5BNNC 1PK6B 1IPSA 3H3LA 4FQ4A 5A6ZA 2RSDA 5H1TA 2VTFA 4D94A 2WZR1 2RHPA 2LXHC 1EAH1 1VAKA 3C7GA 2OUJA 3GJAA 5F5QA 4W50A 3IBMA 3O5SA 4KMQA 2EIDA 2KFTA 5BNQA 4H3WA 2AH2A 1NAEA 4FPFA 2YU4A 4XVHA 4BQ1A 1JOJA 1GV9A 3VBFA 3Q8FA 2L75A 3CL1A 3JB8A 3WDVA 1VAVA 2MUMA 2LXPC 5FYMA 2IXHA 2LGKA 2VJFB 4MH0E 2ETEA 5LK5A 2HWD3 1DYKA 5L7OA 2G6QA 2WL1A 4XF3A 4K40A 2RMU1 3BIEA 5EIYB 5JPMB 4IEQA 5AFBA 2WFF2 1ASJ2 3JQXA 4ARXA 3ITQA 3R4SA 4Y24A 2RS12 4CDXA 4CDUC 4K3UA 4BYYA 1JM7B 1QJY1 2G1MA 3GNEA 3T2OA 3BGAA 1BQPA 5DAXA 2VPGA 3RQ0A 4V2VA 4UI9B 2JB8A 1KEXA 1VBD3 5FAXA 1AR93 4ZZ5A 3IN9A 4QXCA 1PGW2 2EA6A 1HB4A 1ZBA1 3KV5A 5FWJA 4Q4V1 1OQDA 1V6IA 1WA6X 4NHXA 1W90A 3GV4A 2O14A 2ZZJA 3NNMA 5EJ1B 1S2BA 4ZDTA 5LA0A 1VBC2 3AKSA 5DAVA 4OHYA 1IS3A 1OFNA 2VZOA 4GZ9A 1H0BA 1WCDJ 3NW4A 3B3QE 1LESA 3Q8CA 1RVF3 5K0UA 3ZFEB 3UNPA 4UF0A 4MGTA 4YW2A 1GOGA 2W95A 3IPVB 1QEXA 4OCTA 1O5LA 2PTMA 3KV6A 4HK8A 2DVDA 5FO8B 4QQ4A 2ZAAA 2VCAA 3LA7A 3IMNA 2JMIA 1P8JA 1DCQA 4BB3A 5C8WA 2BUKA 1BXHA 3USSA 5A6QA 4S3OB 2J22A 3LEGA 3LEMA 4XF4A 5I8SA 2VQUA 4EJRA 5CEHA 1RJ8A 2CWMA 2VM9A 1V6NA 4KH9A 5FBZA 1GQHA 3NQHA 1OA4A 1AR81 4OMCA 1D0HA 2A6ZA 2DUPA 4ASMB 4AFMA 4ZHNA 4YC9A 3HCTA 3VDDA 5HCHA 3L11A 1OQEA 1XE7A 4LHSA 5FPXA 4TZDA 2YG0A 2R32A 1KRIA 5D8AA 4NUBA 2RS51 4NR1A 1GNHA 4O9GA 4MX3A 4C8DA 1LENA 1RUE2 2WR9A 4IEPA 4XJ9A 3PU8A 1BCXA 1HIXA 5C13A 3EQEA 5LA2A 3WINE 4E9KA 2KXLA 1EYBA 2PFWA 1GZCA 1ONAA 2ZEXA 2ZGMA 1HQWA 3ZPOA 4AEKA 4HK9A 3VBSA 4LK7A 2ZMNA 2ZAHA 5E6HA 2WZR2 3DYMA 4LUMA 1LGBA 1MEC3 3VKLA 1QJU3 4GH4B 4RQPA 1EAH2 2DU1A 2JE8A 1JZ8A 4A45A 4N3WA 2H6CA 1UNBA 2Q8CA 4YZ2A 5AC93 1Z0HA 2VMEA 3I3QA 3OBAA 3POFA 4DXSA 1PM7A 3VKMA 1ST8A 2OW4A 1NQJA 2LTNA 2RDQA 4OZOA 3USUB 1QJX3 4YVWB 3U75A 1AJOA 5L7OC 3KT1A 3O70A 3UGGA 2YHJA 3WQ7A 1SEFA 2GSYA 3AYDA 2D6KA 4QQPA 4YRDA 2OWAA 2WZPP 2JDYA 2RMU2 5A3NA 2QICA 2DURA 4N4FA 4AF9A 2Q1FA 1WLDA 1F35A 1VMJA 1PO13 3KM5A 3O33A 4PQQA 1QJY2 5FMOS 4EN8B 4NIDA 1V87A 2Q4SA 3VUOA 4PTBA 3GDBA 3PHMA 4AYUA 1ZRCA 5C70A 3L1XA 1FPN1 1ZBA2 2C9AA 2WAAA 3AKPA 1PZ9A 3CJXA 4S2FA 5E88A 4XMAA 4FOQA 4EN6B 4Q4V2 3RZHA 4Q8KA 3DCQA 2VZRA 5IVYA 3JD73 1ZRDA 2VMHA 4UFJA 3DYPA 2ZEYA 5DN2A 4CP9A 1LHWA 2HWF3 3GZUC 1OPOA 4E4HA 2HKXA 1LODA 4XFFA 3QZVA 1PX3A 2VQAA 2VNVA 1UIKA 3KT7A 2BJSA 3NV2A 4OUSA 2VMFA 1W6MA 4LA3A 4IGPA 1TE1B 4FOWA 3IIIA 2EGPA 3LSEA 4QQ2A 2YHNA 2ET7A 3KDEC 1QY4A 1X36A 2Y34A 2BPA2 4P08A 2ZX4A 1K45A 1SFYA 4INDA 3VDDC 2MNGA 1Z6UA 1AR82 1WUVA 1YI9A 2OXBA 4EN9B 1WZXA 1DHKB 1ENSA 1I3HA 4FFIA 4A49A 1IS5A 2CSGA 1RC6A 2RR11 4UI9L 2YHOA 1ND3C 4GD4A 2XPJA 1QH6A 4QKBA 2E26A 2CGOA 4CUBA 2OA2A 4D6RA 3TN93 2VCBA 3E6DA 2RS52 2W1UA 3MW3A 4YM1A 5SV8A 4ZZ8A 1W0PA 4HLTA 1XYPA 3C7HA 1PHMA 1PIV3 5FPUA 4GAZA 5FPVA 5TBNA 2VH9A 1I5PA 2WNUC 4LBQD 3LOBA 2XOZA 3ZFGC 4GB31 5FLJA 1NLRA 1QQP1 2EGMA 5T50A 2HBUA 4GALA 4NWVA 2P3KA 1ACCA 1HKDA 2XKPA 3EB6A 3I59B 1W2TA 2EAAA 1Q8PA 4D6QA 1RMU1 2ZX2A 2GAUA 3U37A 5FXVA 4CDQB 2WA4A 2JMJA 1A8MA 4C90A 2BQPA 5G04L 1UU5A 3QLQA 5FY5A 2QQMA 5HBAA 1WEOA 1GP4A 1W6OB 3AZXA 4HANA 4XQDA 2ECTA 4JGYB 4AW7A 2IZWA 3HNMA 1X8EA 2WT2A 2OUHA 5LZ6A 1JZ5A 3C7FA 3QCWA 4XBQA 4GKXA 4HKLA 2J1RA 2RM21 2EA7A 3WP3A 4C9ZA 4L97A 2BNMA 1A78A 2QJVA 4HKWA 5F9TA 1F31A 4N53B 2VNFA 1VIWB 2P6CA 2LW8A 5FPAA 2BP6A 5GKAC 1Y4WA 1OA2A 2J1TA 4JQRA 4SLIA 4XEZA 4Y22A 1V00A 4B7KA 4ORFA 4BXFA 2JKBA 3ACGA 4ZU5A 3N9PA 4KBZA 3K4DA 5A32B 5D8AB 4W4ZA 2VC9A 1YFUA 3PU3A 2XOCA 4NJ4A 1FPN2 4XJUA 4W6XA 5GLZA 4ZKTB 2Y6JA 5H9SA 1JBCA 5A7OA 3WDTA 4MHUA 5KXCA 2Q1ZB 4Q2FA 5GM0A 1FOD1 4CDWA 2KGGA 2LGVA 3IB3A 1MS1A 4XYXA 1QXJA 4Z2WA 3BTZA 1O3QA 5GALA 1F5JA 5C6CA 1IS4A 2CU5A 1STMA 2VW1A 4HVQA 1VPHA 5DXDA 3H1MA 1OI6A 4AQ6A 4LHKA 4J25A 3DQVR 4CUCA 3LVRE 2DX8A 4RGKA 1VE0A 4I09A 4PBOA 3ZMNA 4LKAA 5SVIA 2XHNA 2QFEA 5IK5A 2Y6HA 1G9DA 4Y1XA 3LD8A 4BHWA 4AHZA 5JXGA 3R4DB 1REFA 1WCSA 5J7MA 1J84A 4IE0A 3QACA 4KL1A 1FMD3 1KITA 3A21A 1W0OA 4D0QA 3HN1A 2EIBA 5LBFA 3VGIA 1W8TA 2ZX1A 5JOYA 1A34A 3V43A 1LDKC 5JSPA 1AZDA 4JRAA 1LGNA 1Z60A 3IAPA 3KHBA 4IETA 2RR12 4UT5A 1C57A 5A7WA 4FT8A 4NIHA 2YC4A 4QMAA 2K2SA 2VOVA 1MQTA 2ORZA 1JHNA 1W6PB 3AM2A 5F2SA 3WQ1A 1WCUA 1WESA 4HT1T 3V64A 2ZPXA 2Y43A 2VCMA 2JDMA 4YBMA 2D6NA 1DIWA 5ANQA 5FV3A 4A7KA 2C1FA 2PN5A 4P9LA 1QHDA 1RUI3 1J83A 4V2WA 5I3LA 4GB32 5LCWL 2EAKA 3MUY1 1QQP2 3FLRA 1CAVA 3RRDA 4LNVA 4CCOA 2IDAA 1V9U1 2FD4A 1O5UA 1RMU2 2YBKA 3ZDVA 4A2UA 1RUG1 2GU9A 1U12A 1NLQA 3SOXA 4CU7A 4L58A 4COYA 3N9LA 1YUDA 1VBA3 3SISA 3ZNIA 3GBGA 2ZJCA 4A7YA 1WEVA 4W8JA 1ZZBA 2R16A 1ULPA 2OQ7A 4RS5A 4ISRA 1MS5A 4UW3A 2XQRA 4YWAA 3C7EA 4MGZE 2C0ZA 3FMGA 1XNDA 5JPNB 3JUEA 3NJXA 3KQIA 2RM22 1CPNA 2YGMA 4YZ4A 4LQRA 4H7MA 5FZ4A 5TRBA 2UU8A 2WSUA 2VECA 2XBO3 4MVTA 2RDRA 2MPFA 4E4SA 5HV4A 4P02B 4FTSA 3HPNA 4LLBA 4LBQA 1WEQA 1XNKA 4U36A 2BZDA 4CDWC 1V70A 1W0NA 3AB0A 3POGA 1C8M3 3N9OA 3RYRA 3PUAA 3DPRC 5ABJA 3ZPVE 5I8YA 4Y26A 1LDJB 1FOD2 5FZOB 4I7DA 3J7HA 3LPFA 1R081 5T3NA 3KNVA 4RHV1 2A3XA 1JUIA 2JE7A 4PIYA 5GLWA 5A7SA 1SDDB 5LASA 3VHPA 4KWUA 3W21A 5JZGC 3UKTA 3WT3A 1ODMA 1XE0A 4FPYA 4K21A 1K42A 2GMPA 1Y9MA 2W94A 3PJYA 4KQ7A 5FP9A 1A8DA 2R071 3V0BA 2RS31 2VZUA 2XR4A 4WVWA 2LALA 3MFCA 4DINB 5CFCC 3GHMA 3O37A 1XNBA 2PHFA 3J7LA 4Y1YA 5F3IA 1J59A 1E57A 2ADDA 1S0BA 4B29A 3EHKA 4QGLA 3NV3A 1NCQC 5LKTA 4ARYA 2ZGKA 2J1UA 1Q8VA 1MQTC 1GZWA 3HR9A 4NE9A 3OTFA 4QX3A 2W3JA 1RUH1 1IKQA 2PXJA 5H9RA 1YQ6A 2QZ3A 5I8TA 3MZHA 2AN6A 5AVPA 5A7NA 4WA6A 4AI3A 1RTVA 3AMNA 1WW7A 4OUEA 3E1F1 3WG4A 2JDUA 3AVRA 2NPIA 5LBCA 4CCMA 3GBWA 2VOXA 4GXLA 4PPEA 2HWE1 3K2OA 3CJIA 3VBUA 3RZGA 3V0AA 3PTRB 2FZ2A 1PGL1 4QPIA 2SBAA 2BOIA 3MPPG 3KGLA 2ZMKA 3J7MA 1U5IA 2CGNA 5M0TA 1RMDA 3FFZA 1V9U2 1QDOA 1AR61 3SMHA 4N7UA 5IAXA 2ZHNA 5SV5A 3KD4A 3NO8A 2GNMA 1POQA 1RUG2 2VL4A 3ZXLA 1JYTA 5EQUA 4NIIA 3OUJA 5KR7A 2RJLA 3U5MA 4A6SA 5AIUA 4XJWA 4YG6A 2L9LA 4XF9A 5FXZA 3SHRA 1J58A 5C71A 5FWEA 4JC1A 4BQ3A 1DZTA 2QE3A 2XHKA 4XAEA 1B35A 1CAUA 3MICA 2CSYA 2PQQA 4N43B 2UWCA 3MLKA 2CYFA 4XQWA 4LIVA 1LOGA 1TME1 1CQ9A 1CIWA 1UX7A 4QQOA 4I02A 1GOFA 3NAPC 1YFWA 1NE6A 3D82A 5F7UA 5FZBA 5EWSA 4TYSA 4M01A 1MS0A 2ZX3A 2QBXA 3DKWA 4LBMA 4OVEA 2YBSA 4Q4Y1 1C1LA 1LNSA 3RJRA 4YBSA 3PVOA 3M3CA 1XU1A 3M7AA 1SG3A 4IE6A 5T5JA 2XVGA 2IUWA 3WNPA 3VBOB 5A1AA 3RPGC 1YNAA 1H6XA 2VGDA 4LBKA 1HN0A 4URTA 4B3NA 1ZNPA 2KA3A 1VBB1 5SVIB 1JW6A 2FMDA 3HAGA 1JOBA 1R082 1SPPB 2QQVA 2Y6FA 1H8TC 4RHV2 1W8HA 4YZ3A 3I54A 3RS6A 4EZHA 1CAVB 3AZYA 3WP5A 2HWB3 3DEMA 5GZGA 4FSJA 4ATFA 4CVUA 2VNGA 5FRAA 3ZTGA 3B9CA 1LAJA 4WBBA 5H9QA 1DQ4A 4YFZA 1XWHA 5JWPA 2R072 3APBA 1YJKA 2RS32 4XJ8A 2OYZA 5JIAA 3SLIA 3RMYA 3LJUX 3M3EA 4WZ2A 4D7TA 3O1PA 1R1A3 2K4DA 4P5YA 3ZYQA 2LRPA 2A3YA 1N47A 1RUNA 3T0AA 4XDQA 5LY2A 4EN0A 4RR3B 2J1VA 2PUYA 3C8XA 1RUH2 4EQVA 1CAXA 3CHXA 4HXCA 3BIWE 3A22A 1S0IA 2E6RA 3OBRA 4X3GA 1TNRA 4IE4A 3CZJA 4QX0A 3T6RA 4GJYA 4XETA 1CAWB 3VBUC 1JOCA 2P57A 1NX9A 3K75B 2M3HA 4QPIC 1OC1A 1GZTA 3M2MA 1XPWA 1DLLA 2HWE2 4BQ2A 3U5PA 1PGL2 4QKDA 3KCCA 3AZVA 2D3PA 2QQIA 1VBD2 3LCPA 1VP6A 3IMMA 1W6NA 2OS2A 4DUVA 5JOXA 3AP7A 2Z69A 1OOPA 3JCIA 4IV3B 4BA6A 5FP4A 2ZGQA 3GCXA 1U5ZA 5D1IA 5FYZA 3ZSMA 1AR62 4YVSA 4FPKA 3IZOA 3OB8A 2I50A 1KS4A 1UMZA 3AYCA 2RE9A 2Z79A 2YQLA 1FATA 3ZMOA 3OYWA 5APAA 3WW3A 2GDFA 1B35C 4Q29A 4Z1VA 5KC6A 4LJNA 2RVAA 3S57A 3FL2A 3GM8A 1PMJX 3AL6A 1O3RA 5DZEA 1KDKA 1N1TA 1PK6A 3AK0A 2EF6A 3KMHA 4NHYA 4AR2A 5CADA 1F9KA 3FM8C 3LQJA 3SUBA 4TKPB 1TME2 3SNMA 1YHFA 2YURA 4P9XA 4XC9A 5DMYA 4YFWA 3FLTA 4ZQLA 4HETA 2IC1A 3HVDA 1HN1A 1JYCA 2V09A 4L99A 4QB1A 4MLOA 4AGGA 1O6UA 5FYSA 1FP0A 5DAWA 3U14A 2W9XA 3NRUA 3KF5A 2D40A 1JU4A 4GJZA 4HSJA 2DUOA 4NMIA 4Q4Y2 4LT5A 1SHWB 3TOJA 4NPLA 5KHGA 2F42A 3LDBA 1Y3TA 4QF2A 5FKBA 2B45X 2W2IA 4PLNA 2H0BA 2VJFA 3DKQA 1VMFA 2B42B 4E2GA 1FV3A 2RI7A 2BERA 4KGGA 2JWPA 1VBB2 3WP6A 5JXHA 2OZ6A 3V0AB 1JYWA 3J7NA 4YM0A 2WABA 5TDWA 1DYOA 4BZ4A 3AP4A 5BNPB 1JM7A 3RGBA 5A3LA 2D3SA 3VD4A 2WN3A 4COZA 2W5FA 1OH4A 4Y20B 2XGXA 1FT9A 5JLVA 3VL8A 5C4WC 1T1HA 3U11A 5FZ6A 2WQZC 4BK5A 4NAMA 1W05A 3GF6A 1ND2B 4UXAA 2BW8A 4LBLA 5DUVA 1K5JA 4GWJA 2BBVA 1D4M1 2DV9A 4MXWB 4BQWA 4HFSA 4ZXEA 1ALYA 4AOCA 1KGYA 1QU0A 4AHXA 5F5IA 4MSXA 4UOJA 1OA3A 4COVA 4J1WA 4DS0A 4DIQA 2XXZA 2W87A 3JBG3 4LKFA 3ZFEA 4RGGA 1Z2QA 2KM2A 1UOFA 3IPVA 5A3OA 2J42A 3AMMA 3T1MA 1DGRA 4F83A 1OVPA 1YWKA 4YZ5A 5BNOB 1WE9A 2MD8C 4O64A 1RUC3 4BJ0A 4BPZA 1HDKA 4RL7A 4AI1A 1ZRFA 1MS8A 2BVVA 4MGQA 1BBT1 3PVNA 1ZYBA 4P9WA 3W59A 3ZIWA 4YGEA 3OEAA 1VYXA 3H3ZA 4YVSC 4JKMA 4G9SB 3WNOA 1BORA 1X50A 1ULOA 3GCWA 3WDUA 2XJUA 2B9VA 1W99A 4CCNA 2JUNA 2VNRA 2VUCA 2W92A 1VB4A 2LUWA 2XL7A 4HSLA 1REDA 4HZFA 4BBQA 3OGSA 4LHNA 1O4TA 2FDJA 2ERFA 1MS4A 2ARCA 3MHZA 1SCRA 2HDPA 4KBBA 4CU8A 2VULA 3ME2A 1IKPA 1VJ2A 1OD3A 4Q1RA 4QHOA 5DDJ3 3WD5A 3VBRB 1L7LA 3MIHA 3BCWA 1XQNA 3RVHA 1LU1A 3RZLA 4MGIE 5GJ6A 5D1KB 4PJYA 5CKQA 4GH4A 3TAYA 3ZYGA 2D5HA 1MZ5A 1AL23 1KDMA 4IGOA 1WW5A 2FUUA 4XDOA 4EROA 1HV0A 3B9IA 4R9CA 4E8DA 2E51A 2ZOEB 4J6GA 1CZTA 3USUA 4AGVA 4QX2A 4O65A 1E5HA 3POEA 2MNYA 3OD4A 2IXKA 4TN7A 4DY3A 3BYWA 4Y4RA 1N3OA 1GOHA 2JG8C 1YCIA 3B93A 4ISQA 3QH6A 5CAZA 4GNEA 2DCTA 2KGIA 4LMFA 2MEV1 3IWZA 4Z8BA 3O1MA 1RUI1 2GNTA 4S2DA 4JGZB 5FYUA 2Q30A 4BQXA 1VBE3 2EODA 2J1SA 1L7RA 2WNVC 5LRRA 5DZGA 5FERA 2V4AA 4AQSA 1UZYA 3VBHB 5D21A 1D4M2 5FB0A 2ZGRA 3HCUA 3OPZA 4M0NA 4CSWA 2E7QA 3IT8A 5F6KA 1VRH3 1DDLA 3HQRA 1H6YA 3AMPA 1DQ5A 4CEYC 2ECGA 1TMF1 4FAHA 1WMEA 1FI2A 3ZVXA 2HYKA 2CV6A 3R05A 1AYM3 1HQLA 5JSOA 4AVTA 1KFXL 1QDCA 2HH9A 2VMGA 4I0BA 4S3OC 4UFKA 4B4QA 4N9HA 4EYUA 1ODNA 1RUJ1 3N7KA 1APNA 5CNAA 3ZFFC 3FUQA 2ARAA 3LVQE 3QD6A 4AYCB 1OLQA 5FY7A 4K8FA 4IUGA 4N90A 1BBT2 1NZIA 3LA2A 4XUOA 5B2GB 3J8F1 4H55A 3T30A 4IEOA 1GWLA 4B4RA 1MM3A 3T3YA 4DPNA 1D4VB 1TG7A 2JD4A 4PCRA 2XOYA 2JDAA 2WQ8A 3WDXA 2X29A 4BLJA 2JG9B 3I2OA 3OGRA 5LA9A 1NCRB 4R8HA 4XF0A 1AXZA 3V56A 5HI0A 2LAUA 4XZUG 3O0XA 3LQHA 4FPCA 2YGLA 2ATFA 5CFDB 4TTGA 3LSDA 2A70A 2WT1A 4W65A 3AYEA 3E6CC 2XMLA 4XILA 2OXQC 3RJ2X 2LROA 4TXWA 1SFPA 4GH4C 3L1ZB 2PHWA 2KWJA 4N9IA 3I59A 3GALA 3KZ4C 2FFWA 2GC3A 3MW4A 4CDQA 4BMBA 3O7OA 2BGOA 4M4RA 3WXPA 4Z0RA 2QNKA 4YVWC 4YABA 4OMDA 2PAMA 4YM2A 1K2FA 5FB1A 1B09A 1W6OA 4KG8A 3VZKA 2DSMA 1PNGA 4JGYA 4YW7A 1POV3 3N7JA 4GQ7A 4HMZA 4XOGA 1YI7A 2B4KA 1NA1C 4FXKB 5G04B 2VZSA 4ZS3A 1UO9A 3SEEA 5B75A 2XP0A 1I5ZA 4JDOA 5LRSA 4YW6A 3UV9A 4ONUA 1PO23 4N53A 1UMIA 4LK9A 1UPIA 3AJYA 3PIJA 2MEV2 1Z7S3 1K5MC 1RUI2 2G4IA 1LEMA 3AXEA 2HYXA 4E2SA 4Q0QA 4FTBA 5T5PA 3ASLA 5LWBA 1HB3A 5A32A 3MV11 1H2NA 2I45A 5E1RA 5BNNB 5KXBA 1CZSA 4IXLA 1POV0 2YV8A 1AYN3 2QTWB 3T0BA 3U5OA 5FYHA 3CO2A 2VUAA 4YGCA 4QF3A 2L0BA 5FZ0A 3WW4A 5LB6A 1HRI1 3MF9A 1LOBA 4QWNA 4CXYA 1BVVA 2DVAA 4DB5A 1VFYA 2D6LX 4BHPA 4R9AA 1TMF2 3Q8EA 4S2HA 4RA0A 5FZMA 2RDSA 5F3GA 4JV4A 3OUIA 1PZ7A 2QQUA 2VW0A 4C1WA 4CCKA 1ENQA 1S0CA 1FV2A 2JECA 3DYOA 3VBFC 1RUD3 4BDVB 3NG2A 4ASKA 1RUJ2 2RR4A 3SCHA 5IYYA 1UU6A 2NMOA 5LATA 2VBDA 4XJZA 4AFCA 5FEYA 4CDUB 1RHI3 1NQDA 3HMYA 4XUNA 1D7PM 3J8F2 2VU9A 4XACA 4QX1A 5FMCA 5JR7B 5CBLA 4CCGX 5A7WB 4CDXC 2WC2A 4Y33A 5JMOA 1WEEA 1U6GB 5LBEA 4P5HA 4LORA 5F3CA 4LLOA 3TBDA 1IG0A 3A0KA 5FPZA 1W6PA 2XG3A 1WIMA 4GNGA 4FI9A 1WD3A 2ORXA 1OD5A 3ILFA 4K7JA 4E27A 4OQ8A 1RUF1 3GZTB 3S7IA 3HNYM 3LE0A 1C1FA 4AE2A 1MPXA 2XVLA 4BE3A 4UAPA 2L5UA 3ZSKA 3LFIA 1UY3A 1V6OA 1ZBE1 2R041 4IEXA 4JQTA 1AR73 3LQIA 1OF3A 5K0UC 2VR4A 5F37A 5FYIA 3WHTA 1CESA 3ZR6A 5LCWB 2WFPA 3M1HA 3VB9A 5JAXA 5TDRA 2XLAA 4QQHA 3PUHA 4AZZA 1XNCA 2RJ2A 3MEPA 2PLV3 4CU9A 2EXKA 4FFHA 5EPAA 4NRQA 1QKQA 2YU2A 4GMP3 3THTA 4DZGA 2JM3A 5B8DA 3U5NA 4XZPA 1R093 2JDPA 3ENRA 3B01A 4Z2AA 2V73A 3RYKA 3UK9A 4RSUA 3NSTA 4NROA 1W8ZA 4QM9A 5D8AC 2IQJA 3N9NA 1UXXX 2VPBA 2ZABA 4AQTA 1YXWA 3KS7A 3ZVZB 5AVAA 1BEV1 2VAUA 5IVCA 1BMV1 5GZCA 1XC6A 2UY8A 3CDZB 3M8LA 3MDPA 2EXIA 1LR5A 3VHRA 5FZOA 4LKEA 2VBBA 3P3NA 4ZXKA 1MBMA 4QAWA 5FYCA 1HRI2 3VBSC 5FXXA 3RWNA 1GU3A 2JX9A 2JENA 4K1YA 4BH9A 2D6PA 2W68A 3LQCA 4RQPC 5EYYA 4B1MA 4NRMA 5H1VA 3W5NA 1ULFA 2MA5A 1IHMA 3IDEA 3R6SA 3N36A 4LO8A 5F1RA 1SDWA 3CMGA 5CB7A 4HVOA 1EV13 3LB9A 1OQ1A 2VUDA 5C9AA 2GALA 1YIFA 3HQXA 4OGCA 5FLHA 3VZOA 3UESA 1J3PA 3HWJA 3ZO0B 4QB6A 3ON7A 1QOTA 2IWGB 4LPLA 2AGSA 3O1UA 1OLME 4KWJA 4YPJA 3RDIA 3ZX7A 3NKGA 1V6LA 5FCCA 1XNTA 1SLLA 1NE4A 2OQ6A 1UOGA 2QQJA 2XKOA 3ZKUA 4A6OA 2GN7A 4CP1A 5JMCA 1EUTA 1UYPA 4AQ2A 4UFMA 4BIFA 5BUVA 2TBVA 3FZ3A 3H8RA 3T4VA 3ZXDA 1BZWA 2WDBA 1K12A 2FCUA 2OX0A 1YFXA 2BFUS 3N7MA 3PLQA 4QT6A 4ZY9A 2E9QA 4AI0A 1C4RA 4CEWB 1W9YA 2O8QA 5LEJA 4O61A 4HG6B 4K8RB 5J37A 2C2LA 1RUF2 1X4JA 3NWKA 4YYOA 1CJPA 1UF2C 2JKXA 3CBNA 4R9DA 4WVZA 3RG0A 1KFUL 3T08A 1WEUA 4NOTA 2YFZA 3FX3A 2VMCA 3DL3A 3LF7A 3I97A 2QJ0A 2I07B 4OHWA 1HLCA 3RI8A 4GWMA 1DQ2A 1W9WA 3RSJA 1ZBE2 2R042 3WW2A 3WF3A 2H0DB 1PVC1 1UY4A 4RGAA 2PHRA 3IDBB 1GKBA 2B8MA 3E6BA 5A80A 2E63A 4UBHA 4K9SA 3S6PA 3MW2A 3W58A 2UYAA 4LA2A 4DRRA 3ZPYA 1UMHA 4YARA 2YY1A 5F3EA 4GIQA 3BVCA 4Y4YA 3ZYPA 2WS91 4DUXA 2VE1A 3OY8B 4I7BA 5LKZA 1OUSA 2YSJA 4B7EA 3PDQA 5JUVA 4N43A 2C24A 1ND3B 1JMUB 1YLLA 1BK1A 1AJKA 2KE1A 4GNFA 2WFF3 1ASJ3 2BTVC 4LBJA 4PDWB 4Q8LA 5FY8A 2RS13 5L36A 1QIQA 3U78A 4Y1ZA 4IV1B 4D7YA 2JMDA 4DY5A 5B77A 3U10A 1SLTA 1U0AA 2P34A 5C8CB 3KGZA 3OF1A 2CDPA 4IEZA 4PI0A 1W8WA 2WYFA 3O0VA 5EFUA 2IVJA 5EP9A 2OKXA 4CUGA 3SOUA 2WNUB 4FPOB 2VTXJ 4LKSA 5IVJA 4WVVA 5A3MA 1BEV2 4Q4W1 3ZFGB 5J48A 4KG0A 1URXA 3FBMA 4FCAA 1BMV2 1EUUA 4YG3A 2DVGA 3VBOA 2YT5A 1QXRA 4P14A 1BK0A 3TB0A 3DPLR 1W06A 2AACA 4PF1A 5C11A 1F8VA 2PHXA 1OLMA 1VBC3 1G7YA 1SPPA 3KF3A 4XCBA 3HJRA 3AMQA 3OEBA 1F15A 4OHXA 4UFIA 1MZEA 3GYDA 3H7HA 5A1LA 4K20A 3BI3A 1YQCA 5IWFA 4Q1PA 1IPKA 1GR3A 2Y1NA 4Z0OA 1GUIA 3FL7A 2VZPA 4MXVA 3NJZA 1O59A 2VOTA 4KU7A 5FUNA 4AVCA 3Q1DA 3UT0A 2ECVA 2KWKA 4NO4A 1W2NA 4AXOA 1SFNA 1WBLA 1AUYA 1AL21 4I3PA 5IVFA 4XBNA 3WCSA 2WN2A 1CX4A 2Q8DA 1H1IA 5FQ0B 5A33B 2JXAA 3J9SA 4OUMA 3RWKX 3ZYHA 3BTYA 4QXKA 1MM2A 4WM8B 3DXUA 3I8TA 3KVAA 2Y64A 3H42B 4MGKE 4FOYA 4MO3M 3HBKA 2F6JA 1LRHA 4MZUA 2PYTA 4RR3A 4AL9A 4MHRA 3HTKC 1HRV1 4LTAA 4L2NA 5DQ0A 1WW6A 2JB4A 3BU7A 4HONA 4TLGA 3ZN5A 5LA1A 2YYRA 4BWOA 2ZGPA 1W2UA 2PA7A 5FPBA 3ETQA 1LHUA 4FPLA 1CAWA 1UU4A 3NV1A 3PVEA 4XFIA 3S30A 1I6XA 3V65A 2CDOA 2QQOA 4BISA 4A4CA 2VQ0A 1BYHA 2KR4A 1W8FA 3CQOA 5KWRA 1O8PA 5K4LA 3MGUA 2CRWA 1COV1 1Q3EA 1HJFA 1DYPA 1LOCA 2WZR3 2ZGOA 3H7JA 4M00A 4IV3A 3VD5A 4DEQA 3N7LA 1EAH3 1PVC2 4YM3A 5FIXA 3U07A 2E6VA 4YZ1A 3H1YA 1Q5OA 4LJHA 2VCCA 2EXJA 3R0RA 1DCSA 2P3JA 4ZPIA 1H8VA 4JTOA 3VZLA 5FYVA 2XJTA 1H2MA 1AF9A 4BQYA 1ENRA 2VZTA 5CYYA 2R063 1TVGA 4N8MA 5FMBA 2WS92 4N43C 4FVVA 5C9AB 2GMMA 1S1AA 5I93A 3DDTA 1IQAA 3DWDA 2IXIA 5FP7A 1VALA 2ZGSA 2RMU3 3EO6A 3U4SA 3E5XA 3VD3A 1WD4A 1KD7A 4IW3A 2MA6A 3ACFA 3POWA 2X5IB 2CSVA 4Q0PA 4BQ5A 2ZGTA 1W2AX 5B4XA 1WLTA 1QJY3 3ZVYA 2MKEA 5FREA 3H0OA 5HCFA 1S0EA 3M62A 5FZ8A 4LBNA 2JDHA 1S0GA 2HWD1 3OBTA 3B7MA 3GBFA 2PHTA 3ATGA 4Q4W2 5GZFA 1ZBA3 2P5BA 5I0UA 4EWAA 1GBGA 1UZVA 4Q4V3 4CRQA 4K6BA 2DCKA 3O14A 5CZKA 2IXCA 4AEDB 4CA9A 4PF5A 2DU0A 2UWAA 2Y60A 2ENRA 1O91A 5I0SA 3B69A 1DF0A 4P9IA 4ES9A 1VBD1 2D44A 1AR91 3WDWA 3RZJA 1QJZA 5BNPA 3WNMA 2YZ4A 2BWAA 3I2DA 3AX4A 4HPKB 4WVMB 3LDRA 4URAA 5IFPA 2UZGA 2XVKA 2ZA9A 4DXZA 5C3QA 3TYJA 4WM7A 4Y20A 5FMOL 2WZ8A 4JDNA 1LHVA 5DZFA 2G19A 1HV1A 4Y5Z0 1ND2A 3KQRA 4AVBA 3HBZA 3ZN4A 2JDZA 4RS5C 1AL22 3W9AA 4MXWA 5F5AA 1YEWA 1QNYA 1OURA 2XWBB 3FBYA 3JB4C 1RVF1 3H8UA 4KU8A 4Q0VA 4GNDA 5IW0A 1W6QB 4AFDA 5D1LB 1AR83 4RR3C 3I4IA 4B4PA 5IVEA 1WCQA 3T2QA 2X53S 3WEZA 4W6YA 5IHRA 4YW4A 1JS9A 2FHRA 1POV1 5FO7B 1IS6A 5FZLA 2DUQA 2D5FA 3UL2A 1HRV2 4I2OA 2GP3A 2QZ2A 1FX5A 2K46A 3DPRB 1JN2P 2EVXA 2Y38A 2RS53 3M4FA 1YC61 3NNGA 4GKYA 4JVAA 4DOUA 5BNOA 1CGPA 4S2GA 1H2LA 3OJBA 4HKOA 3H8OA 1S2KA 5ABJC 4CUAA 4CXXA 3WG2A 4PHZA 5SVXA 2WO7A 4XFBA 1AX2A 2JICA 2WWUA 1JODA 4IV3C 3WP4A 5J3UA 5FZDA 3POJA 5A6YA 1COV2 1XYOA 2VVEA 4AHWA 5JZGB 3ILRA 5IAVA 2W47A 2ZKLA 1VD4A 3PVBB 4D6SA 5FFOC 1NOVA 2XUEA 3D0JA 5EXOA 3WUCA 3PL0A 2CKLB 4AGRA 3VKOA 3HIFA 2H0VA 4QU1A 5FZEA 1OXCA 5CFCB 3DECA 1MR5A 2VNOA 4XFCA 3C2UA 4AAXA 3MLJA 3HT2A 4A0CD 1S55A 2A3WA 1H1AA 5FOBB 1TEIA 1NCQB 4PBPA 2G45A 1MEC1 2QCSB 1QJU1 3BTAA 2XJPA 3VBRA 5ACA3 2R0HA 1T6GC 3T2PA 2PQSA 4LE4A 5AC91 2BGCA 2GC1A 2YB7A 1WMFA 4XPVA 3JXSA 4H9DA 3LWCA 4QX8A 3UGHA 1A6CA 3VHOA 1ULDA 2VZ1A 1QJX1 3LEKA 1H2KA 2D6MA 3RI9A 5CA6A 2WRAA 3WQ0A 5GLVA 1REEA 2WIIB 3MV01 3VZNA 2HWD2 2P37A 3AKRA 3VDAA 4FBFA 3HCSA 4ITCA 3TEWA 1FPN3 5AITA 5FTTC 4AI9A 4AFAA 2VW2A 1YJLA 2ZHMA 3AFKA 1PO11 3CJIC 2R0FA 4AFBA 4XDPA 5JSRA 2PHLA 4B7YC 2A6VA 1CD3G 4LOTA 1SLBA 1N3QA 1UQXA 2K9ZA 5HXMA 1WGMA 2A75A 5F39A 3RPQA 4O62A 5CU1A 2ECNA 2PHDA 1XSRA 3FHQA 3BOPA 1AR92 2JE9A 3OOXA 1KJLA 4F7ZA 1N1VA 3OGGA 4JGZA 4C1XA 1CR7A 2V72A 3UGFA 5T5LA 4B1LA 1X9TA 4B8EA 3RZMA 3JD71 3DXTA 5F8PA 5A7QA 3VBHA 4CCCA 2VTXA 2YYOA 3K4ZA 5F5CA 2HWF1 4I01A 4DQAA 2D43A 3NAPB 1RVF2 1GLHA 1QJEA 3D5OA 4CU6A 3HOBA 3I2JA 4OYUA 1WBFA 1RXGA 3ES1A 2VQTA 3LAGA 2OPKA 2RR13 4RFRB 2VMDA 4Y3OA 3U1XA 4BXSV 3I2FA 2Z5WA 1AL0G 1ZZ7A 1R091 3UKVA 4M0HA 1BLZA 2B5HA 2QQWA 5BXXA 5TABA 2VZQA 2YPDA 4BMEA 5JI9A 1C5IA 1CVNA 4AYCA 3URFA 3OCPA 1H8TB 1LTEA 2ET1A 4XABA 4XFAA 2NLRA 5JVVA 5CKMA 1WEWA 2H6BA 3KSCA 3SQOA 4GB33 2BGPA 1QQP3 5I0DA 2HWC3 4LO7A 3TN91 4O9EA 4FP3A 3WNXA 4F52B 2WKKA 1IYMA 1O7FA 1Y43B 1W9TA 2L7PA 1PIV1 2O0OA 1AXYA 5C3RA 2JG9A 1UZZA 5E16A 3VN4A 4C91A 1NCRA 1GZ9A 2EXUA 3ZYBA 2K0GA 4WM7B 3UJQA 1UZWA 4CPBD 1SBDA 5CFDA 1MEC2 1QJU2 4XE9A 3I2IA 5FK7A 3HD8B 3SKJE 1WMDA 1EV11 3WHUA 3K3NA 3MYXA 3ST7A 3WF0A 5AC92 3I3MA 2VP7A 3PJQA 4Q0SA 2QQLA 1NLSA 1Q8QA 1U5XA 2VZVA 2NP0A 3LRQA 3M3OA 4W6WA 1ZX5A 1QJX2 4P9YA 3HN3A 1E5RA 2JRJA 4Y5TA 2HEWF 4W4UA 1SLAA 3H8XA 1LEDA 4IGQA 1GQGA 3QBQA 3FC0A 1HQNA 1HW5A 2E31A 2ZHKA 4IESA 1FOD3 4DO0A 1PO12 4Q4X3 2WWSA 1LCLA 3MIFA 2R30A 5H9PA 1ZRIA 3I3BA 1XXNA 4CTEA 1IZ3A 3AP9A 1WGPA 3PUQA 3N9MA 1OOPC 4JGZC 4LITA 4MG2A 3IKWA 2C5DA 2HEVF 2YU1A 1DQ0A 3C3VA 3NMBA 3NNLA 3VDCA 3A0NA 1GNYA 3VBHC 5J98B 3OG2A 2Y6GA 4HN0A 2LRIC 3E2DA 3QOPA 2NAAA 2QVSB 1BVP1 3NNFA 5BNNA 3JD72 5B78A 4IEWA 2KD7A 1O8SA 3NKTA 4XBLA 3SCGA 1W3VA 2G9ZA 2G9FA 2HWF2 4AUQB 5FJHA 1PMHX 1PK6C 3MFAA 1HB2A 2WT0A 3ZXFA 3INAA 1QXPA 1MS9A 5DUWA 5KC5A 4M4PA 4X6RB 4Y1UA 5DINA 2J1EA 5KHJA 1IQDC 4FPEA 2X05A 5L9RA 2E61A 2KWNA 3A7QA 5FYYA 1H30A 4FIPA 3CF6E 1Y7BA 4FFFA 1OVSA 3MIBA 2VUJA 5CKNA 2MHFA 4KNCA 2B9UA 4DFSA 3I2GA 5H9MA 3PUIA 4ZU4A 4OHZA 2EICA 1W8NA 1FMD1 2XB1A 1R092 2PELA 5FUIA 1XE8A 3H9AA 4YGBA 1RYYA 3T7LA 1JUHA 1OSGA 2SLIA 3W20A 3PIGA 1W28A 3O1RA 2ZGUA 3KB5A 4IQPA 4M3CB 3WCRA 4CDUA 2YREA 4AWDA 1QOOA 5C3SA 1X7NA 2AENA 3TN92 1M4WA 1V9U3 4UWDA 5C4WB 1NCRC 2Y0IA 1RUG3 3AJZA 1PIV2 4DNYA 3U0ZA 4CYDA 3T9KA 2XWJB 3FEHA 4BU2A 2ZEZA 4OHVA 1OLRA 1XOYA 3GZAA 2WYSA 4XAAA 4QX5A 4YW3A 3WR0A 1A3KA 3ALQA 3VD9A 3MLLA 4AK3A 1EV12 2VVDA 2D97A 4QKFA 4YLZA 3AVSA 5IUQA 1Q8SA 2UWBA 4LO6B 1VBA1 2DTYA 3BPZA 4UBGA 1UYZA 3AYAA 5DABA 2R1DA 5T55A 3ZFEC 3EB5A 4XQ4A 1LOFA 1OUXA 1UZ0A 4WZFA 3ZSEA 3T2TA 2Z2SB 1D0GA 1D2QA 5FXWA 2VPEA 1W39A 1HYIA 2P6HA 3ZPV1 1DGLA 1E5IA 5I91A 1UCXA 1KJRA 2FDFA 4AAPA 5GZEA 2C26A 2XBO1 3SCFA 4LOSA 4I7CA 1H9WA 2JDNA 2BOJA 1R083 2MNZA 3EYPA 4QXHA 1RGSA 2D3RA 3WF2A 3WX5A 1Q8OA 2DCYA 5EYAF 4QQLA 3WF1A 1DLCA 1H1MA 3NJYA 4JZRA 3W5MA 2W52A 1C8M1 1ZZCA 2DBIA 5LEKA 4YBTA 2VXRA 3O1VA 3S5QA 2F6NA 1GWKA 3KHCA 1FAYA 2IVIB 2TUNA 4HN1A 3RZZA 2R073 3G7DA 5KXDA 2RS33 2WNOA 5K8SA 1RXFA 4QPWA 3WF4A 3MPBA 3D8CA 3VZJA 1AVBA 5SVYA 1EP0A 4UW5A 2R061 2NYYA 1JH5A 2VOKA 2Q1MA 3F95A 2IFRA 3LIGA 2C2VS 4D8MA 1RUH3 1ZA4A 3HQUA 3J26N 4XXAA 2Y8KA 4U2AA 2ARXA 2YQMA 2GN3A 1X4UA 2AREA 3ZXAC 2GP5A 2K17A 5HPOA 5FBJA 1FMD2 3THCA 4L92A 4CP0A 1DVPA 2AC1A 2JG8B 1UAIA 1UW8A 2W1QA 4KGQA 3AKQA 2XH6A 3Q9OA 2HWE3 1L7QA 4QPYA 4QPGB 1QWRA 3CEWA 4ZS2A 5JI7A 4FP2A 2WLPA 4PI2A 2PAKA 3S7EA 3UJOA 3IHPA 2WNVB 3FUOA 4IL7A 1WCKA 2X10A 3ZOIA 4NPMA 3FAOA 1AR63 5FZKA 2ES3A 1RUOA 5TSWA 1TNFA 1OKQA 5DAPA 4CEWA 4F3JA 2KKYA 2ZETC 4DUWA 2K1JA 3BU0A 2A5ZA 5D2AA 1X9PA 2YVRA 3VDBA 2WINB 4H7LA 4E4ZA 4CEYB 3FHAA 3VV1A 1FYUA 4COWA 3CU7A 2BBAA 3M99A 4LEJA 2VPVA 4NHKA 5EJZB 3DUIA 2HYED 1TME3 3SHBA 2L80A 1LOFC 3JUUA 1VBA2 4QDSA 5ISLA 3ZXEA 4KWLA 1PNFA 2D98A 3ZFFB 4Z07A 2H0DA 2QDRA 1ZA7A 1S4CA 5IK8A 4TWTA 2Y26A 2VJEB 2V4VA 1WEMA 4IE7A 4Q4Y3 2E32A 3VKNA 1AXKA 1V6MA 4I30A 5J3XA 2F4LA 4PIXA 3ZYRA 2V5YA 2J7MA 2ADEA 1UOJA 4OI1A 1FNZA 2W08A 5HV0A 2MD7B 3MIEA 3A23A 4CCLA 1H4HA 2XJQA 2E7AA 3LGRA 3OY8A 4NN0A 1ZVFA 4XCAA 4Y1VA 4QDRA 2BV4A 3THDA 2XBO2 1VBB3 1ND3A 1SZBA 2DDUA 4XIOA 5EJ3A 3ES4A 5F32A 5L73A 3THPA 4JRLA 4PDWA 3UETA 2Q5TA 1UY2A 1G6NA 4IV1A 3X29B 3E5UA 2ECJA 3JZVA 1WW4A 5C8CA 5KH7A 1SBFA 2YSMA 2LDRA 3ZXJA 1C8M2 1XB9A 2F17A 2ZZQA 2WNUA 4EWDA 4XF1A 4NN2A 5JG6A 1W9FA 3ZFGA 1NZCA 3WQBA 3M3IA 1HXS3 4Q5OA 5JDBA 3DGTA 1UX6A 3E5QA 4Q0UA 3T1LA 3WW1A 3C6WA 4V3LC 2AZ5A 3TNPB 3AZZA 2JIJA 1ZM1A 2F4PA 2QQPA 4D3WA 1FBVA 2XEUA 1BKZA 2HWB1 4E8CA 1G9CA 3IDAA 1MVEA 4JHZA 3D3AA 2R062 2VMIA 3MIGA 1F62A 1DQ6A 4EV0A 2OZJA 1SLIA 4CDQC 5ACA1 3BB6A 3SOWA 3L9JT 4L0PA 4KI5M 5KH9A 1AX1A 4AEMA 2JD9A 2LQ6A 1NA1B 2XB6C 4AI8A 2LGGA 1J1TA 4JGYC 1R1A1 5CVRA 4UP5A 1ZBDB 5K7PA 5CG9A 3AXDA 1N1YA 4R2YA 4R8PK 2NM1A 1GMMA 1U5YA 5FQ0A 5A33A 3MHHA 3KT4A 1K5MB 2VJXA 3ECQA 2PHUA 4WM8A 2AR6A 3L2HA 4F1PA 4F8AA 4CEWC 4N53C 3ILNA 2D7FA 4FQZA 3FLPA 3WDYA 3IDCB 2ECWA 1LECA 4FPHA 3WNKA 4FAGA 5G05B 5LKUA 1GNZA 1V0AA 3MF6A 3LKJA 4JAAA 5FY9A 3ZN6B 4XXPA 1CJDA 2DVFA 3FN9A 4GWNA 3N9QA 4E2QA 3C5KA 3H3UA 4L8QA 2HJIA 3KCXA 5E89A 3MHSA 5FOJB 4DMIA 2VOWA 2WLQA 3TEYA 4M3CF 1DGWX 1VMHA 2CL2A 3ZXKA 2WA3A 4GMP0 4NHLA 3U4XA 1JYVA 1Y9GA 1GFF2 2UYBA 2OVUA 3B00A 3PTYA 4G4FA 4RN5A 3VBFB 3FE5A 3K51A 3I7DA 1OH3A 3BALA 3O12A 3OGVA 1V6KA 2BEOA 2IXLA 4FK5A 2R49A 1RIRA 3SITA 5L7OB 4NHMA 2WO1A 3CLPA 3ZDSA 3R4UA 4FOVA 4IEYA 3BTXA 4GULA 5KH3A 4CDXB 3DF0A 4MSVA 3CKHA 4PDWC 4MYEA 1LHOA 2BRTA 2DF7A 1GYKA 2YC2A 3EBRA 3I3EA 5FYBA 4IV1C 4A3ZA 2BAYA 2A6WA 3O36A 2ZX0A 3O35A 5C8CC 1M06G 4MV2A 4XFHA 1C28A 2X5IA 3PUSA 2Z42A 1DZQA 1JYIA 2Y1MA 3PLWA 3VK6A 3P1IA 3QH7A 5G0FA 2HWC1 2UY9A 5FZ1A 3SKVA 3ETPA 3ZSLA 1UKGA 2WQ4A 4UP0A 1FNYA 3SH4A 1LOAA 1O3SA 2BVBA 2VPDA 4A4AA 4IE5A 3MBWA 3KWVA 3KLSA 5IK7A 1DGRN 1D4M3 2FSAA 3T4HB 2GC0A 1UIJA 4LO4B 2I74A 4AEDA 5K0UB 3B02A 4QB2A 4UF0B 5F2WA 5C5TA 1T6BX 1RJ7A 5FP8A 2HWB2 3ZYFA 4YW5A 5I0TA 2DWRA 1OKOA 3POBA 3PNAA 2QUOA 4OULA 3ASIA 5I0RA 4HPKA 2FUIA 1W8OA 2Q0AA 4WVMA 3WNNA 5ACA2 5J09A 2Y6KA 4UW4A 4L7XA 2A1XA 3RMXA 4Z92B 4FPJA 4LK6A 2QQNA 5FDBA 3ZYIB 4BIOA 3UYJA 2ZMLA 2R1BA 1R1A2 1F2NA 1Z78A 4IERA 4CCJA 4D7SA 3OPWA 4NVPA 1BBT3 1PM4A 2OIIA 3OPTA 4WM8C 3VDDB 2R6QA 3AL5A 3JBG1 3ELNA 1KS5A 3AC0A 1W6QA 4QHBA 3HNBM 1RITA 4OLLA 4DXTA 1TZOA 3HEIA 1ZREA 5BPXA 1RUC1 3IM0A 2W46A 3N35A 2W1SA 4ES8A 3CZUA 4Q4X1 3DPRA 4I0AA 4QHZA 1UL9A 2YDEA 5IJRA 1ULCA 1GP6A 2E53A 3VBSB 5FYTA 2N7GA 2FCVA 2NN8A 2B39A 4META 4PIZA 5A3PA 2C6SA 2FBEA 2VVFA 5HCAA 3D4KA 4RQPB 2J1AA 4UYBA 1H4GA 1G86A 4LHLA 1W04A 5BV6A 1IG3A 1OBNA 2ZGNA 1LOEA 4QD2A 5JZGA 1YYNA 5LY1A 2FD8A 2KREA 1MACA 3NV4A 1PX4A 3MDBC 1J3RA 3GJBA 3O7AA 2BDRA 2VD7A 2CKLA 3ORJA 3M7KA 1YQ2A 4P9JA 3HT1A 3M70A 4RYDA 5EV7A 1VR3A 2KKXA 4XI1A 2FZ1A 2P3IA 5DDJ1 3IIAA 2WJSA 3A4UA 5C9AC 5CFCA 1GANA 5DG1A 1NKGA 4K1ZA 1UY1A 5C3OA 3O47A 4B86C 4XUPA 4MGYE 5DKAA 1NCQA 3FJUB 3SC7X 4YAXA 3Q8AA 4AVXA 3IAQA 1GP5A 2EIGA 4R9BA 4WZ3B 5K3QA 2YFUA 3B5LB 3BODA 2X5IC 2ID4A 5FKCA 1O3TA 1WILA 3ACHA 4DRVA 2LN0A 2CY6A 1CX1A 4A4BA 3MI8A 2FDGA 3D6EA 3NNJA 4QDQA 1ULGA 3LA3A 3WZ1A 1WFKA 5G05L 1N87A 2MEV3 4XHBA 4C0BA 2CONA 4JCKA 2FDKA 1CONA 2CT2A 1UWWA 2HWC2 1OF4A 1HX6A 5FLIA 4XIKA 5K9YA 4L11A 2OPWA 5LK7B 4XW3A 4AEDC 5BYNA 2ZTNA 4NPRA 3WNLA 4CP9B 3L2YA 2XUMA 4XJAA 2EALA 5FZIA 4A3XA 4WV8A 1RUE3 5ANNA 2BNOA 3O34A 2M13A 2DCJA 2K16A 4O7XA 5DPNA 1UYYA 1VRBA 3UKNA 1VBE1 1US2A 5C7GA 2FCTA 2AEYA 2W91A 1J1LA 2UURA 3WLUA 1TMF3 1UY0A 1W6MB 2F6BA 1GQPA 1K3IA 3SH5A 5LW9A 4FTEA 1UYXA 4R7EA 3ACIA 2GC2A 2DFCA 4Q6FA 1IPJA 5J1XA 2W39A 3KCYA 5C5UA 3GZEA 4UFHA 1LU2A 3MIDA 4XUTA 1RUJ3 5BY5A 2DBNA 1Y9QA 2WO2A 4OI2A 1QH7A 1VRH1 3BOWA 3EB7A 1JHJA 2JJ6A 2QIZA 1E4UA 1N1SA 3PURA 3NAPA 1LB2A 3JBG2 1NYWA 4YNIA 1AYM1 2CAVA 3J8F3 2QKDA 1XSQA 2XJRA 3CNAA 3P5BA 5FZFA 3WY6A 5KHIA 1I1EA 2QQKA 2D93A 1MZFA 2Y0OA 5JCTA 1ZZ9A 3LIHA 1RB8G 2M1RA 1W3XA 1RUC2 3DV8A 5EHDA 3ZYJB 5FY0A 4Q4X2 3AKTA 1JZ6A 1N3PA 4MGSA 5GLTA 2VBPA 2E7TA 3RYPA 3BKZA 2WSVA 4HOOA 4NAOA 1BHGA 4GA9A 3ZLIA 1X8MA 2WO3A 3ZR5A 5CG8A 1H8TA 3VBOC 1WENA 2Y6LA 5FK8A 2D8UA 3JU9A 3ZXGA 2X09A 2A7AA 2DTWA 1RL3A 1L3JA 1I9RA 4N7IA 1C5HA 5HXVA 1YQ8A 3I2HA 5CIRA 3FANA 4A42A 3GXUA 3NL1A 3OGJA 5DAQA 1JZ3A 3H50A 5A1FA 5JOZA 4OZXA 1YIPA 5DDJ2 4ASLA 2TNFA 2XOMA 2YMZA 3EXUA 1G9FA 1GSLA 4M3CE 5LKXA 1KXGA 2JEMA 3J4UH 3P6BA 1ULEA 4P00B 4I0WB 5AFEA 5L9BA 2YUCA 2BYVE 5CISA 2WNEA 1DGWA 2EIEA 4A44A 4Y22B 5E8AA 1NY71 4C0HA 3PHDA 5B79A 4CP2A 1WMXA 4IEVA 3OUHA 2B7YA 4H2AA 2Z4FA 1SBEA 4LIUA 4QKNA 3T09A 2FDIA 1LGCA 4XMIA 1J3QA 1WKYA 3EMRA 4PLMA 3BN6A 2AYHA 4V1PA 1AX0A 4CDWB 1YFYA 2PAEA 5EZWA 2KR2A 2LV9A 2XLGA 4QGNA 4XTPA 2PNXA 4MUVA 2B0OE 1KQRA 3BPSA 3WG3A 2KIZA 4LULA 1PO21 4QM8A 3DN7A 1CN1A 2RV9A 1ENXA 1Z7S1 2YBPA 4NRPA 2X8KA 4I3GA 1HRI3 4IDZA 5JOWA 5KXEA 3LDYA 2D6OX 1DZRA 1CIYA 1VBE2 2VZ3A 2ZS6B 4MADA 4OFGA 4P9GA 3ACLA 4X6QB 5B4NA 2CHHA 3TNQA 1LULA 4GWIA 3O1OA 3T0DA 5DG2A 4QXBA 4JKKA 1EPWA 3WV6A 5IT6A 4IC2A 1AYN1 1PVXA 2CNAA 4LUKA 5FZ9A 1CHCA 4ZONA 2HBTA 3POIA 1W2OA 3KV4A 2HLEA 4J1XA 2CSZA 1UN1A 1G9BA 5JXIA 5J36A 3M3QA 4YGDA 1VRH2 4AVVA 3LEIA 3LPGA 2CWSA 4LE3A 5FZAA 1S0DA 1NT0A 4X8PA 4ZUXU 3POYA 1AYM2 2JIGA 4L9BA 4CZSA 2Q8EA 2R7EB 4EWEA 1UXZA 1IGOA 1MQTB 1XYNA 2BU9A 2WBKA 3EJKA 3I3DA 2O1QA 2ZEWA 3K48A 3KVBA 3VHNA 1RUD1 2FDHA 3I2KA 3NJVA 1V6JA 4RD7A 4D69A 5FZCA 4G3YC 4OI0A 3VZMA 2WWJA 2MT5A 4XUQA 3N3HA 3P3PA 5FY4A 1RHI1 2E33A 2KYUA 1RUF3 4XURA 1JZ7A 1LHNA 1IOAA 1C3HA 2GNDA 4NIAA 1JI6A 5DUXA 5JIUA 4FJCA 3RFRA 2TEPA 3Q8BA 4M3CA 4EZ4A 2AUYA 4QGMA 1SMVA 1S2EA 3S5AA 4UFLA 1JYXA 3ABZA 2ZXQA 3B94A 2GNBA 2FQPA 1HXS1 2LM3A 1ZBE3 2R043 1VLNA 2VXJA 1OPMA 2FMYA 5FUPA 2P17A 2PMWB 5BNPC 1G9AA 3GL6A 5C4WA 3OD0A 1T2XA 1YQ5A 3ROUA 1SCSA 1OT5A 4WM7C 4RS5B 5FPLA 2BFUL 1RINA 3AP6A 3NVCA 1SQ4A 2VG9A 2XDVA 4BK4A 4CCEA 5C3PA 1W03A 2W0XA 4ZU7A 1ND2C 5EYXA 2Y33A 2LGLA 4AVAA 1WWYA 1AR71 1EY2A 1LJ7A 3LZZA 2CGPA 1F4AA 1QNWA 3GHNA 1XJAA 4DXRA 4FO9A 4P5OB 1NY72 1QGLA 3ZKYA 3BUCA 4LBQB 1DQ1A 4FFGA 3O1SA 2GH2A 2I2SA 4LLFA 2ECIA 1ZZ8A 1PGSA 2XLFA 4H14A 2MIQA 1YO8A 4SBVA 5ABJB 2PLV1 3TRSB 5BNOC 3WOGA 3I49A 5H1UA 1DU3D 1NXD1 4GMP1 5FJKA 1BEV3 3G6JB 4OGEA 3RPGB 5B76A 2E6SA 2WZEA 1QF3A 1PO22 4R52A 4XFGA 3SH3A 3VLBB 5LBBA 1VAMA 4BM8A 1NG0A 4HL0A 4PLOA 3VKFC 1Z7S2 3RZKA 4WZ0A 4LBOA 4JTNA 4Y5SA 1Q56A 4TLFA 4HBNA 2DVBA 4QU2A 5FZGA 3KV9A 4LO5B 4NWWA 1O4ZA 3N4MA 2CAUA 1DP0A 3V0BB 1AYN2 3VD7A 1AHSA 4LKDA 1RMU3 3GGLA 4YSFA 5JXJA 1XNAA 4XTMA 2RDNA 5DUUA 5FR3A 3D0SA 2YC0A 1WLWA 1D2SA 1Q43A 3C7OA 3LOIA 4COUA 1US3A 2ZBJA 3WUDA 1H9PA 5T54A 5KBFA 3WSOA 3TEZA 4BLIA 3VBRC 1GZWB 2M85A 3FHIB 4ET7A 4EE2A 4JX0A 3OSDA 5IATA 5IFTA 1BJQA 2NZ9A 2OT7A 1CWPA 5L9VA 1RUD2 2RM23 4QX7A 2CTVA 1WLCA 2GH8A 2XJSA 2DJAA 1UPSA 5FY1A 1WEPA 2NQYA 2YPJA 5J96B 3CJIB 3VBUB 2Q8OA 4CCDA 3O1TA 2L43A 5T5OA 1RHI2 4CA1A 4QPIB 1S0FA 2JG8A 1XU2A 2ZKNA 3ZIXA 1G25A 5IVVA 5FO9B 1CZVA 4BOWA 5F6LB 3K4AA 2QDNA 3ZSJA 4HVRA 5GZDA 1X4IA 2LS6A 2P3YA 1JXNA 4QPGA 1JZ2A 5A6XA 3VL9A 1XRUA 1XBFA 2P4EA 4LR4A 1JU3A 1QJFA 1UKRA 3AZWA 1HXS2 2WNVA 2VY0A 4R4ZA 4YG0A 1PVC3 1CPMA 5ERLA 5IK4A 2C4XA 2RJKA 3POSA 5GLUA 1S0JA 1ZZ6A 1MS3A 2O8OA 4ATEA 2KU3A 1LKNA 2HEYF 1B35B 1CAUB 2IXJA 1JYNA 2ILMA 2A6XA 3PMSA 1PZ8A 1HB1A 2GMEA 1UOBA 2XQXA 5KHKA 1PMIA 2WS93 4TSVA 1HYJA 4OI4A 4Z82A 1AR72 4CEYA 4JKLA 5FMDA 3RNSA 2D8SA 4IEUA 2RG4A 3MUZ1 2A6YA 1ZRRA 1OMIA 5C33A 2EXHA
chains in the Genus database with same CATH topology
4YADA 3ZFFA 4LADB 1MZ6A 2A71A 3AP5A 5HCBA 2KWOA 1SACA 1OHFA 2XL9A 2ZCWA 2VJEA 2ZGLA 2PLV2 4FXGB 4KWKA 3H1WA 2YROA 4Q4W3 1X82A 2DYCA 2WFF1 1ASJ1 4YW1A 2BWCA 3WVJA 2A73B 2ARBA 2RS11 3M63A 4GB0A 1G8WA 5D1MB 1DFQA 1QOSA 3RTRB 1TQ5A 3H7YA 2NMNA 1QMJA 1FXZA 4A7ZA 1C8NA 1PGW1 3SXWA 1R1ZA 4X8NA 4AI2A 1VB2A 3PMEA 3FJSA 2JG9C 1MVQA 2M6MA 4JDMA 4V3KC 1SLCA 1GICA 2ZHLA 4AG4A 3S0MA 2XJVA 3SHRA 1VBC1 2ZACA 4RFT0 1UD1A 1JTZX 5CFDC 1X33A 4AHYA 2B46X 2YUEA 2DFBA 4E4DX 3AMHA 1CAXB 1YRZA 3E97A 5T52A 4AVSA 4AEJA 2P2KA 4YVWA 1DBNA 3FFQA 2YW8A 1HRV3 4YATA 1EPZA 2IFWA 1O4YA 3O0WA 2GZWA 4PQ9A 3FWEA 4R4XA 1NA1A 3JQWA 1NXMA 4WZCA 4UW6A 4QPGC 4AP4A 1W6NB 1OOPB 4FPGA 4Q26A 4YVSB 1K5MA 1COV3 3TWIA 4EN7B 1DG6A 2YXSA 2DCZA 1WA4A 2G9GA 3OYWB 4RHV3 4Q27A 4XHXA 1F5FA 1RUE1 2BNNA 4IC3A 3AFGA 3WG1A 3ZN6A 1OFSA 4BCUA 5KHHA 5BNNC 1PK6B 4FQ4A 2RSDA 5H1TA 4D94A 2WZR1 2RHPA 2LXHC 1EAH1 1VAKA 5F5QA 2OUJA 3IBMA 3O5SA 2KFTA 5BNQA 4H3WA 2AH2A 4FPFA 2YU4A 4BQ1A 1JOJA 1GV9A 3VBFA 2L75A 3CL1A 3JB8A 3WDVA 1VAVA 2MUMA 2LXPC 2IXHA 2LGKA 2VJFB 4MH0E 2ETEA 5LK5A 2HWD3 1DYKA 5L7OA 2G6QA 2WL1A 4XF3A 4K40A 2RMU1 5JPMB 4IEQA 5AFBA 2WFF2 1ASJ2 3JQXA 3R4SA 4Y24A 4CDXA 2RS12 4CDUC 4K3UA 4BYYA 1JM7B 1QJY1 3GNEA 1BQPA 2VPGA 3RQ0A 4UI9B 5FAXA 1VBD3 1AR93 3IN9A 1PGW2 2EA6A 1ZBA1 3KV5A 4Q4V1 1OQDA 1V6IA 3GV4A 2ZZJA 4ZDTA 1S2BA 1VBC2 3AKSA 4OHYA 1IS3A 1OFNA 1H0BA 1WCDJ 3NW4A 3B3QE 1LESA 1RVF3 5K0UA 3ZFEB 4YW2A 3IPVB 1O5LA 2PTMA 4HK8A 5FO8B 2DVDA 3KV6A 2ZAAA 2JMIA 3LA7A 3IMNA 5C8WA 2BUKA 1BXHA 3USSA 4S3OB 4XF4A 5I8SA 4EJRA 1RJ8A 2CWMA 4KH9A 1V6NA 5FBZA 1GQHA 1OA4A 1AR81 1D0HA 2A6ZA 2DUPA 4ASMB 4AFMA 4YC9A 3HCTA 3VDDA 3L11A 1OQEA 1XE7A 5FPXA 4TZDA 2R32A 1KRIA 5D8AA 2RS51 4NR1A 1GNHA 4O9GA 4MX3A 1LENA 1RUE2 4IEPA 4XJ9A 1BCXA 1HIXA 5C13A 3EQEA 4E9KA 3WINE 2KXLA 1EYBA 2PFWA 1GZCA 1ONAA 2ZGMA 1HQWA 4AEKA 4HK9A 3VBSA 2ZMNA 2ZAHA 2WZR2 4LUMA 1LGBA 1MEC3 3VKLA 1QJU3 4GH4B 4RQPA 1EAH2 2DU1A 4N3WA 2H6CA 4YZ2A 5AC93 1Z0HA 1PM7A 3VKMA 2OW4A 1NQJA 2LTNA 3USUB 1QJX3 4YVWB 1AJOA 5L7OC 3KT1A 3O70A 2YHJA 3WQ7A 1SEFA 2GSYA 3AYDA 2D6KA 4QQPA 4YRDA 2WZPP 2RMU2 2QICA 2DURA 4AF9A 1WLDA 3KM5A 1PO13 3O33A 1QJY2 5FMOS 4EN8B 1V87A 4PTBA 2Q4SA 3VUOA 3PHMA 4AYUA 1ZRCA 3L1XA 1FPN1 1ZBA2 2C9AA 3AKPA 3CJXA 1PZ9A 4S2FA 5E88A 4XMAA 4FOQA 4EN6B 4Q4V2 4Q8KA 3JD73 1ZRDA 2VMHA 1LHWA 2HWF3 3GZUC 1OPOA 2HKXA 1LODA 4XFFA 3QZVA 2VQAA 1UIKA 3KT7A 3NV2A 4OUSA 1W6MA 4LA3A 1TE1B 4FOWA 2EGPA 3LSEA 4QQ2A 2YHNA 2ET7A 1QY4A 1X36A 2BPA2 2ZX4A 1SFYA 4INDA 3VDDC 2MNGA 1Z6UA 1AR82 1WUVA 1YI9A 4EN9B 1DHKB 1ENSA 1I3HA 4A49A 1IS5A 2RR11 1RC6A 2YHOA 1ND3C 2XPJA 1QH6A 2CGOA 2OA2A 3TN93 3E6DA 4YM1A 2RS52 3MW3A 5SV8A 1W0PA 4HLTA 1XYPA 1PHMA 1PIV3 5TBNA 2VH9A 2WNUC 4LBQD 3LOBA 3ZFGC 4GB31 5FLJA 1NLRA 1QQP1 5T50A 4GALA 4NWVA 2P3KA 1HKDA 2XKPA 3EB6A 3I59B 2EAAA 1Q8PA 1RMU1 2ZX2A 2GAUA 4CDQB 2JMJA 2WA4A 1A8MA 4C90A 2BQPA 1UU5A 3QLQA 5HBAA 1WEOA 1W6OB 3AZXA 4XQDA 4HANA 2ECTA 4JGYB 4AW7A 2IZWA 1X8EA 2WT2A 2OUHA 3QCWA 4XBQA 4GKXA 4HKLA 2RM21 2EA7A 3WP3A 4C9ZA 4L97A 2BNMA 1A78A 2QJVA 4HKWA 5F9TA 1F31A 4N53B 2VNFA 1VIWB 5GKAC 1OA2A 4JQRA 4SLIA 4XEZA 4Y22A 1V00A 4B7KA 4ORFA 2JKBA 4ZU5A 3N9PA 5A32B 5D8AB 1YFUA 1FPN2 4XJUA 4W6XA 5GLZA 4ZKTB 5H9SA 1JBCA 3WDTA 5KXCA 2KGGA 2Q1ZB 4Q2FA 5GM0A 1FOD1 4CDWA 2LGVA 1MS1A 4XYXA 1QXJA 4Z2WA 1O3QA 5GALA 1F5JA 5C6CA 1IS4A 2VW1A 4HVQA 5DXDA 3H1MA 1OI6A 4AQ6A 4LHKA 3DQVR 2DX8A 3ZMNA 4I09A 4PBOA 4LKAA 5IK5A 2QFEA 1G9DA 4Y1XA 4BHWA 4AHZA 3R4DB 1REFA 1WCSA 5J7MA 3QACA 4KL1A 1FMD3 1KITA 1W0OA 3HN1A 3VGIA 2ZX1A 5JOYA 3V43A 1LDKC 5JSPA 1AZDA 4JRAA 1LGNA 1Z60A 4IETA 2RR12 1C57A 4FT8A 4QMAA 2K2SA 2VOVA 1MQTA 1JHNA 1W6PB 3AM2A 3WQ1A 1WESA 4HT1T 3V64A 2ZPXA 2Y43A 4YBMA 2D6NA 1DIWA 4A7KA 2C1FA 2PN5A 4P9LA 1QHDA 1RUI3 5I3LA 4GB32 2EAKA 1QQP2 3FLRA 1CAVA 3RRDA 4LNVA 2IDAA 1V9U1 1O5UA 1RMU2 4A2UA 1RUG1 2GU9A 1U12A 3SOXA 4L58A 4COYA 3N9LA 1YUDA 1VBA3 3SISA 3ZNIA 3GBGA 2ZJCA 4A7YA 1WEVA 1ZZBA 2R16A 4RS5A 4ISRA 1MS5A 4UW3A 5JPNB 4MGZE 2C0ZA 3FMGA 1XNDA 3KQIA 2RM22 1CPNA 2YGMA 4YZ4A 5TRBA 4H7MA 2UU8A 2WSUA 2VECA 2XBO3 4MVTA 2MPFA 4E4SA 4FTSA 4LLBA 4LBQA 1WEQA 1XNKA 4U36A 4CDWC 1V70A 3AB0A 3RYRA 1C8M3 3N9OA 3DPRC 5ABJA 3ZPVE 5I8YA 4Y26A 1LDJB 1FOD2 4I7DA 5T3NA 1R081 3KNVA 4RHV1 2A3XA 1JUIA 2JE7A 4PIYA 5GLWA 3VHPA 5JZGC 3UKTA 3WT3A 4FPYA 4K21A 2GMPA 3PJYA 4KQ7A 1A8DA 2R071 3V0BA 2RS31 4WVWA 4DINB 2LALA 3MFCA 5CFCC 3O37A 3GHMA 1XNBA 2PHFA 4Y1YA 1J59A 1E57A 1S0BA 4B29A 3EHKA 4QGLA 3NV3A 1NCQC 5LKTA 2ZGKA 1Q8VA 1MQTC 1GZWA 3HR9A 3OTFA 5H9RA 1RUH1 1IKQA 5I8TA 2AN6A 2QZ3A 3MZHA 5AVPA 4WA6A 4AI3A 1RTVA 3AMNA 1WW7A 3WG4A 2NPIA 3GBWA 2VOXA 4GXLA 4PPEA 2HWE1 1PGL1 3CJIA 3VBUA 3V0AA 2FZ2A 4QPIA 2SBAA 3MPPG 3KGLA 2ZMKA 1U5IA 2CGNA 1RMDA 3FFZA 1V9U2 1QDOA 1AR61 3SMHA 4N7UA 2ZHNA 5SV5A 3KD4A 3NO8A 2GNMA 3ZXLA 1RUG2 2RJLA 3U5MA 5AIUA 4XJWA 4YG6A 4XF9A 1J58A 4JC1A 1DZTA 2QE3A 2XHKA 1B35A 1CAUA 3MICA 2CSYA 2PQQA 4N43B 2UWCA 3MLKA 2CYFA 4XQWA 1LOGA 1TME1 1CQ9A 1CIWA 4QQOA 4I02A 3NAPC 1YFWA 1NE6A 3D82A 5EWSA 4TYSA 4M01A 1MS0A 2ZX3A 4LBMA 3DKWA 4OVEA 4Q4Y1 1RUNA 4YBSA 1C1LA 3RJRA 3PVOA 3M3CA 1XU1A 3M7AA 5T5JA 2XVGA 3RPGC 3VBOB 1YNAA 2VGDA 4LBKA 4URTA 4B3NA 1ZNPA 2KA3A 1VBB1 1JW6A 2FMDA 3HAGA 1R082 3WUCA 4RHV2 1H8TC 4YZ3A 3I54A 3RS6A 1CAVB 3AZYA 3WP5A 2HWB3 5GZGA 4FSJA 4ATFA 2VNGA 5FRAA 3ZTGA 3B9CA 4WBBA 5H9QA 1DQ4A 4YFZA 1XWHA 5JWPA 2R072 3APBA 1YJKA 2RS32 4XJ8A 2OYZA 5JIAA 3SLIA 3RMYA 3M3EA 4WZ2A 4D7TA 1R1A3 2K4DA 3ZYQA 2A3YA 1N47A 2PUYA 4EN0A 4XDQA 4RR3B 1RUH2 1CAXA 3BIWE 2E6RA 1S0IA 4X3GA 3OBRA 1TNRA 3T6RA 4XETA 1CAWB 3VBUC 1JOCA 2M3HA 4QPIC 3M2MA 1DLLA 2HWE2 3U5PA 1PGL2 3KCCA 3AZVA 2D3PA 1VBD2 3LCPA 1VP6A 1W6NA 5JOXA 3AP7A 2Z69A 1OOPA 3JCIA 4IV3B 4BA6A 2ZGQA 3ZSMA 1U5ZA 5D1IA 1AR62 4YVSA 4FPKA 2I50A 1KS4A 1UMZA 3AYCA 2RE9A 2Z79A 2YQLA 1FATA 3ZMOA 3OYWA 3WW3A 2GDFA 1B35C 4Q29A 4Z1VA 5KC6A 4LJNA 3FL2A 1O3RA 5DZEA 1KDKA 1N1TA 1PK6A 3AK0A 2EF6A 3KMHA 5CADA 3LQJA 1F9KA 4TKPB 1TME2 3SNMA 1YHFA 2YURA 4P9XA 4ZQLA 4YFWA 3FLTA 4HETA 2IC1A 4AGGA 1JYCA 2V09A 4L99A 1FP0A 4MLOA 1VFYA 5K9YA 2D40A 4HSJA 2DUOA 4Q4Y2 4LT5A 3TOJA 5KHGA 2F42A 1Y3TA 4QF2A 2B45X 4PLNA 2H0BA 2VJFA 4E2GA 2B42B 2RI7A 1FV3A 4KGGA 1VBB2 3WP6A 2OZ6A 3V0AB 5TDWA 4YM0A 4BZ4A 3AP4A 5BNPB 1JM7A 5A3LA 2D3SA 4COZA 4Y20B 2XGXA 1FT9A 5JLVA 3VL8A 5C4WC 1T1HA 3U11A 2WQZC 3GF6A 1ND2B 4UXAA 2BW8A 4LBLA 5DUVA 2BBVA 1D4M1 2DV9A 4MXWB 4HFSA 1ALYA 1QU0A 4AHXA 4MSXA 1OA3A 4COVA 4J1WA 4DS0A 3JBG3 3ZFEA 1Z2QA 4RGGA 2KM2A 3IPVA 3AMMA 3T1MA 1DGRA 4F83A 4YZ5A 1YWKA 5BNOB 1WE9A 2MD8C 4O64A 1RUC3 4BPZA 1HDKA 4RL7A 4AI1A 1ZRFA 1MS8A 2BVVA 1BBT1 3PVNA 1ZYBA 4P9WA 3W59A 3ZIWA 4YGEA 1VYXA 3H3ZA 4YVSC 4G9SB 1BORA 1X50A 3WDUA 2XJUA 2VNRA 1VB4A 2LUWA 2XL7A 4HSLA 1REDA 4HZFA 4BBQA 4LHNA 1O4TA 2ERFA 1MS4A 1SCRA 4KBBA 2VULA 3ME2A 1IKPA 1VJ2A 3WD5A 4Q1RA 5DDJ3 3VBRB 3MIHA 3BCWA 1XQNA 1LU1A 4MGIE 5GJ6A 5D1KB 4PJYA 3ZYGA 4GH4A 3TAYA 2D5HA 1MZ5A 1AL23 1KDMA 1WW5A 2FUUA 4EROA 1HV0A 3B9IA 4R9CA 2E51A 2ZOEB 4J6GA 3USUA 4AGVA 2MNYA 3OD4A 2IXKA 4DY3A 1N3OA 2JG8C 1YCIA 3B93A 4ISQA 3QH6A 5CAZA 4GNEA 2DCTA 2KGIA 4Z8BA 2MEV1 3IWZA 1RUI1 2GNTA 4S2DA 4JGZB 2Q30A 2EODA 1VBE3 2WNVC 5LRRA 5DZGA 5FERA 4AQSA 1UZYA 3VBHB 1D4M2 5FB0A 2ZGRA 3HCUA 3OPZA 4M0NA 2E7QA 3IT8A 5F6KA 1VRH3 1DDLA 3AMPA 1DQ5A 4CEYC 2ECGA 1TMF1 1WMEA 1FI2A 3ZVXA 2HYKA 2CV6A 3R05A 1AYM3 1HQLA 5JSOA 4AVTA 1KFXL 1QDCA 2VMGA 4I0BA 4S3OC 4B4QA 4N9HA 1RUJ1 5CNAA 3N7KA 1APNA 3ZFFC 3FUQA 3QD6A 4AYCB 1OLQA 4K8FA 4N90A 1BBT2 3LA2A 5B2GB 3J8F1 4H55A 4B4RA 4IEOA 1MM3A 4DPNA 1D4VB 2JD4A 4PCRA 3WDXA 2X29A 4BLJA 2JG9B 1NCRB 4R8HA 4XF0A 1AXZA 3V56A 5HI0A 3O0XA 3LQHA 4FPCA 2YGLA 2ATFA 5CFDB 3LSDA 2A70A 2WT1A 4W65A 3AYEA 3E6CC 4XILA 2OXQC 3RJ2X 4GH4C 3L1ZB 2PHWA 2KWJA 4N9IA 3I59A 3GALA 3KZ4C 2GC3A 3MW4A 4CDQA 4BMBA 3O7OA 3WXPA 2QNKA 4YVWC 4YABA 5FB1A 2PAMA 4YM2A 1K2FA 1B09A 1W6OA 4KG8A 3VZKA 1PNGA 4JGYA 1POV3 3N7JA 4GQ7A 4HMZA 4XOGA 1YI7A 1NA1C 4FXKB 5G04B 5B75A 1I5ZA 4JDOA 5LRSA 3UV9A 4ONUA 1PO23 4N53A 4LK9A 1UPIA 3AJYA 2MEV2 1Z7S3 1K5MC 1RUI2 2G4IA 1LEMA 3AXEA 4E2SA 4Q0QA 4FTBA 5T5PA 3ASLA 5A32A 1H2NA 2I45A 5E1RA 5BNNB 5KXBA 4IXLA 1POV0 2YV8A 1AYN3 3U5OA 4QF3A 3CO2A 2VUAA 4YGCA 2L0BA 3WW4A 1HRI1 3MF9A 1LOBA 1BVVA 2DVAA 4DB5A 2D6LX 4BHPA 4R9AA 1TMF2 4S2HA 4RA0A 4JV4A 1PZ7A 2VW0A 4C1WA 1ENQA 1S0CA 1FV2A 2JECA 3VBFC 3NG2A 1RUD3 1RUJ2 3SCHA 1UU6A 2NMOA 4XJZA 4AFCA 5FEYA 4CDUB 1RHI3 1NQDA 3HMYA 3J8F2 2VU9A 5JR7B 5CBLA 4CCGX 4CDXC 2WC2A 1WEEA 1U6GB 4P5HA 4LLOA 3TBDA 3A0KA 5FPZA 1W6PA 2XG3A 1WIMA 4GNGA 1WD3A 1OD5A 3ILFA 4K7JA 4E27A 1RUF1 3GZTB 3S7IA 1C1FA 4AE2A 2XVLA 4BE3A 2L5UA 3ZSKA 1V6OA 4IEXA 1ZBE1 2R041 3LQIA 1AR73 5K0UC 3WHTA 1CESA 5LCWB 2WFPA 3M1HA 5JAXA 5TDRA 2XLAA 4QQHA 1XNCA 3MEPA 2PLV3 2EXKA 4DZGA 1QKQA 4GMP3 3THTA 5B8DA 3U5NA 4XZPA 1R093