3I2DA

Crystal structure of s. cerevisiae sumo e3 ligase siz1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
286
structure length
280
Chain Sequence
TNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDETSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase SIZ1
total genus 59
structure length 280
sequence length 286
ec nomenclature ec 6.-.-.-:
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i2dA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3i2dA02
4YBTA 2FUUA 4S3OB 2AN6A 3LRQA 1WILA 4YBMA 3PHDA 1T1HA 2E6RA 4L7XA 2IDAA 2YU4A 2K4DA 2YUCA 2EGPA 2KWNA 4LLBA 3KQIA 3I2DA 2JMDA 3DQVR 3N9OA 2HYED 1ZBDB 2JMJA 2KFTA 1WEVA 3ZNIA 4ZDTA 3N9NA 4F52B 1E4UA 2LXPC 2VPBA 3U5OA 2VPDA 1G25A 1WEWA 5TABA 2H0DA 5TDRA 5FEYA 3HTKC 1V87A 3U5MA 4FO9A 2MD7B 4V3KC 1WFKA 3O37A 2BAYA 2KGGA 2MD8C 3U5PA 5J3XA 4I7DA 1Z6UA 3EB6A 3C6WA 4O64A 4Q6FA 5DKAA 2L80A 2NAAA 2KWKA 4YBSA 4R7EA 1WIMA 4GNDA 5LKXA 3VK6A 2CSYA 2KWOA 4N3WA 2XB1A 1VD4A 4LK9A 2KE1A 4V3LC 2ECGA 1HYIA 5D1MB 2JRJA 1WGMA 2OXQC 2E6SA 3L11A 1FP0A 2VPGA 1XWHA 1WE9A 2VJEB 4AP4A 5B8DA 2QICA 2M3HA 1BORA 3O70A 2MA5A 4A0CD 2HDPA 4IC3A 2CT2A 2VJEA 3LQIA 2CKLA 2VNFA 5G04B 3RPGB 1WEQA 5H1VA 2ECIA 2LQ6A 1WENA 4YATA 2C2LA 5D1KB 4WZ3B 4B7YC 4W4UA 3T7LA 2G45A 2ECTA 3O33A 2LGLA 1U6GB 3DPLR 3N9QA 3RPGC 5H1UA 3SOUA 4QF2A 3O7AA 2L75A 4LADB 2ECNA 4FK5A 1MM3A 3ZVYA 3L1XA 2ECJA 3HCTA 4B86C 2L43A 3HCUA 5C11A 5KH3A 5H1TA 1Z60A 1VFYA 5B79A 3ZPV1 3N9MA 2M85A 3N9PA 5LKZA 2MNYA 5TRBA 2YQMA 1RMDA 1WESA 2K16A 2CKLB 2FSAA 4FIPA 2KU3A 1N87A 4TKPB 5G05B 2CSZA 2KIZA 1WEEA 4ZQLA 3O35A 2G43A 5KH7A 3ZVZB 4LJNA 2UZGA 1JOCA 1WEPA 5AIUA 3V43A 4C9ZA 1F62A 1HYJA 2F42A 2YREA 2H0DB 5B78A 3KNVA 5TBNA 4MSXA 4N4FA 1IYMA 4WA6A 2MNZA 4I7BA 5LKTA 3M62A 2Y1MA 2RI7A 5DINA 3SOWA 3LQHA 1JM7B 4A4CA 2D8SA 2G6QA 4I7CA 1DVPA 2MUMA 5TDWA 2MT5A 2L0BA 3KV6A 2VPEA 1X4UA 3LQJA 4AYCA 2PUYA 2ECVA 2VJFB 2LV9A 1MM2A 4PTBA 4YC9A 4UP5A 4MVTA 2KGIA 4YAXA 5G0FA 4YABA 3HCSA 3GL6A 1WEOA 2F6JA 1K2FA 1Z2QA 3O36A 2RSDA 2YSMA 4R2YA 2YT5A 4GNEA 2ECWA 1X4IA 2KWJA 2Y43A 3IHPA 4L58A 1VYXA 3MHSA 4GB0A 4BHWA 3PURA 2MA6A 4X3GA 1LDJB 4WZ2A 5C13A 2K17A 2KR4A 2C2VS 3C5KA 2LXHC 5EYAF 5B75A 4R8PK 1CHCA 3U5NA 4FJCA 2K1JA 4A49A 2LRIC 4AVXA 2YURA 4NN2A 4AUQB 3L1ZB 3O34A 4CCGX 2YW8A 5H9MA 3SOXA 4UP0A 4GNGA 5JG6A 4CA1A 2QJ0A 2PNXA 5KH9A 5B76A 4IC2A 2VP7A 4YADA 2M6MA 3N9LA 3SHBA 5LCWB 2DX8A 3T6RA 4UI9B 2YSJA 2YYRA 4XI1A 2LDRA 1FBVA 2LGVA 5I3LA 4GNFA 4S3OC 5FB0A 3RTRB 2YHOA 2EA6A 2M1RA 2FUIA 1X4JA 2F6NA 3GV4A 2YQLA 2JMIA 2LGGA 3QZVA 5D1LB 3EB5A 3NG2A 2YHNA 4P5OB 4BBQA 4PPEA 2I50A 4A4BA 3ZTGA 4WZ0A 2KYUA 2QIZA 3M99A 5FB1A 3ASLA 3ZPVE 3ZYQA 2LGKA 2LN0A 2MIQA 4LKAA 2EODA 4AYCB 4ZUXU 3KV5A 2KREA 3FL2A 4QF3A 1WEUA 2Y1NA 2ZETC 2VJFA 3M63A 5AITA 3PUQA 3MHHA 5FERA 2L5UA 5B77A 5LKUA 2XEUA 1LDKC 1JM7A 1WEMA
chains in the Genus database with same CATH superfamily
1FMD2 4J25A 1DP0A 3A4UA 4S3OB 1CZSA 1L7QA 5D8AC 3MDBC 1FMD1 4EYUA 5C3QA 2J7MA 3KCXA 1ZZCA 2ZHLA 2E33A 2AACA 1SFYA 1T1HA 2E6RA 4JRLA 3TN93 1H8VA 4DRRA 3CDZB 4UW3A 2A75A 1O3SA 1KGYA 3GNEA 2I07B 1J3QA 3DPRA 1OFSA 1A8DA 2CDOA 1JZ5A 3MW4A 1LOFA 2EAAA 2HEYF 1F2NA 1OBNA 5A1FA 1GOGA 2GMMA 5FPLA 4LLBA 3ZDSA 5E8AA 5FYBA 3CF6E 4QKFA 2IXLA 1Q8PA 4IV1C 5FY0A 5IVCA 5BYNA 4DXZA 5BNPA 3N9OA 3JZVA 4IV1A 3M7AA 1UMZA 3TWIA 3U10A 2XLFA 5JZGC 1JODA 3ETQA 3ZYRA 2JMJA 1Q8SA 2MPFA 4DO0A 4IEQA 5JZGA 3QH6A 4QGMA 4LHLA 3PMEA 4F52B 2FDJA 2UWBA 1EPWA 1H8TA 2CV6A 2JB8A 4KH9A 1KJLA 1PK6C 1WMXA 3NNGA 3NKGA 4R8HA 2LXPC 1VAMA 3K51A 4LBOA 1US2A 3ZFEA 2WWJA 1JI6A 4COZA 4PLOA 4LBJA 3U5OA 1AR63 5LA9A 4CP1A 1AXZA 1DQ5A 1FOD1 4AEDA 5BNNB 3VZNA 2OS2A 3KQRA 1WEWA 5TABA 4SLIA 2H0DA 4V2VA 1ST8A 1B35A 1QJY2 3LE0A 2W52A 2QTWB 1ZZ7A 4WM7A 3TEYA 1NUKA 1RUD1 4XFAA 5A32B 4HK9A 1OOPA 1PVC1 3ACHA 3ZFGA 1SFPA 4HZFA 4K9SA 5A33B 3U5MA 2NQYA 1RHI1 2P4EA 3HD8B 1OVSA 4R9AA 5JI9A 1WFKA 5CU1A 5D8AA 3T1LA 2P1BA 1UPIA 2KGGA 2E61A 1C57A 1OQEA 2JG9A 3KHBA 4Y4YA 4MXWA 3U5PA 1FYUA 3RZMA 4I7DA 5LRSA 3EB6A 1S2BA 2PHUA 4I3PA 4CCDA 3MLKA 3IDEA 2ZEWA 2Q30A 1D2SA 4I0AA 1NZCA 4UBHA 2PHWA 1JZ7A 3EO6A 3DF0A 3POYA 4UF0A 2L80A 3AMPA 3ZSLA 4YVWA 2XJRA 3LDKA 2ZZJA 3HWJA 4QQLA 5F3GA 4CDWC 3IBMA 4NPRA 5JXJA 4QPYA 3IAQA 2D5HA 2RDNA 2WBKA 4XHXA 4XUOA 4HVOA 2X05A 4D69A 5BNOB 2BPA2 1WIMA 4GNDA 2XWJB 4PLMA 1SLTA 1C8M1 4A7YA 2LW8A 2WL1A 2ZGUA 1LOBA 4XDOA 3WF1A 1C8M2 1S0DA 3NV2A 2RS53 1DGWA 5LY1A 5SVIB 1N3QA 1OD5A 2BNMA 2GMEA 2VD7A 4CCOA 4BQ2A 4DZGA 2E51A 3HOBA 2G1MA 3O1VA 1RUD3 1ZBA1 2C9KA 3L2HA 3DYOA 4YWAA 5FUNA 5FZHA 3NAPB 2C4XA 2O14A 2VVEA 3TBDA 4D8MA 1VD4A 2KD7A 1DYOA 1UMIA 4LK9A 2KE1A 5J1XA 3NJZA 1UL9A 2C0ZA 1UYYA 4LNVA 4GIQA 5JVVA 2ZEXA 2ZX1A 2EIBA 2WN3A 4NO4A 2VOKA 1HYIA 1X9TA 2QNKA 3LEIA 3WF2A 3IIAA 5D1MB 5FZBA 3OGJA 3AP9A 4RFT0 4JDNA 5FXXA 1OOPC 4A2UA 2JRJA 2OXQC 2XJPA 3L11A 2VPGA 2WDBA 3MIGA 5FTTC 4AXOA 4GB32 1DIWA 4NHKA 4JVAA 1RUH2 5D1IA 2HYKA 4YW7A 1JYTA 4PIZA 2WNVA 4CU6A 2IVJA 1V70A 4D6SA 4QX2A 1Z0HA 5CFDB 4Q0SA 4AHWA 2P2KA 4ZU7A 2VUDA 5LEKA 2ENRA 2RMU3 3I97A 4E27A 4LEJA 1BORA 1CONA 1NY71 3ES4A 3BOWA 4QQHA 4XABA 3LFIA 4CE8A 1O4ZA 1OQDA 3H8XA 1OPOA 5E89A 4YVWC 1AVBA 2ZGRA 3H50A 4MGQA 4UFIA 3OY8A 3VBUA 4FVVA 2CT2A 3GDBA 2VJEA 3LQIA 4YARA 3LWCA 4MGKE 1H0BA 2V5YA 2Q8EA 1Y9GA 4J6GA 2EALA 1W8ZA 2YU1A 2OXBA 1X82A 3NL1A 1ZRFA 3H3LA 5EP9A 5A70A 4XURA 1JZ6A 3GZTB 5HCFA 3PUAA 4FXGB 5A3WA 1XRUA 3WW4A 2BFUL 4XHBA 4YYOA 2XJVA 2ZBJA 5CG8A 3ZXAC 1O91A 2VZ3A 3M3EA 3OD0A 1MR5A 1O5LA 1CPMA 4Q0QA 3DKWA 2QVSB 2Y64A 3LA7A 5F2SA 1W8WA 5CFCB 1N1SA 1QH6A 5FPAA 4JX0A 1OT5A 4HN1A 2L7PA 4XQDA 3W20A 1HIXA 3K2OA 1MS4A 4PT6A 1AJKA 2D7FA 4XF0A 3JQWA 3O33A 3A23A 3ZKYA 3DPLR 3N9QA 3AL5A 1NXD1 1JU4A 1Y9MA 3RPGC 2E9QA 4M3CE 5C3SA 3PJQA 4ZS2A 1XYPA 3JUUA 4A7ZA 1ALYA 4QF2A 1TMF1 4CDUC 2D6LX 1RUI2 2SBAA 3EHKA 3QLQA 3LA2A 1FOD3 2GNDA 3MGUA 5EQUA 5JMOA 1QH7A 1UW8A 2ECNA 1EY2A 4IDZA 4GA9A 1MM3A 3ZVYA 4QT6A 4Y1ZA 2XGXA 1RUOA 2ECJA 3HCTA 3MIFA 2B42B 4FTBA 3U14A 4U36A 3LGRA 2VM9A 2D93A 4A3ZA 1EUTA 1RHI3 1NA1A 4AI9A 2GDFA 5C11A 2NM1A 4YM0A 4MG2A 3KDEC 3FC0A 1NA1C 1AF9A 1HRV2 2CGPA 1VFYA 4YM3A 1PGL1 1SBEA 1AR92 5FJKA 1G9FA 2OX0A 1PVC2 5KWRA 2XOYA 5LKZA 1UY1A 5TRBA 2YQMA 4WM8A 1OLMA 2P3IA 1UKGA 3VHOA 3MIBA 3EYPA 1VBE1 4JDMA 4YSFA 5A3PA 5J7MA 5IK7A 3RWKX 3V0BA 5GZCA 4W6YA 2CKLB 4P9JA 2VUCA 3JD73 4IE7A 4INDA 5FP8A 3AMMA 5A3NA 3O1UA 4TLFA 4N43C 4AVCA 4XFCA 3RZHA 3BU7A 4LBQA 4FIPA 2JJ6A 2ZAHA 1EYBA 1EPZA 3I7DA 2PLV1 3O14A 4V1PA 3KZ4C 1ZYBA 1OMIA 3LPGA 4Q4V3 2KIZA 1UWWA 5FO8B 4RHV2 1QU0A 1RVF3 1WEEA 4ZQLA 1OKQA 2Y38A 3R4UA 1K45A 5HCBA 3CLPA 1ZRDA 1QJU1 2I45A 5F2WA 2XP0A 3BGAA 2Q5TA 4IV3A 3VDAA 2UWAA 3WNOA 1QJU2 3D4KA 3B94A 3K77A 2VCBA 2VUAA 1S0IA 1CR7A 5A7WA 2IVIB 1H9WA 3A22A 2CSGA 1H2NA 3HBKA 3WNMA 1CD3G 3GZAA 1OLME 3VKNA 1W6MB 3WF3A 4D7SA 2W1SA 2HWE3 2H0DB 2F17A 4QHBA 1DG6A 1KEXA 4YM2A 1WD3A 1XSQA 4OGCA 3ZXKA 3ECQA 5TBNA 1SLCA 5FDBA 4C1XA 1RUC3 3VKOA 3WF4A 4LLOA 2MNGA 1RB8G 3VDDA 1LAJA 1W6PA 1LGBA 2AGSA 2ZX2A 3NSTA 1VBC1 3PUIA 5J37A 5D8AB 1RXGA 4LK6A 5JIAA 1OA4A 1E5HA 3OPZA 2RI7A 3LQHA 3LSDA 3PLWA 1A8MA 4MSVA 4XJWA 2PYTA 2JENA 1RVF2 1XU1A 1DVPA 1YQ6A 1UY3A 2Z5WA 1QKQA 3TRSB 2JD9A 4ARXA 1RVF1 4Q5OA 5A3MA 1RUNA 5TDWA 5C9AB 2XQXA 3ZSEA 3RDIA 1H4GA 4IESA 1UOGA 1W9YA 2HBTA 4CDQC 4CU9A 2MT5A 2E7AA 2D43A 3G7DA 5LW9A 2JD4A 3H1MA 5GLZA 4Y20B 1U12A 1DQ1A 4PJYA 5BNOA 4MXVA 4NIIA 3RI8A 3MDPA 3MV01 4OLLA 2B0OE 4L8QA 5F5AA 5JZGB 4YC9A 5H9SA 4IETA 1D0GA 4LIUA 1S0EA 2QQKA 2XB6C 1VR3A 1W2UA 4MVTA 5HI0A 1RUC1 2KGIA 1PVC3 3USUA 4YAXA 5G0FA 5FBZA 2MEV1 4ASLA 3S5AA 4RL7A 4ATFA 4CDQB 4EN9B 3U37A 1ULDA 4X8NA 1WLDA 5I8YA 5EYYA 3NQHA 1REEA 3AJZA 2RE9A 2HWC1 1AZDA 1W90A 3FUQA 4OI1A 1WEOA 4OI4A 1PGSA 2JG8A 1GLHA 1U5IA 3GGLA 4H2AA 2RSDA 2HWC2 2YSMA 3POGA 5IFPA 3ZFFB 4CCMA 2YT5A 4GNEA 4RQPA 3CQOA 2NZ9A 3J7HA 1AR82 1NT0A 3NNLA 4CCJA 1X4IA 1UY0A 2R32A 2Y6FA 2YGMA 2E7TA 3DPRB 4H7MA 2ARAA 2Y43A 4YZ2A 4EV0A 4L58A 1OQ1A 1CJPA 3HEIA 1RUI1 2WO2A 4RYDA 1IS4A 4NJ4A 5A7PA 4E9KA 2EF6A 1MS0A 2IXCA 4WVVA 4HXCA 5GLUA 3ZSMA 4MADA 5CG9A 2W95A 4OHXA 5A3LA 1LDJB 1UAIA 4WZ2A 1OF4A 5C13A 2XONA 1JZ4A 3DV8A 3HQUA 4FQ4A 3RFRA 3BCWA 2NN8A 3ATGA 5FLJA 3NWKA 2KR4A 4K8FA 2VTXJ 5LA0A 4RR3C 1URXA 3C7OA 4XMIA 4ET7A 3WUDA 1J1LA 3QCWA 5FY4A 4KQ7A 2WAAA 2B39A 1BK0A 2MEV3 3ILNA 2GC1A 3Q8EA 2W2IA 5FUIA 1PGL2 4A49A 4AVXA 3ASIA 3L1ZB 2DBIA 4BXFA 3VN4A 3MIDA 3WDTA 3IZOA 4BIFA 1DQ6A 1L7LA 1W9FA 2ZABA 2VXJA 2R7EB 4IQPA 5DZGA 3MIHA 3WDYA 4BXSV 1N47A 5JPMB 1XE7A 4M4RA 1RUF2 1GNZA 1WKYA 2PLV3 2QQNA 4IGOA 4R4XA 5JXHA 2FDHA 4UP0A 1VBA3 3OBRA 3BPSA 1UOFA 4YG6A 5C8CA 5E6HA 3FHIB 5L36A 4HANA 3ME2A 4YGEA 3POFA 4MGYE 1FPN3 2D98A 5I8SA 1D4VB 3DYPA 4L9BA 2K9ZA 1G86A 2VNGA 1U5ZA 1LESA 1VB2A 1VBA2 2YBKA 5KHHA 1V6NA 1H6XA 2VOVA 3LFMA 3PMSA 4RHV1 5FZ9A 5LATA 4XF3A 3ZN6A 4RS5A 3FLTA 1HXS2 1WWYA 4LA3A 3LZZA 4CEYA 1GICA 5LZ6A 1HXS1 1US3A 5GJ6A 4IGPA 2W92A 3O1SA 1RMU1 2ETEA 3VHPA 4G4FA 4M0NA 4AFBA 1D0HA 2C6SA 2LGVA 3JU9A 1CWPA 3WW3A 3EB7A 1VBB1 2ZX3A 3IWZA 4Q0PA 4GNFA 2Y6GA 5I3LA 3RZKA 5HV4A 1VBD2 2OZ6A 1EAH3 5GZDA 1GWKA 1CZTA 1HKDA 1SG3A 2OYZA 1YRZA 1BBT3 1ASJ1 4GWJA 2VJXA 2J1TA 4JGYC 3LOBA 1VAVA 2RG4A 5T5PA 5BNQA 2QQMA 2FMDA 1QQP2 2GC2A 3WNXA 2EXKA 2EA6A 5G04L 4LHSA 4K1YA 4KNCA 2XVKA 3PNAA 4Q8LA 4XXPA 4CP0A 1X4JA 2FUIA 3B5LB 1N1TA 5C4WB 3LVQE 1J58A 4XIOA 3NJYA 4UT5A 1ULFA 2R49A 3GV4A 1NE6A 5IHRA 1K42A 4YVSA 1HRV1 3NKTA 2AR6A 2FD4A 1CX1A 1DGRN 3H7YA 3UL2A 2JMIA 2LGGA 1AHSA 3KLSA 1QJEA 4XMAA 1KS4A 4K3UA 3EB5A 3SH4A 1AJOA 2EXJA 5CB7A 5T55A 4NAMA 3OGGA 5DAXA 3T0AA 3ZX7A 4BBQA 3N3HA 2VNFA 3ZTGA 1RMU3 5IAVA 4ZHNA 1XPWA 3M99A 1POV0 2BNNA 3WW2A 2D6NA 5CA6A 1UIKA 4PI0A 1R1A3 2VH9A 2ZHKA 2ZMLA 1GZWB 1W04A 4M01A 2FDGA 3ZPVE 3E6CC 1XSRA 2JE8A 2XJQA 3CKHA 1KDMA 2WC2A 5FZEA 1G6NA 4BYYA 4CPBA 4EN6B 3RVHA 5LK7B 2LN0A 4GH4A 1NAEA 4LBQD 3VB9A 4QX3A 3UJOA 3ZR6A 4LKAA 4AYCB 3U11A 2VQAA 2FD8A 3KV5A 1DYPA 3GHNA 3LVRE 1AR73 2WFF2 4Q4X2 2VZ1A 4GWMA 2KREA 4QF3A 5FMCA 4XACA 1XNBA 5E16A 3ZSJA 4BOWA 4CCCA 2ORZA 3PU3A 3LF7A 5BNPC 2EIGA 2Q4SA 4BQXA 3S7IA 3PTYA 3R05A 4Q4Y3 5AVAA 4QX7A 4DEVA 3VL9A 2J42A 2FFWA 4AVTA 1XE0A 2ARBA 2ZJCA 3N7JA 1HDKA 4K21A 4N7IA 2JX9A 4QB1A 3ZM8A 3IPVA 5J3UA 2PAMA 2WO1A 3BIEA 1IS3A 5B77A 1CQ9A 1W6PB 5FPZA 1HLCA 4QB6A 2RHPA 5FOJB 4N53B 3ACFA 1K3IA 3MHZA 2RDRA 2AC1A 4RSUA 2WNUC 1WEMA 1O6UA 1OUXA 2VCMA 2WT2A 2EIEA 2RJKA 3PUHA 4FFFA 4I0BA 3H0OA 1FXZA 2FDIA 4X8PA 2EAKA 3MW2A 3O5SA 4KMQA 1JYXA 1YNAA 3O0WA 5C8CB 3PHDA 5BUVA 3KGLA 3I2FA 1KD7A 3ACIA 4ES9A 4QXCA 2IDAA 1XYOA 2RDSA 2WUHA 4AL9A 3RRDA 1ZZ6A 4YFZA 2K4DA 2YVRA 2FMYA 5AC92 2XL9A 4NE9A 4Q29A 3DGTA 1JHJA 2A1XA 4NHYA 5AC91 3NV3A 4FOYA 2KR2A 2VW2A 4NRPA 2WLPA 5JXGA 5KC6A 3VBHC 1C5IA 1EUUA 2EGPA 2W91A 4N53C 5FZ8A 2KWNA 5K0UB 5IATA 1YCIA 5JAXA 2YMZA 5JMCA 2E6VA 1K5MC 2JDAA 5AFBA 5JPNB 2JMDA 3CJIA 1QJZA 4QXBA 1E5SA 1WCQA 3FAOA 1UZZA 1X8EA 4DOUA 1NCRA 1YC61 3O1OA 4JHZA 4AE2A 2A71A 4IEOA 1NCRC 2JB4A 3NNFA 1SLIA 4AVSA 4EWDA 4Z8BA 1CGPA 5FZFA 4Y4RA 1CIWA 1QJX3 1XNKA 2VG9A 3UT0A 2ECTA 5C71A 2XOCA 1UMHA 1QOOA 3EJKA 3PL0A 5JSOA 1YQCA 3T4VA 1EV11 2RS13 4FOWA 5F6KA 1G25A 1V6MA 1HXS3 1W9WA 4ZONA 3VBFB 4COUA 1EV12 1TME3 1WLCA 4XBNA 4BMEA 1HB1A 1DCQA 4FTEA 2VW1A 5CAZA 2AH2A 5TDRA 4YVSB 3WP3A 2BQPA 3UGGA 1H2MA 3HTKC 3VKMA 1RUE3 1EAH1 4FO9A 1TEIA 1YQ8A 5C4WA 3T09A 1BMV1 2DURA 2MD7B 4V3KC 2W47A 3U1XA 2JDYA 3PHMA 3ZXFA 4AQSA 1GOHA 4Y26A 5JDBA 1BBT2 1UF2C 2AENA 5J98B 2OUJA 3E5XA 4QQOA 3USSA 2VMFA 3K4DA 3AYAA 3O7OA 5J3XA 4LHKA 5BNNA 1VBB2 1JBCA 3WW1A 2BNOA 1SLBA 4GKYA 1Z6UA 1VBD1 2Z69A 1STMA 1PX4A 4WV8A 5DUUA 2W0XA 3W59A 4LO5B 5C8WA 1ODNA 1W6OA 3ELNA 4CUBA 2DV9A 3ZMNA 1OA3A 1GNYA 4D0QA 1JU3A 2K2SA 1X8MA 3MW3A 2WZR3 4ZZ8A 5DKAA 1HQWA 2FZ2A 1KXGA 5IFTA 3VBHA 2RMU1 2YGLA 1U0AA 1ULOA 3KSCA 2KWKA 4R7EA 1UYPA 2RMU2 1W6QB 1UU5A 3IB3A 3ZFEC 4A6SA 4AZZA 1SMVA 5EJZB 4K20A 1BEV3 2Y33A 4A4AA 2HWF2 1DZRA 2WZR2 2X8KA 3QD6A 3RJ2X 4BCUA 1CAUA 3MEPA 1ODMA 2P17A 1W28A 2PQQA 5FK7A 3JD72 3PVOA 4UFMA 1G9CA 2GC0A 3VD5A 2WO7A 4B3NA 3KV9A 2RM21 3PVNA 3RMYA 3URFA 1WLTA 4DRVA 3GBWA 1JYVA 4JTNA 4R9BA 2QQUA 4EZ4A 5DUWA 1RUF1 3TB0A 5JXIA 3H7HA 2W1QA 1IQDC 2IXHA 2R6QA 4AR2A 2DVBA 4RGKA 5IK8A 4Q2FA 2XBO1 3LEMA 1IG3A 3IMNA 4AAXA 5JR2A 1QXJA 4NAOA 5FKBA 3DDTA 1S2EA 1QDOA 4AFCA 3BTZA 1FP0A 1XWHA 3I4IA 3DECA 3AKRA 4GH4C 4YPJA 2LAUA 1VJ2A 5ACA1 3MFAA 4KG0A 3W58A 1REFA 2IC1A 1TNRA 2PELA 2ZCWA 3HQRA 5ACA2 1Z7S3 1UQXA 2DU1A 4C90A 1JMUB 3VL8A 3ZKUA 3N36A 2Y34A 4OUEA 4QQ2A 1CAXA 2QICA 3D5OA 1R093 3ZYPA 3DCQA 4HKOA 4XF9A 2M3HA 4FPCA 4L97A 1GQHA 4NIGA 4N9HA 1LOAA 5CEHA 1V9U3 2WO3A 2QFEA 3MFCA 1C1LA 4DY5A 4M00A 1AX0A 5T54A 2D3RA 4AGGA 3S6PA 2AUYA 1IOAA 1FV3A 4KU8A 1VE0A 4KWUA 4YW5A 4N43B 4CCKA 1GOFA 4AHYA 2QUOA 4D7TA 2VE1A 3OBTA 4IC3A 4CP9B 5FZ1A 3HAGA 4JKKA 4XFGA 3ZYIB 5LBBA 2CKLA 1GP6A 5L19A 4TZDA 5G04B 4EN8B 3T0DA 5JOXA 3M3CA 3O47A 1LTEA 5LA1A 1VPHA 5H1VA 2W87A 4XETA 3VBRC 4Q4W1 1CPNA 1W2OA 5KXDA 5FYIA 3ZFFC 3B3QE 3GXUA 1POV3 3THPA 2C2LA 2JUNA 4COWA 3DN7A 4IEVA 3MIEA 4YLZA 4EN7B 4LBKA 3POEA 5ACA3 2WNVC 5SVYA 1W05A 1MZ5A 2VTFA 4JHTA 4B7YC 3RPQA 4L2NA 4W4UA 5GALA 2KXLA 4R52A 2WQZC 1KITA 4F8AA 1YXWA 1Q8QA 2VZUA 2ZOEB 4DUVA 4BLJA 4OI0A 1H1IA 4AEDB 1ASJ3 1UOJA 4FFHA 4P9WA 4BE3A 4IEZA 2M13A 1UYZA 1NCQA 5C3OA 1MVQA 1SCRA 1W0NA 3WP6A 4IERA 3M3IA 4AI2A 3O7AA 2C24A 2CONA 1K5JA 1QEXA 4IE4A 3JCIA 3OYWA 1HQNA 4ASMB 3WNKA 2L75A 1W39A 4XJUA 3WCSA 2Z4FA 1WCSA 1RITA 2VBDA 1UIJA 1DCSA 3ZOIA 1C3HA 4D6QA 4FAGA 2RS32 3CJXA 1HRV3 1N1VA 2CRWA 1R1A2 3AM2A 5T50A 4B86C 2XLAA 3O0XA 3P6BA 2WABA 4Y22B 3IPVB 1CN1A 5H1TA 5KH3A 1PK6B 2FDFA 2Y0OA 3AZXA 5CKNA 4I01A 1WBLA 4GWNA 3UKVA 4B4PA 3J26N 4QPGA 1CAVB 2YFUA 3J8F1 4IXLA 1Y3TA 2P34A 4J1XA 3E97A 3RZZA 1A6CA 5FY1A 4AW7A 2J1AA 5DDJ1 3SLIA 3VDCA 3MBWA 1RUG2 4OHZA 5T3NA 4QPIC 3POWA 2CTVA 1W6NA 2JIJA 5A33A 3ZFGB 2PQSA 2ZKNA 1QIQA 4BQ4A 2JKBA 2R0HA 3CIHA 4FI9A 5FP9A 3VBFA 3RNSA 3NJVA 4Z07A 2XQRA 2IXIA 3MLJA 1QJY3 1W03A 3I59A 3OBZA 2YPJA 3WF0A 4CUAA 4HFSA 2DF7A 4GULA 4FBFA 1HV1A 4H14A 5KR7A 4MXWB 2KU3A 3V0AB 4WM8B 1TNFA 5F5QA 4GB31 2BP6A 3AYEA 4QDSA 4LLFA 1M4WA 2Y6JA 2EXIA 4QXKA 4N9IA 3AFKA 1YUDA 1LHWA 1BVP1 3B9CA 5FZKA 2QQIA 2BERA 2WAOA 3CHXA 2R1DA 2RR13 4EQVA 4LJNA 2D6MA 1JYIA 4CXYA 2ZACA 1WUVA 3AVSA 1CJDA 1SHWB 2GMPA 1F5JA 4XUNA 1GZ9A 2RM22 5DDJ3 1F62A 2A7AA 3BI3A 2HWB1 1UZYA 1HYJA 4UYBA 4BQ3A 1PO13 1OSGA 4AEMA 5IVFA 1W6QA 3NV1A 4WM8C 1W2NA 3NAPC 4XEZA 1YI7A 1IYMA 4NHLA 4URAA 4CDUB 1SDDB 2WFPA 2VQTA 5FY5A 3TNPB 3RZJA 2XVGA 2W1WA 5LKTA 1PNGA 2B9VA 4JRAA 4A45A 5BY5A 2IUWA 2VMHA 3OCPA 4A4CA 5CBLA 4I0WB 2G6QA 4I7CA 1I6XA 3M1HA 3T08A 2JG8C 4DINB 4DUXA 3VZJA 4Z0OA 4CUGA 3B7MA 3I3EA 1Y4WA 4LA2A 5DG1A 4C0HA 1D4M2 5ERLA 4AAPA 5ABJB 3KQ4B 5JSRA 4GZ9A 2DUOA 5A80A 1UU6A 3HNYM 4UOJA 4RS5C 1FNZA 1ZA7A 3ETPA 3FMGA 3KV6A 1W2AX 3OGSA 2VQ0A 1GKBA 3WQ1A 4C91A 5HCAA 5IVJA 5CFDC 3VBHB 3LQJA 2BVBA 2PUYA 1YFYA 2R041 2JDMA 4ZXKA 4CRQA 4FSJA 1MM2A 2ECVA 1ASJ2 1LOEA 1E57A 4QGNA 1YJKA 4LKSA 5EWSA 4BDVB 1IS6A 3TEZA 3NV4A 2HWB3 2GN7A 2QKDA 3BALA 3SITA 1POV1 4GALA 1W99A 1GFF2 2D97A 3AMHA 4YVWB 1TME1 2RS12 4Q27A 3PJYA 1XC6A 4RR3A 1OH4A 4NHXA 2OT7A 1QDCA 3OY8B 5HBAA 5KC5A 4YABA 3E6BA 2FCTA 2NLRA 3HNMA 3HT1A 4GMP1 4Q4W2 1G9AA 1BZWA 4Z92B 4YFWA 5CYYA 1VRH1 2HWF1 2KA3A 3GALA 3TYJA 1H2KA 2F6JA 1T2XA 1ULCA 1K2FA 3EBRA 5FR3A 1Z2QA 3O36A 4FAHA 1RHI2 3C7FA 3I49A 1LKNA 1SPPB 4IV3B 1AL0G 2A6XA 1H30A 1DQ0A 3DL3A 4LKEA 4LBMA 2W5FA 3OB8A 1LRHA 2ZXQA 4PDWB 2B9UA 2NMNA 1WGPA 2WSVA 5FAXA 4CUCA 2WS92 3JB8A 2BBVA 1AL21 1NX9A 2VZPA 2KWJA 4LPLA 5FYMA 2H0VA 4LO7A 3CZUA 4XJ8A 3WNPA 5CISA 2HWD2 3LCPA 4AHXA 3S57A 1NLRA 3PURA 1YLLA 4XTMA 3C2UA 1ZRRA 2OIIA 1POQA 1RUJ2 2HWD1 4BPZA 4WVMB 2MA6A 3I59B 4FPYA 1FV2A 4UW6A 4C8DA 3E1F1 5HXVA 3CJIB 4V2WA 1F4HA 2K17A 4LHNA 3RI9A 1ND2A 4XYXA 5IK5A 4RQPB 3ENRA 4JGZB 2JWPA 3PDQA 2ZEZA 3NO8A 4YW3A 4E8DA 5JOZA 3PVBB 4O62A 5F5IA 1G9DA 5CFDA 1K5MB 2VZTA 3C5KA 4AOCA 4TSVA 3N4MA 2LXHC 5EYAF 1O7FA 2F4PA 5B75A 4R8PK 3POIA 1IGOA 1CHCA 3U5NA 2ZGOA 1K12A 1PM7A 1XNAA 4ZZ5A 2K1JA 2LRIC 2YURA 4AUQB 5FZ7A 2F4LA 4FXKB 2JDNA 4JGYA 4OQ9A 1XNDA 3I3BA 5A7OA 4BQWA 4CCGX 5JLVA 3FN9A 4DXTA 2YW8A 1UO9A 4F83A 3Q1DA 3T7LA 5FQ0A 2JE7A 3KVAA 5FRAA 1ZZBA 3ZXDA 3U4XA 1LEDA 3RSJA 4X6QB 2WSUA 5I91A 4YW4A 2E32A 4XQWA 2IXKA 3OD4A 3VDDC 5F3EA 2QJ0A 4IC2A 3NMBA 2WNUA 3JB4C 4LE4A 1DLLA 1UXZA 5FYSA 4HK8A 1WMEA 2IZWA 3QBQA 2C5DA 4PCRA 4Q26A 4XAAA 4GAZA 4K40A 2HWE2 1IG0A 4UFHA 4P9GA 2RR11 1PGW2 2GNTA 4BQYA 1D7PM 3WEZA 2ATFA 5FYHA 5I93A 5KXBA 2B5HA 3T6RA 3B9IA 2OQ7A 3CL1A 5J48A 3WHTA 5JOYA 1GSLA 1XBFA 4W6XA 2LDRA 4Y1YA 1U5XA 5FYVA 1LCLA 1PO11 3KMHA 5IAXA 1PO21 2UU8A 5LK5A 4PQ9A 5LBFA 1O8PA 4IEYA 1PO12 5E1RA 3VBOB 5TSWA 4EWAA 1OLRA 2YU2A 2Y8KA 3VBSA 3INAA 3TAYA 3V0AA 3H9AA 2OWAA 4XW3A 1Y7BA 3Q8BA 1GV9A 2ZHNA 2F6BA 2WQ4A 2FZ1A 3H3UA 5JCTA 3N7LA 1X50A 3ZFEB 1XYNA 2BZDA 3DPRC 3MF9A 2BRTA 3D0SA 4ATEA 3WQBA 3IT8A 2GAUA 2BJSA 5FY7A 2DDUA 2CNAA 4UI9L 2M1RA 2R073 3FFQA 4JCKA 3S5QA 5LCWL 5SV5A 5FZ6A 2A70A 4ARYA 2UWCA 3AMNA 2YUEA 2XOZA 2MEV2 4XQ4A 5K0UC 3E6DA 2UY9A 1SEFA 3VBOC 2HH9A 1AR61 4XJZA 4KWLA 4FFGA 4WVWA 3QZVA 4OMDA 5ANNA 2P3YA 2W3JA 2XMLA 4QM9A 5FXVA 1H8TC 1PNFA 1SPPA 2YHNA 2X53S 5CVRA 3RYRA 2R061 2D5FA 2R16A 2VOWA 4A4BA 5FUPA 5K8SA 4W6WA 4BA6A 4ZKTB 4KBBA 2EXHA 2WNOA 1CAXB 2WYSA 4MLOA 5C5TA 2A6WA 1JS9A 4AEDC 1V6JA 1ZBE2 4FTSA 5FB1A 2BDRA 1YHFA 2QQVA 3EQEA 2X09A 4NPMA 3MLLA 1U5YA 1AR83 2XJTA 2LGKA 1O3QA 1ZNPA 2A5ZA 2MIQA 2P6HA 3OF1A 2EODA 1UXXX 4AVVA 3VZLA 3GF6A 4NWWA 2YROA 1GMMA 3J8F3 4JKMA 1BVVA 5BV6A 1WMFA 1TG7A 5A6XA 2SLIA 2E31A 3FFZA 4KL1A 4CEYB 3ZXEA 2XJUA 3WR0A 4LULA 2QZ3A 1O8SA 2W68A 3I2IA 4AFAA 4UFJA 1HB3A 1IZ3A 2D40A 3PUQA 1JOPA 4MGIE 3LQCA 4YGBA 2CAUA 5A1AA 3GCXA 5T5OA 1NQDA 4JGZA 1H2LA 2OQ6A 2HEVF 3G6JB 3GJAA 4ISRA 2CDPA 1RINA 1LULA 2TBVA 4LE3A 4TLGA 3O1TA 5DUVA 1BKZA 2VUJA 2HWB2 2ZGPA 3WG4A 1T6BX 2VZRA 4L0PA 3NNJA 4F7ZA 3MPPG 1IKQA 4YM1A 4DPNA 2B7YA 4P08A 2FUUA 3OUHA 1JUHA 2AN6A 3LPFA 4BISA 1WILA 2Q1FA 3AP7A 1PM4A 1BYHA 4NRMA 3IDCB 2TEPA 4YBMA 4AWDA 3I3DA 1UNBA 5IUQA 3WX5A 3THTA 5J36A 3KWVA 2ZAAA 3SUBA 3C7GA 1V6IA 4UW5A 5FCCA 2XVLA 1ND2C 4XJAA 3U07A 3ZIWA 4QX8A 2DJAA 1LHOA 1A78A 5ANQA 5FMDA 4M0HA 4QPIA 5FXZA 5GZFA 1GR3A 3RMXA 3O1MA 1VRBA 2YUCA 5EFUA 1IKPA 1MZEA 4B7KA 4H7LA 1S55A 4I09A 5BNNC 4CDWA 1OLQA 5FLIA 3SEEA 2VW0A 2WS93 3VHRA 3KQIA 2X29A 3I2DA 1AX1A 4GWIA 1VBE3 2QQPA 4WVZA 3DQVR 2HYED 1TMF2 5JI7A 1ZBDB 4ISQA 2KFTA 3W5MA 2MKEA 1WEVA 4P5HA 3B93A 3ZNIA 1ULPA 2OW4A 2WJSA 3N9NA 1IPJA 4GH4B 1R64A 1PMIA 5EYXA 5EJ1B 1KS5A 4E4DX 3WP4A 4MZUA 4IW3A 1WW5A 2VPBA 1TQ5A 2K0GA 4XDQA 1FOD2 2JDZA 3KGZA 1KJRA 1YIFA 2R30A 1RJ7A 1W6NB 4C1WA 3LKJA 2VPDA 3WQ7A 1QJU3 3MUZ1 2RJ2A 3ZYJB 2RR4A 5D1KB 3ZXLA 2JECA 2VNVA 3AP4A 2VMCA 1O59A 4HT1T 2BU9A 1V87A 4BK4A 1RUD2 4H3WA 4S2DA 3UETA 4CEWA 1E5RA 1KFUL 3VLBB 3BIWE 4COYA 3OEBA 2R043 3WNLA 4QXHA 1CESA 3SHRA 3IDBB 1IS5A 3ZLIA 2BAYA 5DAVA 2XBO3 3MF6A 5JR7B 2MD8C 2WS91 2OUHA 1QOSA 1V9U2 2VMIA 1GWMA 5HXMA 5B4NA 1DU3D 5FP7A 3C6WA 5HV0A 4O64A 2JDKA 1X9PA 4MO3M 1MZFA 2BGOA 3WV6A 1PX3A 2AREA 3MV11 5A6YA 4Q6FA 1RUJ1 3KM5A 1D2QA 1C8M3 2E63A 2RS31 2W46A 5F6LB 2V4AA 1GNHA 1J3RA 1ENXA 1Z78A 4JGYB 1VRH3 2YC4A 3AL6A 4YBSA 1RUC2 4NR1A 3SCHA 4CCLA 5LKXA 1AR93 2ZEYA 4Q4X1 3WXPA 4B7EA 3VK6A 3LIHA 4E4SA 1O4TA 2CSYA 4K8RB 5FWJA 3C7EA 5K0UA 1S0FA 3N7KA 3RS6A 1ZZ8A 4E8CA 5FIXA 5F8PA 5FWEA 2LM3A 2VECA 4NHMA 2AEYA 4S2HA 5APAA 4XFIA 2QQWA 4Q1PA 1COV3 1H1MA 2WZ8A 5BPXA 3UJQA 1TE1B 3IAPA 5FXWA 1AR81 3I3QA 3CBNA 1S0GA 2R062 5F37A 2HWD3 3I2OA 3RQ0A 3N7MA 4OI2A 4XCAA 4AQ2A 1GYKA 2V5DA 2ZGNA 3LSEA 2Q8CA 5A3UA 2ECGA 3RYPA 3FE5A 2GALA 1DQ4A 2TNFA 4OHWA 3SXWA 3TEXA 4CXXA 4CU8A 4Q4V2 5IJRA 1WGMA 3W9AA 2CGNA 5HCHA 4XE9A 1XE8A 2VNOA 1NG0A 4O9EA 2RR12 4GXLA 4YZ3A 3P1IA 4EWEA 3M3QA 3NW4A 4MUVA 1WE9A 1YI9A 2J1UA 4AP4A 4XUQA 3LEGA 2YC0A 2VZOA 1DYKA 2N7GA 2CAVA 2P6CA 3D0JA 3OSDA 4FPKA 3BOPA 1AYN1 3OBAA 5EXOA 5IVVA 5KHJA 1PO22 4MGTA 5I0TA 3O70A 2YB7A 4YG3A 4AQ6A 1B35C 2NMOA 1JYNA 1XU2A 1GBGA 1JTZX 5CFCA 3H3ZA 2DYCA 4M3CA 5I0DA 2CRRA 1COV1 3UGHA 2HDPA 1PZ8A 3LRQA 5FV3A 1YIPA 2X10A 3FLRA 4L11A 5DAWA 1TVGA 2LUWA 2BV4A 3RPGB 3WVJA 1J1TA 3IDAA 5FP3A 3AKQA 2NP0A 1RXFA 4ZU4A 1DGWX 1WEQA 2PHXA 4F3JA 1JZ2A 2D8UA 4OZXA 2P57A 4GKXA 2PMWB 5I0SA 2ZGKA 2A73B 4DFSA 3VDBA 5CADA 4PBOA 1PMHX 2WINB 4AI3A 1WENA 4E4HA 4YATA 5DZFA 4OZOA 4Y5TA 4IEXA 1VBC3 4YW2A 3BVCA 3PU8A 4QAWA 1AUYA 3T4HB 4WZ3B 3L2YA 5A3TA 1H1AA 1TMF3 2G45A 3M8LA 1NA1B 4CP2A 1LOCA 3WG1A 2LGLA 2GP5A 1J83A 1NE4A 1I5ZA 2QQLA 1U6GB 4HSJA 5T5JA 2B8MA 4DNYA 3P5BA 1MBMA 1W9SA 3B00A 2OPWA 4LR4A 4CCEA 1RIRA 4DXSA 3K3NA 3KD4A 4LADB 1C5HA 3T2TA 4FK5A 4MV2A 2ADEA 2VVDA 4LIVA 1P8JA 4N90A 5IYYA 1MVEA 3L1XA 1UCXA 1SLAA 1CAWA 4HKLA 4XF4A 5IVEA 1NYWA 5FQ0B 5EJ3A 4AI8A 3H42B 4LT5A 2H6CA 4CVUA 4URTA 3N35A 4LBNA 1VMHA 3T1MA 3TN91 5F3CA 5B79A 3OUJA 3ZFFA 4EZHA 1KQRA 3OGVA 2VVFA 3HQXA 2HEWF 3N9MA 3TN92 3ZPV1 3N9PA 4YW6A 3DYMA 2M85A 2JDUA 1WCDJ 3RJRA 2MNYA 4P9XA 2BBAA 3QH7A 3JD71 1S0BA 2AEZA 5FLHA 5SVXA 4CPBD 2JKXA 1DBNA 1LOGA 2XH6A 5AC93 5K9YA 4Y33A 1G9BA 4HVQA 2JG9C 1BXHA 2K16A 1UZVA 2Y60A 1VBE2 1T6GC 1W8NA 2E26A 2EA7A 4G9SB 2OKXA 5J96B 3OG2A 4CYDA 2FSAA 4KU7A 3GHMA 5F7UA 5JSPA 1F15A 4AI0A 4ZS3A 5L7OB 1R083 1V6OA 1OKOA 3BN6A 3D3AA 2BOJA 4MHRA 1N87A 4TKPB 3K48A 1QXPA 2BWAA 2GN3A 4ZY9A 2PHDA 2CSZA 4HL0A 5D2AA 4DQAA 1DGRA 4OHYA 4XBLA 4NIDA 1ENQA 1OI6A 1J84A 4LO8A 1JZ3A 3POJA 1HJGA 1YWKA 3ZVZB 5KH7A 4NN0A 3WINE 4BWOA 3ZR5A 1RMU2 2CL2A 2ZGTA 4W65A 1UN1A 3R6SA 2PHTA 2UZGA 2HJIA 1JOCA 3KV4A 4YZ4A 4EJRA 5KHGA 4ES8A 3V43A 1W0PA 1HV0A 2ID4A 4BHPA 3DWDA 2CWMA 2F42A 5FO7B 4BK5A 4OHVA 3D6EA 2XLGA 2DU0A 1WCUA 5B78A 3UESA 4GMP3 3KNVA 4LKFA 2G9FA 1OH3A 1YYNA 3LAGA 2VULA 1Q56A 3WDWA 2PHLA 4NOTA 4D7YA 5GLWA 1ACCA 1WA6X 2HWE1 4NWVA 3ZXGA 3BKZA 3M62A 1QGLA 1GQPA 2FQPA 2XWBB 2YY1A 2G9ZA 1QQP3 2LS6A 4QPWA 3VZOA 4HN0A 4Y3OA 4P9LA 4KWKA 3SISA 3MUY1 2WRAA 3MYXA 2V72A 3W21A 4JQRA 1C8NA 1WCKA 2DFCA 2L0BA 5FZDA 1GWLA 1RC6A 4CDXC 3P3NA 4YG0A 4NMIA 2FCVA 2D3SA 5FJHA 4JAAA 2FDKA 3RGBA 4I2OA 1W6OB 3I3MA 2CY6A 1COV2 2CGOA 3VBSC 1VBB3 2ET7A 3FEHA 4XXAA 1Z7S2 1WMDA 1RUH3 4XFHA 3UV9A 5A7NA 5ISLA 2EGMA 1LECA 2EXUA 4UP5A 1V6LA 5FYZA 2LROA 2P3JA 3SEPA 3KHCA 3FM8C 3AB0A 1RUE2 4AVBA 1FNYA 4CP9A 3D8CA 5A7WB 4QWNA 3WY6A 5F1RA 2D3PA 2YBSA 3ILFA 2VR4A 2P37A 3GL6A 4XPVA 3ZO0B 3FBYA 4CDXB 1AR72 2WFF3 2B45X 1VP6A 5A32A 1DDLA 4IEPA 1LODA 1W2TA 4AFDA 3MI8A 4MYEA 4BH9A 1RUG1 3VHNA 1L7RA 4CEWB 2ECWA 4FPFA 1PK6A 3IN9A 3GBGA 4JV4A 3APBA 1PIV3 2VMDA 3IMMA 4PQQA 3U75A 1J59A 1HRI2 4TN7A 4NIHA 4LUKA 1ZBE1 2X5IB 3C8XA 3RZGA 2RVAA 4CDUA 2WZPP 1HRI1 3MHSA 4BHWA 1QY4A 3SMHA 5I0RA 4Q4V1 5FK8A 1F9KA 4X3GA 2IXJA 1ULGA 1CX4A 4HVRA 3ZN5A 4N7UA 5T52A 3T2QA 2JDPA 3Q8CA 4QKNA 1S1AA 2A3YA 1RUH1 4LBQB 5FZIA 4DIQA 1Y9QA 2I2SA 2NPIA 2C2VS 4LO6B 1ZX5A 5LWBA 3AC0A 3HR9A 1UZ0A 1ZZ9A 4IV1B 5DABA 2JE9A 1O3TA 4I30A 1S4CA 5K3QA 1AYN2 2DCJA 1OXCA 1LJ7A 2WIIB 3ZN6B 4Y1XA 1LGCA 5G05L 5SVIA 3WDXA 3OJBA 1A34A 3O34A 1ZRIA 1UD1A 1RL3A 2DVDA 2XDVA 5FYTA 4XZPA 5JWPA 3ACLA 4IEWA 4RS5B 1YJLA 2MHFA 2R071 3ZVXA 4CA9A 4P14A 3SOXA 2OZJA 2ZKLA 4GNGA 4OULA 2Q8OA 1TZOA 4FPEA 4BQ1A 3VBRB 5FZ0A 3CO2A 5DMYA 1GANA 4QD2A 4AFMA 2XBO2 3LDBA 4FPOB 4HG6B 2GP3A 1ZBE3 2RS52 3AJYA 2VP7A 2WR9A 2PFWA 3T0BA 4XVHA 2RS51 1OPMA 1JH5A 4NROA 3AKPA 1ND3B 3AKSA 3N9LA 5FZCA 1C4RA 3S0MA 2Q1MA 1VBA1 2QQJA 3UYJA 5LCWB 2DX8A 2DCTA 2VXRA 4UI9B 5FMOL 3V65A 2YYOA 2HKXA 3H7JA 5FKCA 3FJSA 2YYRA 4XI1A 4L92A 5C4WC 2PA7A 1L3JA 4QU2A 3ZN4A 4E2SA 1BBT1 1LU2A 2GNBA 3CU7A 2ILMA 5FY9A 3WZ1A 2VBBA 2B46X 5C9AA 2WKKA 4NUBA 5FYUA 4Y1VA 4S3OC 4OMCA 5FFOC 1JN2P 1SLLA 1D4M3 4HSLA 2CWSA 2PAEA 3ITQA 3T2PA 5F32A 1XNTA 3VGIA 4ASKA 4M3CB 1QQP1 4FQZA 2YHOA 1HN0A 3C7HA 4XIKA 2FBEA 3SH3A 4JDOA 3DEMA 5KXCA 3VD4A 5C7GA 4YZ1A 2JEMA 1GP5A 1MQTC 2VU9A 4WVMA 4COVA 2J1EA 2F6NA 2A6YA 1YQ5A 1QNYA 1QJX1 2BYVE 1QJY1 1PZ7A 1FPN2 4AEJA 4CZSA 3CJIC 4QKBA 4CTEA 3JQXA 2VY0A 3B69A 4QPIB 3DXTA 1WA4A 2P5BA 2XXZA 5IT6A 1PIV2 3PUSA 5A6QA 5FOBB 1UY4A 3ZFGC 3RZLA 4PF5A 3H1WA 4XFBA 2A3XA 3NG2A 2JG8B 3SKJE 4P5OB 4LMFA 4PPEA 2FCUA 2I50A 5ABJC 4R9CA 3WP5A 4CDXA 3VKFC 4WZ0A 5BXXA 1RTVA 1F4AA 4E4ZA 5FREA 5K7PA 3ASLA 1YFWA 3AVRA 5F3IA 1WW4A 4OGEA 4Y24A 5FPUA 4JTOA 5FZLA 3C3VA 1MZ6A 2WLQA 3AXEA 4HOOA 3SNMA 1GZTA 3KS7A 1LR5A 1AX2A 2WNUB 2VL4A 2WFF1 3BU0A 1R1A1 3LOIA 4ZUXU 3AFGA 3H8OA 3FL2A 1MEC2 2ZZQA 1OC1A 2J22A 3BYWA 4QDQA 4Y5Z0 2Y1NA 1MS5A 5C8CC 2VJFA 3M63A 3CMGA 3ZYFA 1VIWB 1Q3EA 4JC1A 2XUMA 3J8F2 3VKLA 3VBOA 1AR71 4MH0E 3ST7A 3MHHA 5FERA 3A21A 2L5UA 1HRI3 3PTRB 2IQJA 1AXKA 5B4XA 1W06A 3NNMA 5LKUA 1Q8OA 4KBZA 3ORJA 1LDKC 4Q4Y1 1MQTA 1XB9A 1VMFA 1OFNA 4ITCA 4H9DA 5CKMA 3HNBM 2QJVA 3LDYA 2JDHA 2WWSA 4NRQA 4Q0VA 4YBTA 3H1YA 1KRIA 3LB9A 1JYCA 4F1PA 1N3PA 1W9TA 4CCNA 3Q9OA 4WZCA 3HIFA 4W4ZA 3PVEA 1NCRB 2YBPA 3OTFA 4RHV3 1WW7A 2ZX0A 4UF0B 4L7XA 3UK9A 3L9JT 2Y6KA 1SBFA 1V0AA 4OQ8A 2YU4A 2QDNA 2WWUA 4AGRA 3BB6A 4A7KA 5GLTA 3KCCA 2XKPA 5ABJA 5LEJA 5IWFA 3T2OA 3CZJA 1SBDA 4IEUA 2DCYA 3THCA 5KBFA 3UNPA 4GD4A 3Q8FA 5T5LA 2ES3A 4M3CF 1LHNA 1RUJ3 4YVSC 4AGVA 1W8TA 2WQ8A 5IVYA 3WDVA 1ENSA 1REDA 4OUSA 2BEOA 1E5IA 2XR4A 2YDEA 4A41A 5IVBA 2H6BA 3JBG1 2BOIA 4META 1QHDA 1OOPB 5GKAC 5FP4A 5FZMA 1UX7A 2JICA 4ZDTA 3R4DB 3AZVA 4ZPIA 4LBLA 1SFNA 5LY2A 3AX4A 1E4UA 3HN1A 2EVXA 3IM0A 1QMJA 2R1BA 3WT3A 5GZGA 3LJUX 4NPLA 1PHMA 1BHGA 3ZSKA 4BJ0A 3J9SA 2KM2A 1W3VA 2O1QA 4IE6A 1LGNA 2J1VA 1RUE1 4JZRA 4Q1RA 4WBBA 5JIUA 2XPJA 2LTNA 3S30A 1RYYA 4LXLA 1Q5OA 3ALQA 2VPVA 1LNSA 3IIIA 4RGAA 1HW5A 1QOTA 2UURA 4Q4W3 4TWTA 2JIGA 5FEYA 1J3PA 1XJAA 1D4M1 3DUIA 1RGSA 2DUPA 1PVXA 1JOBA 2VOXA 2Q8DA 4CXWA 3O37A 4U2AA 1BMV2 3I8TA 1WW6A 1ENRA 1OA2A 2XG3A 2ZMKA 1AYM2 4O9GA 5AVPA 4DEQA 5B2GB 4E2QA 2V73A 1H4HA 4B1MA 5CKQA 4SBVA 3KB5A 1WBFA 1ND3A 3F95A 4RA0A 3OUIA 2DVFA 2ZGQA 4HKWA 4YRDA 1BJQA 5FYYA 1YFXA 5E88A 3ABZA 1UZWA 5FZOB 2WZEA 4TTGA 1BEV1 1F5FA 1UYXA 1W8HA 2D6OX 3NRUA 3UKNA 4PF1A 1FATA 1H9PA 1YQ2A 4KWJA 4MGSA 5FZ4A 2WZR1 4DXRA 3WG3A 3V0BB 1FPN1 2DWRA 2KWOA 3T9KA 1RUG3 2CU5A 2YG0A 3OPWA 4N3WA 2PHFA 3BTYA 4WM7C 1IPKA 1GUIA 3GCWA 3FHAA 5CNAA 2QDRA 3EMRA 3O0VA 1PIV1 1JHNA 2Z2SB 2XB1A 4P9IA 2J1RA 2VMGA 3ZXJA 5GM0A 2I74A 3VDDB 4A42A 3VD9A 5EHDA 5L9RA 4IUGA 3QOPA 1MS3A 3B02A 4LUMA 3T30A 4V3LC 4AF9A 1MS1A 3GYDA 4BIOA 3ZPYA 1H8TB 5FMOS 3TOJA 2RM23 2R0FA 2ZA9A 3OEAA 1BQPA 3PLQA 3ZYBA 1X7NA 2IFRA 2J1SA 3AZYA 1RUF3 2PLV2 2E6SA 4I02A 3GZEA 3M70A 3K46A 4N43A 5GLVA 1WD4A 2D44A 4XBQA 5FPXA 1ZREA 1QNWA 1FX5A 2RV9A 4XUTA 5A6ZA 3M2MA 1GU3A 3RYKA 2LALA 2VJEB 5B8DA 2VC9A 1LU1A 5FZ3A 3SQOA 3LA3A 3KT7A 4KGGA 4QX0A 3GZUC 3JXSA 4AYUA 2OVUA 4RD7A 1BK1A 3H8UA 5LBCA 1I1EA 4JKLA 4XCBA 1GP4A 3O1PA 3E2DA 4ONUA 1RUI3 2VAUA 4XFFA 1H6YA 4A3XA 4A0CD 4FPGA 1R091 3KF3A 4QHOA 4LQRA 2B4KA 3UGFA 1XNCA 1R092 5DZEA 4FP2A 4LTAA 5A7QA 2RDQA 3AKTA 3OYWB 5I0UA 3SCFA 1EV13 1TME2 2RS11 3BTAA 5FPVA 4AG4A 5LBEA 2ERFA 4BU2A 3W5NA 3VBRA 3TNQA 4BMBA 3POBA 1VBC2 2O8OA 2G19A 3ES1A 5IK4A 1O3RA 2ECIA 5KHIA 2YFZA 4HPKB 3GJBA 1QJX2 2LQ6A 3OGRA 4LOTA 2VZQA 3LIGA 4Y20A 3O12A 4CEWC 2KKXA 4E2GA 4GMP0 2VCAA 1JOJA 3QACA 3HMYA 4EROA 1DZTA 2GU9A 4PI2A 4QGLA 3SKVA 5I8TA 1VMJA 5DQ0A 1QJFA 2NAAA 5FBJA 3DXUA 4O7XA 3NAPA 2X5IC 4TXWA 2YHJA 3OPTA 3P3PA 4HMZA 4Y22A 1NCQC 3MZHA 1NZIA 1XXNA 2XJSA 4XZUG 2XHNA 1M06G 1YO8A 1AL22 4QKDA 4WZFA 5H1UA 2OPKA 4RFRB 3SOUA 2CHHA 5FZAA 4Z1VA 2YZ4A 2GZWA 4AK3A 2TUNA 3USUB 4DB5A 5F9TA 1AYM3 2QBXA 2QZ2A 3AYDA 5A3OA 3JBG2 1WLWA 5H9RA 1I9RA 2A3WA 4QX1A 4QQPA 3VBUC 3NVCA 2ZGLA 3D82A 1OF3A 4RR3B 1UKRA 3BODA 4GJZA 1ZA4A 2ARXA 5FZOA 4K1ZA 2L43A 3HN3A 1YFUA 1MEC1 1VLNA 2ZX4A 5L9BA 1W8UA 4DY3A 3R4SA 3HCUA 4Z0RA 2WA3A 5A1LA 2DVAA 3ZYGA 1Z60A 1S0CA 5K4LA 4B1LA 1NCQB 2HBUA 4LKDA 4DS0A 1MQTB 1PO23 2ZHMA 4Z82A 4LO4B 3CEWA 1NXMA 2VZSA 4FPHA 3VV1A 4FPJA 4I3GA 4HLTA 1B09A 2C26A 1LHUA 1AXYA 4XJ9A 2HWF3 1ZBA2 2O8QA 1RMDA 5CIRA 1PMJX 3PIJA 4XILA 2ZS6B 1WESA 4FOQA 4Q4Y2 1DFQA 2Q1ZB 3KVBA 4P9YA 2G9GA 2DSMA 2H0BA 2CYFA 4HBNA 5C70A 1B35B 1DF0A 1ND3C 4AQTA 3FBMA 3KT4A 2Z42A 4K6BA 1GZWA 5DAQA 4P00B 4YZ5A 1BCXA 1ND2B 3DKQA 4ZXEA 3V64A 2DFBA 1S2KA 3MPBA 5LASA 3WD5A 1ZRCA 1BEV2 4N8MA 5G05B 4GQ7A 3WDUA 2DCZA 4XC9A 5KXEA 3FL7A 1HB2A 4IE5A 3KCYA 1W6MA 4ZU5A 4B29A 3UKTA 4QB2A 3O35A 1C28A 4QPGB 2G43A 3GM8A 1OHFA 4PBPA 2BGPA 4G3YC 4CDQA 4CDWB 2VZVA 5LB6A 5KHKA 1WZXA 5L73A 3WLUA 4IE0A 5GZEA 4Q8KA 4GB33 4KI5M 5BNOC 4X6RB 4XTPA 5LA2A 1JW6A 1NY72 1OURA 2D6KA 2BTVC 4OYUA 5CFCC 2PHRA 4OFGA 4UW4A 1WEPA 2G4IA 5DPNA 5AIUA 1W8FA 1SQ4A 5A7SA 2W94A 4C9ZA 1QF3A 1NLQA 3WUCA 2Y0IA 3EXUA 2YREA 2WNEA 1S0JA 3NJXA 2GSYA 1DZQA 2K46A 2W39A 2WYFA 1CAWB 1UU4A 4EN0A 1VB4A 4FP3A 1VAKA 4MX3A 4MSXA 4N4FA 3R0RA 5FY8A 4QPGC 3ZIXA 2DUQA 3T3YA 4MHUA 2ZGSA 4QU1A 2Y6HA 4GJYA 5J09A 1SZBA 2MNZA 4WA6A 4I7BA 2Y1MA 4QQ4A 5DINA 4H55A 3SOWA 4UBGA 2QCSB 3IHPA 1JM7B 2D8SA 3ZYHA 1AR62 5LRRA 1VALA 5DG2A 1NOVA 2PAKA 4HONA 5EZWA 4DUWA 1EAH2 2MUMA 1FAYA 3U4SA 1KFXL 1UPSA 1IPSA 1UY2A 1XQNA 2D6PA 1RJ8A 1G8WA 3I54A 3I2GA 4YGDA 5DXDA 4EE2A 2E53A 3JBG3 5C3RA 1F31A 4UFKA 2VPEA 5F39A 2DTYA 1X4UA 2R042 3ILRA 1G7YA 5DN2A 3TEWA 4XF1A 4AYCA 1LENA 4B4RA 2VJFB 3Q8AA 4CU7A 2LV9A 3RWNA 3WCRA 4PTBA 3HJRA 2HLEA 2JXAA 4PDWC 1O4YA 2BW8A 4Q0UA 2DTWA 3J7NA 4YGCA 2VTXA 2Y26A 3I2HA 1CVNA 1ZM1A 2A6ZA 4BQ5A 4XOGA 2AYHA 1V6KA 1O5UA 3VD3A 5BNPB 2XKOA 4R9DA 3VUOA 3E5QA 3M3OA 3O1RA 5C3PA 2WT0A 2QE3A 3LEKA 4UFLA 1MPXA 4JQTA 3HCSA 1VRH2 5EPAA 4D6RA 2PN5A 4QM8A 1IHMA 4BB3A 1HQLA 5DUXA 5EIYB 1JZ8A 3ZDVA 2GH8A 4Y5SA 5FPBA 3J7LA 5FYCA 4PHZA 4JGZC 4AI1A 4PLNA 4PIXA 4R2YA 5DAPA 3AK0A 4UXAA 5D21A 4Z2WA 1ONAA 4HETA 1F35A 4FCAA 3SH5A 1IQAA 3U78A 1V9U1 3ON7A 3B01A 1F8VA 2VCCA 3RG0A 2WN2A 1A3KA 5FMBA 1W0OA 3FHQA 2DBNA 1V00A 2W08A 3KT1A 2R063 4LJHA 3WSOA 5IW0A 3S7EA 1VYXA 2IWGB 4GB0A 4K7JA 4QMAA 4P5YA 1NKGA 2O0OA 2FHRA 1W8OA 2YXSA 4KGQA 3ACGA 4FOVA 4RN5A 4TYSA 4IL7A 2VNRA 4QDRA 3VZKA 5AFEA 2YPDA 4Y1UA 3FUOA 4IV3C 4KG8A 4UAPA 4RGGA 2UYBA 3K3OA 4FJCA 2LRPA 3HVDA 2VBPA 2GH2A 1C1FA 3BPZA 1VBD3 4NN2A 1CAUB 2A6VA 4PDWA 2PXJA 1OD3A 4D3WA 3WQ0A 3MO4A 4FPLA 4NVPA 1LEMA 1SACA 4FFIA 1Q43A 5JUVA 1OVPA 5L9VA 4WM7B 2XHKA 2DVGA 2HWC3 4J1WA 2PTMA 1LHVA 4HPKA 5HPOA 1UX6A 5H9MA 1PZ9A 5JG6A 2VQUA 4CA1A 2RS33 1DGLA 4W50A 2PNXA 3AYCA 4BLIA 3VBFC 1LB2A 4RQPC 5KH9A 3E5UA 5B76A 3A0KA 1DQ2A 2WA4A 4YADA 3CNAA 4AHZA 1HN1A 2JG9B 4IGQA 2V09A 1QWRA 3VBSB 4ORFA 2EICA 1PGW1 1XOYA 2ET1A 4O65A 2GNMA 2M6MA 3M7KA 1APNA 1MACA 2ORXA 2ZPXA 4A44A 5JOWA 3SHBA 3FANA 1EP0A 2V4VA 4LOSA 3MICA 5C6CA 5L7OC 4B8EA 3X29B 1N3OA 2ADDA 2YSJA 1CZVA 4LITA 4P02B 2P3KA 5SV8A 2YC2A 2W9XA 3WNNA 3HPNA 3U0ZA 1FBVA 3FLPA 2XUEA 3J7MA 1Y43B 4B4QA 1Q8VA 1SCSA 2CSVA 1ZVFA 2WT1A 4C0BA 4BM8A 1BLZA 3V56A 5FB0A 2ZGMA 1JUIA 3F2ZA 1HB4A 4NIAA 2ZMNA 2Y6LA 3RTRB 5C5UA 3A0NA 3FX3A 4XAEA 4Z2AA 3FJUB 2BGCA 1Z7S1 1KDKA 4S2GA 2BFUS 1OUSA 2ARCA 1LOFC 2AZ5A 4YW1A 2IFWA 5FZGA 2W1UA 1JYWA 2L9LA 3AMQA 4MGZE 5EV7A 4W8JA 2UY8A 3ROUA 4BZ4A 1AYN3 1HX6A 1SDWA 1N1YA 1ULEA 1JXNA 2BWCA 3A7QA 4XDPA 1R081 4A6OA 4AVAA 5M0TA 3BUCA 2YQLA 2MA5A 3LDRA 1X36A 1R082 1DLCA 2ZTNA 5F5CA 2UYAA 5DDJ2 3OOXA 5D1LB 4QHZA 1AL23 4LK7A 4M4PA 3WOGA 3VD7A 4CEYC 1AYM1 2C9AA 3THDA 2NYYA 2WNVB 3FZ3A 2RJLA 3GBFA 3IKWA 5CZKA 1FT9A 1HJFA 1CIYA 2DCKA 3J4UH 4YNIA 2YV8A 5H9PA 1NQJA 2BVVA 2XL7A 2KYUA 2Z79A 1FMD3 4R4ZA 5C9AC 2QIZA 1I5PA 1ZBA3 3SC7X 4O61A 3K4ZA 5L7OA 3FWEA 4PIYA 1MEC3 3AZZA 3BTXA 2E7QA 3WHUA 2VGDA 3ZYQA 1GQGA 2C1FA 4LORA 1R1ZA 2OA2A 4OCTA 4OUMA 5FO9B 2Q0AA 3VBUB 2GC3A 3K4AA 2XOMA 4N53A 1X33A 1NLSA 1UOBA 3AXDA 1WEUA 2VOTA 1MS8A 2X5IA 1FI2A 2EIDA 5C33A 1GZCA 1W3XA 2ZETC 4DMIA 3WG2A 3AP6A 4D94A 5AITA 3PIGA 3ZPOA 1DHKB 2QQOA 4L99A 1AR91 4Q4X3 4MOAA 1K5MA 4UWDA 2VMEA 3SCGA 1CAVA 1YEWA 4CSWA 3I2JA 1I3HA 2VO5A 1MS9A 3KF5A 4XUPA 3K75B 3VZMA 3AZWA 4QX5A 4S2FA 3AP5A 3I2KA 2KKYA 4AEKA 2HYXA 3M4FA 1QXRA 2XEUA 2BUKA 2JM3A 3HT2A 3HBZA 4OVEA 3ZMOA 3LD8A 3POSA 3H8RA 3JUEA 2R072 5H9QA 1JM7A 4FT8A
chains in the Genus database with same CATH topology
1FMD2 3A4UA 4S3OB 5D8AC 1FMD1 3KCXA 1ZZCA 2ZHLA 1SFYA 1T1HA 2E6RA 4JRLA 3TN93 1H8VA 4DRRA 4UW3A 2A75A 1O3SA 3GNEA 2I07B 1J3QA 3DPRA 1OFSA 1A8DA 3MW4A 1LOFA 2EAAA 2HEYF 1F2NA 2GMMA 4LLBA 3ZDSA 5E8AA 3CF6E 2IXLA 1Q8PA 4IV1C 5BYNA 4DXZA 5BNPA 3N9OA 3JZVA 4IV1A 3M7AA 1UMZA 3TWIA 3U10A 2XLFA 5JZGC 3ETQA 3ZYRA 2JMJA 1Q8SA 2MPFA 4IEQA 5JZGA 3QH6A 4QGMA 4LHLA 3PMEA 4F52B 2UWBA 1EPWA 1H8TA 2CV6A 4KH9A 1KJLA 1PK6C 4R8HA 2LXPC 3NKGA 1VAMA 3K51A 4LBOA 3ZFEA 4COZA 4PLOA 4LBJA 3U5OA 1AR63 5BNNB 4CP1A 1AXZA 1DQ5A 1FOD1 4AEDA 1WEWA 3VZNA 3KQRA 5TABA 4SLIA 2H0DA 1B35A 1QJY2 2W52A 1ZZ7A 4WM7A 1RUD1 4XFAA 5A32B 4HK9A 1OOPA 1PVC1 3ZFGA 5A33B 4K9SA 4HZFA 3U5MA 2NQYA 1RHI1 3HD8B 4R9AA 5JI9A 1WFKA 5CU1A 5D8AA 3T1LA 1UPIA 2KGGA 1C57A 1OQEA 2JG9A 4Y4YA 4MXWA 3U5PA 1FYUA 4I7DA 5LRSA 3EB6A 1S2BA 2PHUA 4I3PA 3MLKA 3IDEA 2Q30A 1D2SA 4I0AA 1NZCA 4UBHA 2PHWA 3EO6A 3DF0A 3POYA 2L80A 3AMPA 3ZSLA 4YVWA 2XJRA 4CDWC 2ZZJA 3HWJA 4QQLA 2NAAA 3IBMA 4NPRA 4QPYA 2D5HA 4XHXA 2BPA2 4D69A 1WIMA 4HVOA 5BNOB 4GNDA 2XWJB 4PLMA 1SLTA 1C8M1 4A7YA 2WL1A 2ZGUA 1LOBA 1C8M2 1S0DA 3NV2A 2RS53 1DGWA 1N3QA 1OD5A 2BNMA 2GMEA 4DZGA 2E51A 1RUD3 1ZBA1 3L2HA 3NAPB 2VVEA 3TBDA 1VD4A 4LK9A 2KE1A 3NJZA 1UL9A 2C0ZA 4LNVA 4GIQA 5JVVA 2ZX1A 4NO4A 2VOKA 1HYIA 2QNKA 5D1MB 3IIAA 3OGJA 3AP9A 4RFT0 4JDNA 1OOPC 4A2UA 2JRJA 2OXQC 2XJPA 3L11A 2VPGA 3MIGA 5FTTC 4AXOA 4GB32 1DIWA 4NHKA 4JVAA 1RUH2 5D1IA 2HYKA 4PIZA 2WNVA 1V70A 1Z0HA 5CFDB 4Q0SA 4AHWA 2P2KA 4ZU7A 5LEKA 2ENRA 2RMU3 4E27A 4LEJA 1BORA 1CONA 1NY71 3ES4A 3BOWA 4QQHA 1O4ZA 1OQDA 1OPOA 5E89A 4YVWC 1AVBA 2ZGRA 3H50A 3VBUA 3OY8A 4FVVA 2CT2A 2VJEA 3LQIA 4YARA 3LWCA 4MGKE 1H0BA 2V5YA 4J6GA 2EALA 1X82A 3NL1A 1ZRFA 3GZTB 5HCFA 4FXGB 3WW4A 1XRUA 2BFUL 4XHBA 4YYOA 2XJVA 2ZBJA 5CG8A 3ZXAC 1O91A 3M3EA 3OD0A 1MR5A 1O5LA 1CPMA 4Q0QA 3DKWA 2QVSB 3LA7A 5CFCB 1N1SA 1QH6A 4HN1A 4XQDA 1HIXA 1MS4A 1AJKA 2D7FA 4XF0A 3JQWA 3O33A 3DPLR 3N9QA 1NXD1 3RPGC 2E9QA 4M3CE 3PJQA 4A7ZA 1XYPA 3JUUA 4QF2A 1ALYA 1TMF1 4CDUC 2D6LX 1RUI2 2SBAA 3EHKA 3QLQA 3LA2A 1FOD3 2GNDA 3MGUA 2ECNA 1QH7A 1UW8A 1EY2A 1MM3A 4GA9A 3ZVYA 4QT6A 4Y1ZA 2XGXA 1RUOA 2ECJA 3HCTA 3MIFA 2B42B 4FTBA 4U36A 3LGRA 2D93A 1RHI3 1NA1A 2GDFA 5C11A 2NM1A 4YM0A 3FC0A 1NA1C 1AF9A 1HRV2 2CGPA 1VFYA 4YM3A 1PGL1 1SBEA 1AR92 1G9FA 5KWRA 1PVC2 5LKZA 5TRBA 2YQMA 4WM8A 2P3IA 1UKGA 3VHOA 3MIBA 4JDMA 1VBE1 4YSFA 5J7MA 5IK7A 3V0BA 5GZCA 4W6YA 2CKLB 4P9JA 3JD73 4INDA 3AMMA 4TLFA 4N43C 4AVCA 4XFCA 3BU7A 4LBQA 4FIPA 2JJ6A 2ZAHA 1EYBA 1EPZA 3I7DA 2PLV1 3O14A 4V1PA 3KZ4C 1ZYBA 1OMIA 4Q4V3 2KIZA 5FO8B 4RHV2 1QU0A 1RVF3 1WEEA 4ZQLA 1OKQA 2Y38A 3R4UA 5HCBA 1ZRDA 3CLPA 1QJU1 2I45A 4IV3A 2Q5TA 2UWAA 1QJU2 3D4KA 3B94A 2VUAA 1S0IA 1CR7A 1H9WA 1H2NA 1CD3G 3GZAA 3VKNA 1W6MB 4D7SA 2HWE3 2H0DB 4QHBA 1DG6A 4YM2A 1WD3A 3ZXKA 3ECQA 5TBNA 1SLCA 5FDBA 4C1XA 1RUC3 3VKOA 4LLOA 2MNGA 1RB8G 3VDDA 1W6PA 1LGBA 2AGSA 2ZX2A 3NSTA 1VBC1 5J37A 5D8AB 5JIAA 2RI7A 1OA4A 3LQHA 3OPZA 3LSDA 1A8MA 4MSVA 4XJWA 2PYTA 2JENA 1RVF2 1XU1A 1DVPA 2Z5WA 3TRSB 1QKQA 5A3MA 1RUNA 1RVF1 5TDWA 5C9AB 3ZSEA 3RDIA 1H4GA 4IESA 4CDQC 2MT5A 2E7AA 2D43A 3G7DA 2JD4A 3H1MA 5GLZA 4Y20B 1U12A 1DQ1A 4PJYA 5BNOA 4MXVA 3RI8A 3MDPA 4YC9A 4OLLA 4L8QA 5JZGB 5H9SA 4IETA 1D0GA 1S0EA 2XB6C 1VR3A 1W2UA 4MVTA 5HI0A 1RUC1 2KGIA 1PVC3 3USUA 4YAXA 5G0FA 5FBZA 2MEV1 4ASLA 4RL7A 4ATFA 4CDQB 4EN9B 1ULDA 4X8NA 1WLDA 5I8YA 5EYYA 1REEA 3AJZA 2RE9A 2HWC1 1AZDA 3FUQA 1WEOA 4OI1A 4OI4A 1PGSA 2JG8A 1GLHA 1U5IA 2RSDA 2YSMA 2HWC2 3ZFFB 2YT5A 4GNEA 4RQPA 2NZ9A 1AR82 1X4IA 2R32A 2YGMA 3DPRB 2E7TA 4H7MA 2Y43A 4YZ2A 4EV0A 4L58A 1OQ1A 1CJPA 1RUI1 4E9KA 1IS4A 5KC5A 2EF6A 1MS0A 2IXCA 4WVVA 5GLUA 5CG9A 3ZSMA 5A3LA 4OHXA 1LDJB 1UAIA 4WZ2A 5C13A 3DV8A 4FQ4A 3BCWA 2NN8A 3ATGA 5FLJA 3NWKA 2KR4A 4K8FA 4RR3C 1URXA 4XMIA 3WUDA 1J1LA 3QCWA 4KQ7A 2B39A 2MEV3 3ILNA 4A49A 2GC1A 1PGL2 4AVXA 3ASIA 3L1ZB 3VN4A 3MIDA 3WDTA 4BIFA 1DQ6A 4IQPA 2ZABA 5DZGA 3WDYA 5JPMB 3MIHA 1N47A 1XE7A 1RUF2 1GNZA 2PLV3 4UP0A 4R4XA 1VBA3 3OBRA 4YG6A 5C8CA 3FHIB 5L36A 4HANA 3ME2A 4YGEA 4MGYE 1FPN3 2D98A 5I8SA 1D4VB 4L9BA 2K9ZA 1G86A 2VNGA 1U5ZA 1LESA 1VB2A 1VBA2 5KHHA 1V6NA 2VOVA 3PMSA 4RHV1 3ZN6A 4XF3A 4RS5A 3FLTA 1HXS2 4LA3A 3LZZA 4CEYA 1GICA 1HXS1 5GJ6A 1RMU1 2ETEA 3VHPA 4G4FA 4M0NA 4AFBA 1D0HA 2LGVA 3JU9A 5I3LA 3WW3A 4GNFA 1VBB1 2ZX3A 3IWZA 4Q0PA 1VBD2 2OZ6A 1EAH3 5GZDA 2OYZA 1HKDA 1YRZA 1BBT3 1ASJ1 3LOBA 4JGYC 1VAVA 5T5PA 5BNQA 1QQP2 2FMDA 2GC2A 3WNXA 2EXKA 2EA6A 4Q8LA 4K1YA 4KNCA 2XVKA 3PNAA 4XXPA 4CP0A 1X4JA 2FUIA 3B5LB 1N1TA 5C4WB 1J58A 4XIOA 1ULFA 2R49A 3GV4A 1NE6A 4YVSA 1HRV1 3NKTA 2AR6A 1DGRN 3H7YA 3UL2A 2JMIA 2LGGA 1AHSA 3KLSA 4XMAA 1KS4A 4K3UA 3EB5A 3SH4A 1AJOA 2EXJA 5CB7A 5T55A 3OGGA 3ZX7A 4BBQA 3N3HA 3ZTGA 1RMU3 3M99A 1POV0 2BNNA 3WW2A 2D6NA 5CA6A 1UIKA 1R1A3 2VH9A 2ZHKA 2ZMLA 1GZWB 4M01A 3ZPVE 3E6CC 2XJQA 1KDMA 2WC2A 4BYYA 1G6NA 4EN6B 5LK7B 2LN0A 4GH4A 4LBQD 3UJOA 4LKAA 4AYCB 3U11A 2VQAA 3KV5A 1DYPA 3GHNA 1AR73 2WFF2 4Q4X2 4GWMA 2KREA 4QF3A 1XNBA 5E16A 3ZSJA 4BOWA 5BNPC 2EIGA 2Q4SA 3S7IA 3PTYA 3R05A 4Q4Y3 5AVAA 3VL9A 4AVTA 2ARBA 2ZJCA 3N7JA 1HDKA 4K21A 4N7IA 2JX9A 5J3UA 3IPVA 2PAMA 5B77A 1IS3A 1CQ9A 1W6PB 5FPZA 1HLCA 2RHPA 5FOJB 4N53B 4RSUA 2WNUC 1WEMA 2WT2A 3LRQA 2RJKA 4I0BA 3H0OA 1FXZA 4X8PA 2EAKA 3MW2A 3O5SA 1YNAA 3O0WA 5C8CB 3PHDA 5BUVA 3KGLA 1KD7A 4ES9A 2IDAA 1XYOA 2K4DA 3RRDA 1ZZ6A 4YFZA 2FMYA 5AC92 2XL9A 4Q29A 3DGTA 5AC91 3NV3A 4FOYA 5KC6A 2VW2A 2EGPA 2WLPA 3VBHC 1C5IA 4N53C 2KWNA 5K0UB 5JAXA 1YCIA 5JMCA 2YMZA 2E6VA 1K5MC 5AFBA 5JPNB 2JMDA 3CJIA 1QJZA 1UZZA 1X8EA 4DOUA 1NCRA 4AE2A 2A71A 4IEOA 1NCRC 1SLIA 4AVSA 4EWDA 4Z8BA 1CGPA 1CIWA 1QJX3 1XNKA 2VG9A 1QOOA 3EJKA 5JSOA 1EV11 2RS13 4FOWA 5F6KA 1G25A 1V6MA 1HXS3 4COUA 3VBFB 1EV12 1TME3 1WLCA 4XBNA 4BMEA 4FTEA 2VW1A 5CAZA 2AH2A 5TDRA 4YVSB 3WP3A 2BQPA 1H2MA 3HTKC 3VKMA 1RUE3 1EAH1 4FO9A 1TEIA 5C4WA 1BMV1 2MD7B 2DURA 4V3KC 3ZXFA 5JDBA 3PHMA 4AQSA 4Y26A 1BBT2 1UF2C 2AENA 5J98B 2OUJA 3E5XA 4QQOA 3USSA 3AYAA 3O7OA 5J3XA 4LHKA 5BNNA 1VBB2 1JBCA 3WW1A 2BNOA 1SLBA 4GKYA 1Z6UA 1VBD1 2Z69A 4WV8A 5DUUA 2W0XA 3W59A 4LO5B 5C8WA 1W6OA 3ELNA 2DV9A 3ZMNA 1OA3A 2K2SA 1X8MA 3MW3A 2WZR3 5DKAA 1HQWA 2FZ2A 1KXGA 3VBHA 2RMU1 2YGLA 1U0AA 3KSCA 2KWKA 4R7EA 2RMU2 1W6QB 1UU5A 3ZFEC 1SMVA 4K20A 1BEV3 2HWF2 2WZR2 1DZRA 2X8KA 3QD6A 3RJ2X 4BCUA 1CAUA 3MEPA 2P17A 2PQQA 3JD72 3PVOA 1G9CA 2GC0A 4B3NA 3PVNA 2RM21 3RMYA 3URFA 1WLTA 4DRVA 3GBWA 4JTNA 4R9BA 5DUWA 1RUF1 3TB0A 2IXHA 2R6QA 2DVBA 5IK8A 4Q2FA 2XBO1 3IMNA 1QXJA 1QDOA 4AFCA 1FP0A 1XWHA 3I4IA 4GH4C 3AKRA 1VJ2A 5ACA1 3MFAA 4KG0A 3W58A 1REFA 2IC1A 1TNRA 2PELA 2ZCWA 5ACA2 1Z7S3 2DU1A 4C90A 3VL8A 3N36A 4QQ2A 1CAXA 2QICA 3D5OA 1R093 3ZYPA 4HKOA 4XF9A 2M3HA 4FPCA 4L97A 1GQHA 4N9HA 1LOAA 1V9U3 3MFCA 2QFEA 1C1LA 4DY5A 4M00A 1AX0A 5T54A 2D3RA 4AGGA 3S6PA 2AUYA 1IOAA 1FV3A 4KU8A 4YW5A 2MA5A 4N43B 4AHYA 2QUOA 4D7TA 4IC3A 3OBTA 3HAGA 3ZYIB 4XFGA 2CKLA 5G04B 5L19A 4TZDA 4EN8B 5JOXA 3M3CA 1LTEA 5H1VA 4XETA 3VBRC 4Q4W1 1CPNA 5KXDA 3ZFFC 3B3QE 2C2LA 1POV3 3THPA 5D1KB 4COWA 3DN7A 4IEVA 3MIEA 4YLZA 4EN7B 4LBKA 5ACA3 2WNVC 1MZ5A 4B7YC 3RPQA 4L2NA 4W4UA 5GALA 2KXLA 4R52A 2WQZC 1KITA 4F8AA 1YXWA 1Q8QA 2ZOEB 2ECTA 4BLJA 4OI0A 1H1IA 4AEDB 1ASJ3 4P9WA 4BE3A 4IEZA 1NCQA 1MVQA 1SCRA 3WP6A 4IERA 3M3IA 4AI2A 3O7AA 2L75A 3JCIA 3OYWA 1HQNA 4ASMB 1W39A 4XJUA 3WCSA 1WCSA 1RITA 1UIJA 1C3HA 4FAGA 2RS32 3CJXA 1HRV3 1N1VA 4B86C 1R1A2 3AM2A 5T50A 2XLAA 3O0XA 4Y22B 3IPVB 1CN1A 5H1TA 5KH3A 1PK6B 2Y0OA 3AZXA 4I01A 1WBLA 4GWNA 3UKVA 4B4PA 3J26N 4QPGA 1CAVB 3J8F1 4IXLA 1Y3TA 2P34A 4J1XA 3E97A 3RZZA 1A6CA 4AW7A 5DDJ1 3SLIA 1RUG2 4OHZA 5T3NA 4QPIC 3POWA 2CTVA 1W6NA 5A33A 3ZFGB 2ZKNA 2JKBA 2R0HA 3VBFA 3RNSA 4Z07A 2IXIA 3MLJA 1QJY3 3I59A 2YPJA 4HFSA 2DF7A 4GULA 4FBFA 1HV1A 4H14A 2KU3A 4MXWB 3V0AB 4WM8B 1TNFA 5F5QA 4GB31 3AYEA 4LLFA 1M4WA 2EXIA 4QXKA 4N9IA 3AFKA 1YUDA 1LHWA 1BVP1 3B9CA 2R1DA 2RR13 4LJNA 2D6MA 1JYIA 2ZACA 1WUVA 1CJDA 2GMPA 1F5JA 1GZ9A 2RM22 5DDJ3 1F62A 2A7AA 2HWB1 1UZYA 1HYJA 1PO13 1OSGA 4AEMA 1W6QA 3NV1A 4WM8C 3NAPC 4XEZA 1YI7A 1IYMA 4NHLA 4CDUB 2WFPA 3TNPB 2XVGA 5LKTA 1PNGA 4JRAA 5BY5A 2VMHA 3OCPA 4A4CA 5CBLA 4I0WB 2G6QA 4I7CA 1I6XA 3M1HA 2JG8C 4DINB 3VZJA 3B7MA 4LA2A 4C0HA 5DG1A 5ABJB 1D4M2 5JSRA 2DUOA 1UU6A 4RS5C 1FNZA 3FMGA 3WQ1A 3KV6A 2VQ0A 1GKBA 4C91A 5HCAA 5CFDC 3VBHB 3LQJA 2BVBA 2PUYA 1YFYA 2R041 4ZXKA 4CRQA 4FSJA 2ECVA 1MM2A 1ASJ2 1LOEA 1E57A 4QGNA 1YJKA 5EWSA 1IS6A 3NV4A 2HWB3 2GN7A 2QKDA 3BALA 3SITA 1POV1 4GALA 3AMHA 1GFF2 2D97A 4YVWB 1TME1 2RS12 4Q27A 3PJYA 4RR3A 1QDCA 3OY8B 5HBAA 4YABA 3E6BA 2NLRA 3HT1A 4Q4W2 4GMP1 1G9AA 4Z92B 1BZWA 4YFWA 1VRH1 2HWF1 2KA3A 3GALA 3TYJA 1H2KA 2F6JA 1ULCA 1K2FA 1Z2QA 3EBRA 3O36A 4FAHA 1RHI2 1LKNA 4IV3B 1AL0G 2A6XA 1H30A 1DQ0A 3DL3A 4LBMA 1LRHA 4PDWB 2B9UA 2NMNA 1WGPA 2WSVA 5FAXA 2WS92