3I2DA

Crystal structure of s. cerevisiae sumo e3 ligase siz1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
286
structure length
280
Chain Sequence
TNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDETSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase SIZ1
publication title Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 59
structure length 280
sequence length 286
ec nomenclature ec 6.-.-.-:
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i2dA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3i2dA02
3M99A 4IC3A 2LXHC 3ZVZB 5B79A 2ECGA 3N9QA 5TDWA 4V3LC 4BHWA 2QIZA 4YBSA 1XWHA 4A49A 3MHHA 5B78A 2VJFB 5FEYA 4L7XA 5B77A 3U5PA 3L11A 3PUQA 5DINA 4AYCB 2VJEA 4LLBA 1VD4A 2UZGA 5B75A 4LK9A 5TRBA 2MNYA 1K2FA 3RPGB 4GB0A 1DVPA 2Y1NA 2LQ6A 1BORA 4ZQLA 4S3OC 2F42A 2BAYA 2L75A 4Q6FA 2ECWA 4UI9B 2LN0A 2KE1A 3ZVYA 1WIMA 3DQVR 2LXPC 2HYED 1X4JA 2YQMA 5JG6A 4GNDA 3SOWA 2RI7A 3HCUA 4A4CA 1T1HA 3GL6A 2MA6A 2OXQC 3O37A 2MA5A 2MD7B 5LCWB 5TABA 4I7CA 5H1VA 4R7EA 2Y43A 2KFTA 2PNXA 4YATA 1VFYA 2FSAA 3L1ZB 3DPLR 4FK5A 3MHSA 2CKLA 3IHPA 2KWOA 3O33A 3U5NA 3N9PA 2YHOA 3N9OA 3KV6A 4QF2A 4YBMA 3PHDA 2XEUA 2L80A 2VPEA 4YABA 5AIUA 3HCSA 5G0FA 2IDAA 2KGIA 3PURA 2PUYA 4MSXA 4N3WA 2VPDA 2KIZA 2FUIA 4AUQB 1LDJB 3NG2A 2F6JA 1JM7A 3U5OA 2LGKA 2YW8A 3LQJA 1CHCA 2YYRA 2ECVA 2NAAA 2EGPA 2YURA 2DX8A 2KWNA 3KNVA 3ZYQA 2G45A 1WILA 1Z60A 3LRQA 2QICA 3N9NA 3ASLA 3SOXA 2XB1A 2LV9A 1F62A 2H0DA 4QF3A 3RTRB 4AVXA 3N9MA 2Y1MA 5C11A 3O34A 2LGGA 1Z6UA 5D1MB 4B7YC 2KR4A 3RPGC 5B8DA 1FBVA 5DKAA 3M62A 2K4DA 1WFKA 2LDRA 2YSJA 4UP5A 4UP0A 3M63A 5C13A 4CA1A 2K16A 4A0CD 2VJEB 3ZPVE 5G05B 1HYJA 5I3LA 2VNFA 2MT5A 1FP0A 4PTBA 4WZ3B 2FUUA 4GNEA 5EYAF 1WEPA 1WEQA 5KH9A 2MNZA 3T7LA 1Z2QA 2EODA 1G25A 1ZBDB 5KH3A 2VPGA 3V43A 1WESA 2G43A 5B76A 1E4UA 4V3KC 1RMDA 2YSMA 1X4IA 4AP4A 2KWJA 4WA6A 1WE9A 3KV5A 5J3XA 2MUMA 3HCTA 4ZUXU 3QZVA 2L0BA 5D1KB 3T6RA 3GV4A 1LDKC 2E6SA 3SOUA 3FL2A 2JMIA 5LKXA 2ZETC 2CKLB 3U5MA 2JRJA 3C5KA 3HTKC 4FIPA 1MM2A 2I50A 4BBQA 3SHBA 2M85A 2VJFA 2L43A 5G04B 4C9ZA 2YU4A 1WGMA 3LQHA 3ZTGA 3O7AA 4AYCA 1MM3A 2JMJA 4LKAA 1WEVA 4IC2A 2K1JA 4XI1A 4F52B 1WEOA 2EA6A 1HYIA 5FB1A 3O70A 2F6NA 2VP7A 4YBTA 4R2YA 1JM7B 2LGVA 2M6MA 4A4BA 1N87A 2ECIA 4LADB 5LKUA 2L5UA 2D8SA 1WEMA 2ECJA 3N9LA 2G6QA 2KYUA 3O36A 4S3OB 4W4UA 2E6RA 2C2VS 4YAXA 3EB5A 4P5OB 5LKZA 1WEEA 2YQLA 4FJCA 3I2DA 2KREA 4FO9A 3C6WA 2MIQA 2H0DB 3O35A 3LQIA 2YHNA 4YC9A 2JMDA 2KGGA 2HDPA 5FB0A 1IYMA 2ECTA 4GNFA 5TDRA 4TKPB 2YREA 2CSZA 5LKTA 2K17A 1WENA 1JOCA 4LJNA 2YUCA 2LGLA 4GNGA 1VYXA 4ZDTA 4B86C 5D1LB 1V87A 5H1UA 5FERA 2M3HA 4WZ0A 3L1XA 2CSYA 2LRIC 2ECNA 3ZNIA 4YADA 4NN2A 1X4UA 2MD8C 2C2LA 5H9MA 4PPEA 2M1RA 1WEUA 4WZ2A 4I7BA 4MVTA 2AN6A 2RSDA 4I7DA 5KH7A 2KU3A 3VK6A 5H1TA 2QJ0A 4X3GA 5AITA 3EB6A 4CCGX 4L58A 5TBNA 4O64A 1WEWA 2KWKA 2CT2A 2YT5A 4R8PK 4N4FA 3KQIA 1U6GB 2VPBA 3ZPV1
chains in the Genus database with same CATH superfamily
3E97A 2ORXA 1PMJX 2G9ZA 4HK9A 1U0AA 1BBT1 2JG8C 2CWSA 4I0AA 3FJSA 4MV2A 4IV3A 2V5YA 4AHZA 5FY5A 2EIGA 2XBO2 2LAUA 2RJKA 3VBOB 4EN7B 2BYVE 3K2OA 3OD4A 4AI8A 1CAVB 2G19A 1WCUA 5ABJA 1CWPA 1AR93 5TDWA 1QJX1 3LDKA 5KXBA 4S2DA 2AEYA 1LHWA 1VBB2 3ZN6A 4META 4QT6A 2UURA 4CCOA 3AFGA 4U2AA 3J7MA 4K9SA 4CCJA 5CBLA 2KXLA 2K0GA 2VGDA 3AMNA 1DCQA 1T6GC 2D43A 5IW0A 1G6NA 1H8TB 1QOOA 1F2NA 4LBNA 3LAGA 5HXVA 1QJU2 1POV3 5HI0A 1AR81 3PUQA 4YVSC 3L11A 5D8AA 3U1XA 4MXVA 1CGPA 2VTFA 4H55A 3ME2A 2FDIA 4NIAA 1FNYA 1GP5A 3AZZA 5GZDA 4KNCA 2A5ZA 5J3XA 4ARXA 3T0AA 1VD4A 3J9SA 2J1EA 1DZRA 1XYOA 2DWRA 4LK9A 5A7OA 2RM23 1K2FA 1A8MA 4JHTA 4NIHA 2AC1A 1QDCA 4OULA 4XMIA 1MS5A 1Z78A 4Y1UA 2DCJA 1ZZ7A 1SCRA 4XBNA 5JZGA 3AP7A 1BLZA 1V9U3 3BOPA 5IATA 2Y1NA 1W04A 4LTAA 4NN0A 4BQYA 4A41A 4YG6A 1RUF2 1PGSA 4WVZA 1IKQA 1ZM1A 1LODA 5FP7A 3FL7A 1RUG3 2XOCA 4RS5B 2OWAA 3ZR6A 3WD5A 3QD6A 1FMD2 4QQPA 4QQHA 1BK0A 4RFRB 3URFA 4W6XA 2ZGKA 1UXXX 4YC9A 3AC0A 2PN5A 2ZS6B 4EZHA 2R1DA 4UI9B 2JWPA 2LN0A 4FTSA 1KFXL 4IEQA 2WNOA 2C4XA 2YPDA 4K8FA 3ZIXA 3K51A 1ZBE2 3ZVYA 4BMBA 2DURA 5IK5A 5FMOS 3AL6A 2E7QA 4QGMA 5FMBA 5FZ8A 2WA4A 4QM8A 2LXPC 5C70A 2R7EB 3RZKA 2HYED 1RUC3 3WNLA 4PBOA 4UYBA 2UWAA 2VD7A 1UL9A 2HLEA 4OI4A 3UJQA 1ZBA1 2BNOA 3QLQA 1LGNA 3ECQA 3HWJA 1T1HA 1W6QA 1W6OB 1QJY2 4UI9L 5A7WA 2UWBA 1RUD3 4HPKA 5F3GA 2TEPA 3MICA 3A22A 1RHI1 3CO2A 1W2UA 2XONA 2CTVA 4G4FA 4Y4YA 1JYTA 2VAUA 5GLWA 1DYOA 3T0DA 2Q8CA 5ANQA 1J84A 3AYAA 5CB7A 4CDXB 2Y43A 2YY1A 4ZU5A 2O14A 2PLV1 3KSCA 2JDNA 3SQOA 4CTEA 4YZ2A 4OVEA 4CRQA 2FSAA 5A3LA 1MVQA 1ENRA 4NMIA 1SMVA 2RMU2 1QNYA 3WG1A 4EYUA 4XQWA 2V4AA 2CKLA 3VBRA 3JUUA 2JDYA 4KMQA 5FMDA 2HYKA 3MDPA 1VB2A 5F7UA 4DUVA 1XOYA 2D40A 4NE9A 4GA9A 5EHDA 4XUOA 3JD73 4DNYA 4OI2A 1QJZA 1SCSA 4YM1A 4JGYA 5ACA2 2PA7A 2WINB 2XEUA 1XNBA 4NIIA 4D7YA 4E8DA 1D4M1 1PZ7A 2JG8A 3A0KA 3P3NA 4MLOA 3AZXA 2RS33 1NCRB 1CESA 1HRV2 4RGGA 3WCSA 4IETA 4XUNA 5AIUA 3J7HA 4AVAA 3HCSA 5C7GA 2FZ2A 3CEWA 4BISA 2E6VA 1LHOA 3QCWA 5DZEA 1D0HA 5DDJ3 5GLUA 4DS0A 1CQ9A 1OVSA 3PURA 2JIJA 4L0PA 5DG1A 3TN93 2ARCA 2OZJA 3AYDA 2BOJA 5CKNA 4MSXA 3VBUA 1W8OA 4IE4A 2VPDA 1ZRRA 2Y6LA 2L9LA 3I3EA 3OGSA 3ZXAC 1RUJ1 1AR72 3TEYA 3ACFA 1TEIA 1OA2A 4IGOA 1HQLA 5KHHA 1JZ7A 1V6OA 3HR9A 4QKNA 4YVSA 3LJUX 3ZFFC 2OUHA 1RL3A 3ZYPA 2EGMA 4NHMA 4YZ1A 2WSVA 2W91A 1W2NA 4QM9A 5JMCA 4MZUA 4QD2A 5FYUA 1O6UA 2LS6A 4ISQA 1VB4A 4CXYA 1ULCA 3ROUA 4R9CA 3ZKUA 1REDA 1MEC3 2ERFA 3HNMA 4PLNA 1CN1A 2GH2A 2YYRA 3H8UA 2ECVA 2WT1A 3WF4A 5JDBA 2NAAA 1PO12 2O8OA 1NXD1 1NZCA 4H7LA 4LUMA 4QU2A 1LEDA 4WZCA 5A3OA 2XPJA 1IZ3A 2Q1MA 2IQJA 3AP9A 1DF0A 3H3UA 4NHLA 3ZYQA 5FZOA 1XE7A 4W6WA 1WILA 4LE4A 4OHYA 4FVVA 4FTEA 1Z7S1 3C8XA 1Z60A 3LRQA 3MIFA 2RS51 1FOD3 4HVOA 5C3QA 3TEWA 3ASLA 2WAAA 4JKLA 1AYM1 1RUE3 1ZYBA 3PMSA 4MOAA 4BM8A 5JXJA 3U10A 2GN7A 2PXJA 3W20A 2CWMA 3KT4A 4IV3B 1XSQA 4UW5A 1YEWA 3RTRB 5FO8B 4AVXA 2Y1MA 1ASJ3 5ABJB 4AQ2A 5C11A 5I0RA 2VPVA 3O34A 2Q0AA 2QFEA 3VHOA 3ZN6B 4AFMA 4B7YC 2Y26A 1V6IA 2J1UA 4N7IA 3PVBB 3HQRA 4IESA 3HVDA 5AVPA 3RS6A 3K75B 4CU9A 1PVC2 2Y6GA 5LBBA 1H4HA 4NHXA 4Y1VA 1ULGA 1WFKA 3FMGA 1EY2A 1CAXA 2YB7A 2IFRA 2YSJA 4LK7A 2WS92 4Z82A 4ONUA 5D8AB 2VCCA 1GNZA 1GV9A 2ZGSA 4N9HA 3MGUA 4QPIA 2ZGNA 1I5PA 4CA1A 2YMZA 3HAGA 1UPSA 4FPLA 2A1XA 2YV8A 1F15A 1ZNPA 3MHZA 5JPNB 2NMNA 1HYJA 3SC7X 1EV13 1H0BA 3B69A 2MT5A 3DCQA 2B39A 1FP0A 5LCWL 4COZA 5BNNC 1RINA 3BODA 2KR2A 4XURA 1NYWA 3RYRA 2ZGRA 2ZGLA 4BK4A 5JZGB 2F6BA 1AYN2 2BVBA 1WEPA 3KDEC 1AX0A 3PLWA 5KHJA 2RVAA 5FOJB 3LA3A 5E8AA 5K9YA 3T09A 5FP9A 3C3VA 5IFTA 1WCQA 2H6CA 2XJQA 4GJZA 4Q0QA 1QU0A 3IMMA 1K5MB 3WP5A 1WKYA 5KH3A 1OBNA 2EXKA 5F32A 5JMOA 1YIFA 5F5AA 5FKBA 4DY5A 5E6HA 5DG2A 4BHPA 5E1RA 1COV2 1TZOA 1CX1A 2G43A 4TN7A 1K42A 1E4UA 1MQTC 4OLLA 4C0HA 3BN6A 1VAKA 3S0MA 3BTZA 2HWB2 1RMDA 2IXIA 4Q27A 5FZ1A 4YW3A 3EO6A 3PMEA 1S0GA 1KEXA 4YWAA 1WD4A 1FV2A 3N7MA 3I4IA 4WA6A 3C2UA 1SFYA 2DBIA 1OFNA 3ZFFA 3I54A 1W6QB 3KV5A 1GQHA 1V6KA 4OFGA 1OH3A 1W8UA 4Q4W3 5LRRA 5A7WB 4A6SA 3LFMA 4HPKB 4EWEA 3I3QA 3AVRA 2PMWB 3DF0A 1AL22 4YYOA 2PQQA 2VQTA 2XL7A 3LEKA 4COYA 1HRI1 3LDBA 1URXA 1X8EA 4XTPA 4PLOA 1OT5A 1XNCA 2ID4A 3POGA 4JAAA 3WNMA 3BUCA 5KHGA 5I0TA 3SLIA 3N36A 4AEJA 3G6JB 5D1KB 5DUVA 2VQUA 2CY6A 5BYNA 1QEXA 4AAXA 4XUPA 1ZREA 4QX1A 3SOUA 2ZETC 2HBTA 3T3YA 5FY4A 2CKLB 3VBRB 1KXGA 4BA6A 4QX7A 2P3JA 3U5MA 3SISA 4M3CE 3MO4A 3IWZA 3ZM8A 1VBE3 3TYJA 4AEKA 1UY4A 2YYOA 3HTKC 2ZGMA 1IG0A 2XVGA 4FIPA 2B9UA 2QQLA 2WLQA 2XMLA 2ZX2A 3H9AA 2R062 5BNPC 1W8TA 2R073 4AG4A 4JGYB 3ZFEC 1RUNA 2IZWA 1W8NA 3FLRA 4YGCA 3VHRA 2YU4A 3BALA 5KBFA 4Q4V2 2YC4A 1ZX5A 4N7UA 1QF3A 3O7AA 2ZABA 4GALA 3IDCB 3IPVB 4V2WA 5DAXA 1G9DA 1LOBA 4L99A 4LXLA 2RR12 5F3IA 3T4VA 2JMJA 4L11A 1WEVA 1YIPA 2BERA 4AGVA 4ES9A 2JDHA 1TMF1 1NLQA 2VR4A 4CP1A 5K0UC 3NNFA 4WVVA 4DEVA 1PGL2 2AENA 1I1EA 3BU0A 3WQ7A 3VBUB 4E4HA 2K1JA 3AFKA 1QQP1 2VZPA 4F52B 2OPKA 3Q8AA 1HB2A 2OIIA 5LA9A 4Z07A 1WEOA 1E5SA 4YVSB 5FRAA 5FB1A 5H9QA 3OYWA 1CVNA 1WA6X 4IE5A 5A6YA 4L2NA 3CL1A 4RN5A 5JOXA 2W39A 4E8CA 5I91A 4M0HA 2WBKA 5F5IA 3O1MA 5IFPA 1OOPC 5DAQA 3MUZ1 4CEYC 3CQOA 2XBO3 1FX5A 3M3IA 5FXVA 1S2EA 3I2HA 3G7DA 2RE9A 3W5MA 5BNNA 1VBB3 4K20A 3M4FA 5CA6A 1LHUA 4IDZA 1NG0A 2BP6A 1FNZA 2DTWA 1LHVA 1UN1A 3E6BA 4Y1XA 1EPWA 1C8M3 4F83A 3WXPA 5GALA 4TXWA 5H9PA 4XJAA 5FZ0A 5FZOB 1J1LA 4HL0A 2MHFA 4ZY9A 1BXHA 1QJU3 1DDLA 1CPMA 3IN9A 1CAWA 5KXCA 2V09A 5FBJA 1WEEA 5LKZA 3ACHA 2BBAA 2FHRA 4INDA 4AWDA 1AVBA 4FP2A 2HEYF 2Z2SB 3TBDA 5JAXA 4QHOA 2HWC2 1AR91 4LKEA 1W3XA 3MIGA 3TWIA 2BFUS 1MQTA 2OQ7A 5IUQA 5A1FA 2YHNA 1SQ4A 5JXGA 1UD1A 4LO5B 4Q26A 3D82A 4QHBA 1U5IA 3E5XA 4XXPA 3RMXA 4BIFA 4I30A 2B8MA 4M01A 1UMIA 5JI9A 4Q4Y2 1DBNA 4YM2A 1RUF3 4XF1A 4GNFA 4OGCA 2XQRA 3ZPOA 4BYYA 4PI2A 4DO0A 1POV1 5FYCA 1RUH2 3SH3A 2FBEA 1VE0A 5JIAA 5H9RA 1WENA 4A6OA 5LEJA 5FLHA 2CONA 4XDOA 1CAXB 1JOCA 3WHTA 1ZA4A 4TSVA 4FOYA 4QPIB 2VZOA 4EN8B 3CZJA 1H6XA 2GC0A 2RM21 3DPRC 3EXUA 3N3HA 4OZOA 4QB6A 4COWA 4E27A 5DMYA 5FO7B 5FUNA 1UY2A 3L1XA 1E57A 2BFUL 3IT8A 2HWD2 5A32A 1V9U1 3JQXA 4CA9A 1L7RA 1BVVA 5FZFA 3S6PA 1US2A 3O5SA 1XNDA 3MLLA 4XACA 2HEWF 3OEAA 1S0IA 1O5LA 5J96B 1WLDA 4NPMA 1R093 1X4UA 5I8SA 3RZMA 2Q8DA 4GH4A 4BU2A 5EJ3A 2JJ6A 4IGQA 4Q5OA 1J83A 1H2NA 1IS5A 2NP0A 2PAEA 1C5HA 1VRH2 2Q8EA 4QWNA 2WL1A 1ONAA 2WSUA 3LIHA 3P3PA 2OX0A 2M1RA 3ILRA 3LSDA 4GAZA 4AFCA 4WZ2A 2JG9C 2GH8A 3KLSA 4Y1YA 4P9LA 4LO8A 5IVEA 2MKEA 4R8HA 1JYXA 2ZAHA 3A7QA 3I2FA 2WLPA 3HBZA 5C3SA 2QQOA 2O0OA 2ZGQA 2VE1A 5K0UA 5HXMA 4X3GA 4QQ4A 2XJVA 5FY1A 3OGRA 4WZFA 3S57A 4CCGX 1LOFC 3AK0A 4Q8LA 3I2IA 1YQ2A 4BLJA 1PO22 4YFWA 1SDWA 5AC93 1Y7BA 2WAOA 4CUAA 4O64A 2JXAA 4PCRA 3H8RA 3ZFFB 3VBFC 3B01A 3LA7A 4N53C 5ACA3 2YT5A 2PHWA 3BIEA 2QTWB 3OOXA 4MUVA 3EHKA 4YGEA 5LEKA 1CR7A 3T4HB 2WIIB 3GDBA 1OOPA 4CEYA 2VM9A 4CU7A 3NMBA 4B7EA 1G25A 2DVBA 2WO3A 2K46A 5IVBA 3DKQA 1BVP1 3RPQA 3M99A 4P9YA 1W2AX 4RHV2 5EQUA 3H1YA 4IC3A 4I3PA 5C3OA 4Q4X2 2LXHC 5CG8A 3ZVZB 3HJRA 4PJYA 5JCTA 1WMDA 1FT9A 3ZSEA 1DQ6A 2NZ9A 3ZXFA 2YFZA 2CRRA 1LOAA 4YG0A 3JD71 4V3LC 3BCWA 4QX3A 3SH5A 4BHWA 1CJDA 4IE6A 4YARA 1AR73 2QNKA 3WW2A 1O3SA 1XWHA 2VOWA 3P5BA 4XFIA 2ZA9A 5T3NA 4B4PA 1YQ5A 3UGHA 5B78A 4J25A 4CCKA 4UXAA 2RS31 4Q1RA 1SDDB 1W0OA 4TWTA 1V00A 3JB4C 3KVAA 4XJ8A 2P37A 3KQ4B 1JYNA 3JBG2 4QXKA 1UNBA 3A0NA 5FLIA 4AOCA 3U5PA 5FZ4A 3OGGA 3VD3A 5C8CB 3FBYA 1WW6A 4XFHA 4NIGA 5DINA 2P17A 5FZDA 5K3QA 4L92A 5DDJ1 4C8DA 1X36A 2E7AA 2PHXA 3TN91 4LO7A 5IK4A 1MS0A 2R042 2VJEA 4LLBA 2CDPA 1MZ5A 2ZEZA 4MGZE 3H1MA 4LIUA 4BB3A 1PO13 5KHIA 1NQDA 5B75A 1DYKA 4XC9A 3O1UA 4X8PA 2FQPA 2GSYA 1BEV1 2VULA 3MIDA 2VL4A 4JRAA 4UFIA 1RJ8A 1TNRA 2VG9A 4HANA 1DVPA 1SLIA 4UT5A 4I02A 4XHXA 5DUUA 1BORA 3WF3A 1AUYA 1UU5A 4RQPC 2PHFA 1LTEA 4JCKA 3NKTA 4ZXEA 5FP8A 3OYWB 3WNXA 3WF1A 5LY1A 1LENA 2W68A 1JMUB 1NCQC 1SLLA 3I49A 4XMAA 1ZRDA 2QCSB 3SUBA 4CPBD 3DPRA 4DPNA 3VD4A 1LOGA 3KT7A 4Q6FA 2VZ1A 4XF4A 1PNGA 4DQAA 1BYHA 2ORZA 2ZGOA 2HJIA 2QKDA 3AXEA 4K1ZA 5EWSA 4P9WA 4PLMA 4Q2FA 2IXLA 2VZ3A 3GBGA 3BPZA 3KV4A 3VDDC 3PTYA 1ULDA 4XETA 4UWDA 4CDQC 2M13A 2ZZQA 1YXWA 2B5HA 1PVC3 1FOD1 4GNDA 3OUJA 3FE5A 4MGTA 1RVF3 3GJBA 3J4UH 1RUE1 3WVJA 4CZSA 4EJRA 4LBQA 4AI0A 3F95A 3O1SA 2QJVA 2WS93 2ZX0A 2MA6A 2JG9A 4LMFA 1MVEA 5FPBA 1LB2A 1BBT2 2GMEA 4RYDA 2N7GA 2FCTA 2MD7B 2VY0A 3C7HA 3FANA 2RHPA 1OXCA 2FD8A 5TABA 4LHLA 3FHIB 1Y3TA 4DRRA 3R4UA 1HJFA 4R7EA 1MZEA 5J36A 3QH7A 5FJHA 1MQTB 2DTYA 4YFZA 2PNXA 2RDRA 4M4PA 5GZCA 4FPOB 1W6PB 1XE8A 2JDAA 1V6LA 5CZKA 3DPLR 3L1ZB 1YFUA 3TEZA 1LOFA 1SBFA 1GWLA 1UAIA 2K9ZA 2NLRA 4P9XA 4YGBA 3MHSA 4UBGA 4PIZA 2VMHA 3IHPA 3RWNA 3UKNA 4MX3A 4CCCA 2JIGA 3VBFA 4CUCA 4N53A 4UW3A 2GDFA 4MGIE 3O33A 2D3SA 2QBXA 3U5NA 1PM4A 2A71A 3OBRA 2YHOA 3N9OA 3VZMA 1EUUA 3FUQA 3KV6A 4LOTA 4YBMA 4AFAA 4YRDA 1GZWA 2A6XA 4P02B 3PHDA 4K21A 5C9AC 3SXWA 1EV11 4YABA 3FUOA 5SV5A 2SBAA 2WNEA 3OG2A 1COV3 1XU2A 4JC1A 4QQOA 1HIXA 2GAUA 5FZ6A 5A32B 3CDZB 1UZZA 1H9PA 1O8PA 1OLME 1HN1A 2HWB3 2EIDA 3NAPC 4BXSV 4XBLA 3S5AA 2Z79A 4EQVA 1MBMA 2WO7A 2WNVC 2XLGA 1AZDA 5F2SA 1OUXA 5HCFA 3WG4A 3ZDVA 1A3KA 3OJBA 4FP3A 2YBSA 4GH4B 4N43C 3KHBA 1G86A 3NV2A 2KD7A 3IDAA 3V56A 2VCAA 5LATA 2R49A 4QDQA 5EJZB 4DXTA 5K7PA 3U75A 1XRUA 1HKDA 2PHRA 3T2QA 2UWCA 4AUQB 1JN2P 4DIQA 1WCSA 1ZRIA 2J1TA 2RDSA 2R0FA 4V2VA 1UQXA 1ZZCA 3LD8A 4P14A 2LGKA 2A6ZA 4MYEA 2YW8A 3M70A 5IAXA 2JDZA 2DDUA 5T55A 2TUNA 3NJYA 1H30A 4ARYA 4FSJA 1S0DA 2MEV2 3QOPA 2EIBA 2QQIA 2VVDA 2WYFA 2CHHA 1EYBA 4GD4A 3PTRB 4IE7A 4HVQA 4Q4W1 1UPIA 1GQGA 2Y34A 5J3UA 3FAOA 2DCZA 2VNRA 3MF6A 4NHYA 4RQPA 2LRIC 4QKDA 2R063 4UFMA 1RHI2 2G45A 1YHFA 3RRDA 3KGLA 4ZPIA 1YWKA 2DCKA 1A8DA 3NV1A 5FP3A 5FYZA 3B94A 3T2TA 4JTNA 5JPMB 2QICA 1OOPB 4XIOA 1HXS2 2AH2A 4AVCA 3L9JT 1HV0A 2PLV2 3U07A 2RR13 4FPHA 3ZPYA 2WZR3 1U5ZA 2VC9A 5C3RA 3ZLIA 1F62A 2YU1A 5FYVA 3JB8A 1CZSA 4A7YA 3EYPA 2XOZA 1E5IA 2I74A 4XDPA 2WUHA 1VBE1 2ET7A 3VBSC 3VDDA 2J22A 5LB6A 3ES1A 4CDQA 2Y8KA 3N7KA 1W9YA 3RJ2X 1ALYA 4FPEA 1H2MA 2LGGA 5F6KA 2JM3A 1NA1C 2R071 2W0XA 3JU9A 1LGCA 2J7MA 1QXPA 3IBMA 2FDJA 4NPRA 5ERLA 2KR4A 2X5IC 2PTMA 2WFF3 2D97A 1AR61 2AEZA 4RD7A 5FXXA 1BZWA 1FBVA 3WV6A 3LPFA 1GKBA 2PHTA 4TLFA 3KVBA 2CNAA 4X6QB 4Y33A 4F7ZA 1V6MA 5IVVA 2FMDA 4UP5A 1UCXA 2I2SA 3MUY1 2WWUA 5JI7A 3WT3A 4FOWA 1WD3A 3MZHA 4URTA 3VKFC 5JXHA 1BHGA 1NUKA 1STMA 3KZ4C 3LEMA 4FXKB 4HLTA 4LLOA 2PAKA 2K16A 2VJEB 4A0CD 1UWWA 1OA4A 3KV9A 4HBNA 4HMZA 2XB6C 3J8F3 1AXZA 1J58A 5K4LA 5I3LA 4JV4A 4WM8A 4GXLA 4XHBA 2VNFA 4X8NA 3AL5A 3M1HA 2EXUA 4AI1A 3GHMA 1RUJ2 3LGRA 4M3CA 3AKSA 3WSOA 4BOWA 4WZ3B 2FUUA 2WO1A 1N1TA 2UY9A 3NV4A 4XF9A 4H7MA 5IT6A 1W6MA 3VUOA 4W4ZA 5LA1A 1LGBA 2WNUC 1QKQA 2VBBA 1IQAA 1CPNA 5LASA 1Q8QA 3NO8A 2EODA 5C9AA 3V0BA 1QWRA 3ZSKA 4NAOA 4M0NA 4AVBA 4LO4B 3POJA 2Q4SA 1POQA 4E2SA 5L19A 5A7SA 2DF7A 3H3ZA 1KD7A 3IZOA 3OPZA 1VBB1 1Q43A 2XOMA 1VJ2A 2D3RA 2I45A 4JKKA 3OD0A 1CIYA 1YLLA 2FDFA 3WHUA 1GFF2 4A4AA 2VPGA 3V43A 5A3WA 3ETPA 1RXFA 4LE3A 4RGKA 1VBC2 5FMOL 4ASKA 1C8M1 1WESA 1PIV2 1VBD1 1HQWA 3HIFA 3FN9A 4JKMA 4NHKA 3OUHA 2XJPA 4N8MA 4ZZ5A 2WNVA 3ZSMA 3THPA 4B1MA 2GZWA 1UF2C 2J1VA 4AI3A 2Y33A 1QJU1 4IEZA 2Q30A 2Y6HA 2QQWA 1O3QA 4IE0A 3TAYA 1SBEA 1RUH3 2IFWA 4N43A 1C57A 1WBLA 3R0RA 4QX5A 3V0AA 5HV4A 1Z7S2 1N1YA 2YSMA 4XFGA 2YZ4A 2PHLA 3WNOA 4SBVA 4XE9A 1WE9A 5FZGA 1AYM2 2FCVA 4ZKTB 1YO8A 4GB33 2CAUA 1F9KA 1ULEA 1WLWA 2JG9B 3MPPG 1PMIA 4LA2A 4LEJA 2X05A 4AQSA 5HBAA 3HCTA 4ZUXU 1IS6A 1RMU3 3PU3A 4P9JA 4A45A 3QH6A 4OZXA 4YM3A 2L0BA 2ZX4A 1UMZA 1PGW2 2HWD3 1H4GA 1TE1B 2OZ6A 3IIIA 5LBCA 2HWE2 1LCLA 3RZZA 1RUF1 4AEDC 3T6RA 4XAAA 3SNMA 4JGZC 3SKJE 3GV4A 1CJPA 3N7JA 1LDKC 4LQRA 5DPNA 2LROA 2E6SA 1PM7A 4BCUA 2P1BA 2XWBB 4AAPA 4S2HA 4R52A 4LO6B 1KS4A 4KBBA 4FTBA 1WA4A 4YW7A 3ITQA 3VBFB 1JYWA 3OY8A 3C5KA 1UYXA 2XWJB 4NJ4A 2LRPA 2CV6A 1MM2A 4L8QA 4QHZA 2I50A 4XCBA 2O1QA 4KG8A 4OMDA 2PQSA 2H0VA 2M85A 4A3XA 2YPJA 1GZWB 1JU3A 3H7YA 1GP6A 1K45A 1MZFA 3HEIA 2XDVA 1R1A1 4Y5Z0 1QDOA 2UYAA 5FTTC 2Y60A 1JZ6A 3DXUA 2BBVA 1DU3D 3ZTGA 3PHMA 3H1WA 3DDTA 3VKOA 3LIGA 2VNVA 4QMAA 3WLUA 5JOWA 1R091 4LBLA 1K12A 4XJ9A 1JBCA 1FATA 2JE8A 2KM2A 1XNTA 2V72A 2Y38A 3H0OA 4LBOA 3SHRA 4EZ4A 1NA1A 4LLFA 1PO23 1JZ3A 3WF2A 2CAVA 4PIXA 2P6CA 2QQKA 2X53S 2X5IA 4YLZA 4CCEA 1IPKA 3WP3A 4HT1T 3RG0A 4FFGA 1OLRA 3DGTA 3UNPA 4QPYA 3AYEA 4JQTA 2XJSA 1AX2A 2BUKA 1M06G 2AREA 2VMFA 5GLTA 4XJZA 1VAVA 5FZBA 4URAA 2W47A 1UOFA 1UXZA 4JDOA 2BWAA 3I3MA 1DGRA 1WMXA 1LU1A 1Y43B 2P3YA 4RR3C 5F5QA 5HPOA 3I2KA 3USSA 3BU7A 3P6BA 4OHVA 3HMYA 4HKWA 2AR6A 4LITA 4RHV3 1LKNA 3DYPA 5HV0A 2LGVA 3WDWA 4A4BA 4Q4X3 5AVAA 3WCRA 1JHNA 5CVRA 1N87A 3TNQA 5A1LA 4CEWC 5CYYA 3ABZA 1XBFA 2JKXA 2WZEA 1TNFA 3ATGA 5AC91 4LADB 3DKWA 4KBZA 1WGPA 5JR7B 3HPNA 2XUMA 3GXUA 4K40A 4WVMA 4XQ4A 4YZ4A 1WEMA 2L5UA 2EXJA 2F4LA 2WNUA 3C7GA 4RQPB 5IK7A 3N9LA 4AL9A 2KYUA 3O36A 2XJRA 4DB5A 2E6RA 3S7IA 2C2VS 1HRI2 1UW8A 2CGOA 2YUEA 1WCDJ 3JBG3 3JZVA 4E4DX 1D2SA 4YZ5A 1VAMA 1F5JA 2LUWA 3EB5A 2ILMA 2SLIA 5L73A 4P5OB 1OF4A 3D0SA 4FJCA 2WWSA 1W2OA 1NT0A 1D7PM 3I2DA 1LRHA 2D6OX 4OCTA 4D8MA 4AZZA 3U4XA 3BI3A 4E4SA 3LKJA 1S0CA 1SEFA 1UOJA 3O35A 3M3OA 1BMV2 4KI5M 2ZGTA 3NJVA 3PJYA 2WR9A 3VDDB 3THDA 4DY3A 2VW1A 1MACA 5FBZA 4CVUA 5C6CA 4Y3OA 2G9FA 2QQMA 4CDQB 4Z8BA 4OQ8A 2JMDA 1G9AA 1YQCA 1LU2A 2GC3A 3A23A 1G8WA 4DUXA 4BMEA 5IVYA 1GOGA 3ES4A 4DXZA 3MW2A 2C26A 4Q0VA 4TKPB 1IQDC 3I2GA 5FY9A 3UYJA 4B3NA 2LM3A 3NNMA 5T50A 4OQ9A 4DOUA 5B77A 1EAH2 3ETQA 2B42B 2D93A 2P6HA 5B4NA 5FZLA 1YFYA 4XAEA 4CP9A 3THTA 1IOAA 2K17A 5LA2A 5LKTA 3B5LB 3RZGA 4ZU7A 5FK8A 3ZYFA 4FT8A 4ITCA 3I2JA 1C5IA 1PO11 1S1AA 1GNHA 1W8FA 1X9PA 4HETA 1VYXA 4GNGA 3VKLA 1R64A 4ZDTA 5H1UA 5FERA 3CJIC 4AEDA 1L7LA 3LZZA 3QBQA 4J1XA 5JSPA 4V3KC 1TMF2 4JGZA 1FPN3 1LEMA 2RS12 1DLCA 4QB2A 1S0JA 3AJZA 4WM8B 2EVXA 5EIYB 4YVWC 1YCIA 1APNA 4GWIA 4S2GA 3D8CA 3GZAA 2CSYA 2IXJA 1O4YA 1QQP2 2O8QA 3KWVA 3WX5A 5FY0A 1GU3A 1OMIA 4M3CB 4NUBA 4UBHA 4XPVA 5KR7A 4NN2A 1C28A 3KD4A 4XEZA 2WZPP 4OMCA 1W6MB 4B1LA 2QDRA 3USUA 5F37A 1QXJA 3CZUA 5FDBA 3PIGA 2C2LA 4AF9A 1CX4A 5BNOC 3NQHA 5C9AB 1H1MA 4LJHA 3AP6A 2CL2A 4CCDA 2Y0OA 1AF9A 1H2KA 4AQTA 2VXJA 1GYKA 1A78A 2VCBA 4NR1A 3U11A 1XU1A 5C5UA 2UYBA 1WMEA 1VBA2 2QQPA 5A70A 3ZMNA 1PX3A 4N9IA 5JUVA 2RSDA 5FZAA 1CD3G 2C6SA 4XBQA 3MBWA 5KH7A 3VN4A 1PVC1 3VK6A 4LOSA 3R4SA 5H1TA 2WNVB 4LKFA 1RVF1 4LHKA 2HWF1 5FZIA 3EB7A 4CDUC 3BTYA 1ZRFA 1R081 5JXIA 2Z69A 4FPJA 4N43B 2WS91 5GLVA 3UESA 2VZTA 5FPUA 4JX0A 2DBNA 1REEA 3AB0A 2WQ8A 4O65A 1YYNA 3JUEA 3O12A 4I2OA 1WEWA 3X29B 3UK9A 4BQ3A 3MW4A 2ZHKA 2CT2A 2DCYA 2JG8B 5CAZA 3H50A 4CCMA 2W08A 4LBJA 4RR3A 3U4SA 5GZFA 1NLSA 3UV9A 5DQ0A 1LOCA 2Y6KA 3VB9A 2NM1A 4QGLA 5FY8A 4CEWA 1LJ7A 3V65A 3JCIA 3H8XA 1RYYA 1LAJA 2W92A 1RC6A 2YXSA 4L97A 2RR4A 3NNLA 5FXZA 2AZ5A 3UJOA 3QACA 5FYSA 3PUIA 4D3WA 1OKQA 5BNQA 3M7KA 1GSLA 5B79A 2ECGA 2C24A 1I6XA 2WZ8A 1KS5A 3OGVA 4FPKA 1W8WA 1JW6A 2BGPA 3VHPA 3OY8B 3GYDA 4XVHA 4AI2A 3MHHA 3OCPA 2W46A 4C0BA 4XF0A 3I7DA 2W1QA 3CF6E 2NYYA 5FIXA 2DVAA 2IC1A 4OGEA 3MYXA 3WG2A 2A75A 3DV8A 1COV1 3LEGA 2VBDA 5IVFA 4L7XA 1N1VA 1KDKA 2YDEA 2HWB1 3WW3A 2JDUA 5F2WA 4ET7A 4O9GA 2D8UA 1SPPA 1PNFA 2QE3A 3LA2A 5IAVA 1WWYA 5JOZA 3E2DA 2MEV3 2VUCA 3MIHA 4A3ZA 1W90A 3OPTA 5DAVA 1Q8OA 1WW4A 5DABA 1DGWA 3ZN4A 1NA1B 2BPA2 5A3NA 4I3GA 2MNYA 4D0QA 1NKGA 2C1FA 3FX3A 2X5IB 3WF0A 4WBBA 1PK6C 1UZWA 1UOBA 4FAGA 1W28A 5T52A 1OURA 5KWRA 4BQXA 3T1MA 4BZ4A 2LQ6A 3RVHA 1E5RA 2UY8A 4QGNA 3T9KA 1K5JA 1OC1A 3FFZA 1RUOA 3D3AA 3MW3A 1HXS3 4S3OC 1OQ1A 1KDMA 2ZOEB 4GZ9A 2BAYA 4WV8A 1GUIA 1GOHA 1TME2 2E53A 1DLLA 2XQXA 2R0HA 2JENA 3WP6A 2L75A 1JUHA 3K4DA 2W94A 4TTGA 5LZ6A 1OLMA 1MS8A 3H42B 2Y6JA 4YVWA 3ZVXA 3B00A 4IL7A 4RS5C 1VMJA 3O0WA 3RZJA 4IEPA 4MH0E 4CUBA 3UKTA 2WA3A 2R061 1JYVA 2JE9A 3VHNA 4RFT0 3R05A 2KE1A 1NY71 1NE4A 4BLIA 2XVKA 2QVSB 1WIMA 2BNMA 5M0TA 4WVMB 1FMD3 3W5NA 3DQVR 4F1PA 1H1IA 2WNUB 1ENQA 4GKXA 5EV7A 4DXRA 1X4JA 4AHXA 1W0NA 2VZRA 1S55A 2YQMA 1POV0 1FXZA 1HW5A 4PDWC 5BNOA 4TZDA 5JG6A 4XFFA 2XJTA 2RR11 5L9BA 2A3YA 4J6GA 2WN2A 4ASLA 2WZR1 3CMGA 3WEZA 2OXQC 1NAEA 2AYHA 3D4KA 3FHAA 1VP6A 1DYPA 3O37A 1KJLA 1JOJA 3IAQA 1YI9A 3PL0A 2Y6FA 2D6KA 3GBFA 2ZPXA 1ZBE3 5TSWA 2JECA 1MS1A 2MA5A 3VDBA 4KU7A 4AYUA 3J7LA 5GLZA 2H0BA 4AHYA 4I7CA 5H1VA 1IGOA 3I2OA 1OI6A 2R1BA 5FYYA 1YFWA 2YGMA 1DCSA 1RUG1 3JD72 3NVCA 2Z5WA 3I59A 3NJXA 1QXRA 1VPHA 4CDUA 2WFF1 3N7LA 2Q1ZB 3WDXA 1QJY3 1V0AA 1W2TA 4GIQA 4XUQA 5A3TA 5BNPA 5SVYA 3APBA 3HQXA 3ZFEA 2E26A 2VZVA 5FZMA 4CDXC 2QUOA 2VMDA 4MXWA 5E16A 1UKRA 1IPSA 3DYOA 2JD9A 2VMIA 3FFQA 4D6SA 3N9PA 1K3IA 1X8MA 3LEIA 2EALA 3JXSA 4CU8A 3TNPB 4QF2A 1UY1A 1XQNA 3ZN5A 5DDJ2 3J8F1 3KCCA 3TN92 4C1XA 1RUC1 2BWCA 2VPEA 4YM0A 2RMU3 5G04L 1VBC3 3AYCA 4Y5TA 2PYTA 4YW5A 1ZA7A 1PIV3 2BGOA 4AEDB 3ZYRA 4JGZB 5FYMA 3RZLA 4YW4A 2P5BA 1SLAA 4Q8KA 1BEV2 2OKXA 4BQ1A 1BK1A 2GP3A 1HYIA 2D7FA 4P9IA 3PIJA 1RUD1 2W1SA 4HKLA 2G1MA 4YSFA 1YQ8A 3BYWA 3KHCA 1L7QA 3ZYIB 3KT1A 2IDAA 1F31A 2KGIA 1HJGA 4FPGA 2PUYA 2IXCA 2E7TA 1UX6A 4N3WA 3USUB 4IV1C 4M3CF 3MV11 3DN7A 2FFWA 1WZXA 2XOYA 3H7HA 3SH4A 2BQPA 3WDYA 2CGPA 3AKPA 1HRV3 3Q1DA 3H3LA 1FI2A 3ZXEA 5DUWA 4Z0RA 4JZRA 3CLPA 1LOEA 2HWE3 2VBPA 4IEVA 2WT0A 5FKCA 1SZBA 2IVJA 4HN0A 1JM7A 4ATEA 3H7JA 1GZCA 3GM8A 3U5OA 5F9TA 5C71A 4Y5SA 1RUH1 3WNKA 4R9BA 3LQJA 2CSGA 4OHWA 4FI9A 3AKTA 1CHCA 2VVFA 3TEXA 4XQDA 3ZR5A 1FOD2 3GBWA 4PQQA 1PK6A 4GB31 2YURA 2ZMNA 3Q8CA 2CU5A 2B7YA 1NOVA 2NN8A 2CDOA 4P5HA 4UFKA 3LB9A 1RUI2 3Q8BA 2KWNA 3KNVA 1RMU1 4IEUA 1RTVA 1O7FA 4QX2A 2V73A 4EWDA 4PHZA 2VUJA 4RR3B 1REFA 5EFUA 4COVA 3GJAA 2OW4A 5A33A 3VBHC 2HBUA 1OSGA 3N9NA 3O1TA 2J42A 4Q29A 3KS7A 1H9WA 1W9SA 3K46A 3O0VA 4FAHA 3I3BA 4RS5A 2DCTA 2XB1A 3SOXA 1Q56A 1ACCA 5FXWA 2ET1A 3F2ZA 3AKQA 4MGSA 2E63A 2I07B 4EROA 5GM0A 4K1YA 3ZOIA 4Z92B 4H2AA 4JQRA 4OYUA 1ZZBA 3U37A 3C7OA 4QPWA 5I93A 5D1MB 1HB1A 4PDWA 3AVSA 3W21A 1OD5A 3KF3A 2DUPA 1H1AA 2GMPA 3RPGC 1MEC1 5B8DA 1SHWB 3V64A 4Y4RA 1C1FA 1US3A 1XPWA 2OVUA 2A3WA 4GWNA 5CU1A 1ULPA 3GHNA 3VKMA 1S0EA 1HV1A 4DRVA 2YBKA 3ALQA 3IAPA 2XR4A 3M3EA 1QOTA 5FPAA 2C9KA 2DVDA 4MGQA 1GMMA 4CCNA 1SPPB 1DQ2A 2DFBA 1OPOA 2ZMLA 3C7FA 1G7YA 2LTNA 3HBKA 2W1UA 5BNNB 1YC61 1QJEA 1DFQA 1PO21 3BVCA 3JQWA 3M63A 5C13A 3ZPVE 2V5DA 2XH6A 3A21A 5G05B 1CIWA 1MS9A 4FOQA 5EPAA 1W39A 1ST8A 5F1RA 5T5OA 4WVWA 3BPSA 4OI0A 2ZKNA 4XF3A 2GNMA 5CG9A 4AQ6A 2W95A 2P3KA 5L9RA 3BTXA 1DG6A 1CAWB 2MNZA 3SKVA 4LBMA 1UZVA 2DUQA 3O0XA 4RHV1 1ASJ1 1ND3C 2R6QA 1Z2QA 4Q4X1 5AFBA 1NE6A 5A7QA 5SVXA 1SFNA 3AMQA 1I9RA 1LULA 3PUSA 4EN9B 1QJX2 3PNAA 3WQ1A 1O3TA 5IHRA 1VR3A 2VNOA 4NOTA 5BV6A 5J48A 1GWMA 1SLTA 1UZ0A 4CP2A 3VD9A 1UMHA 5ANNA 3UGFA 3O47A 1AYN3 3WQBA 5CFCC 5E89A 4YVWB 3S5QA 3IMNA 4Q4W2 4UF0A 3SCFA 4ZS2A 3ZXGA 4HOOA 1VMFA 1C1LA 1OFSA 2VUDA 3CJXA 3JBG1 1CZTA 4YPJA 2VUAA 4J1WA 1AR82 1OQDA 2B46X 2RDQA 1K5MC 1QHDA 2YROA 3LSEA 3M8LA 3MV01 4IV1A 1V6NA 1EAH3 3UKVA 4BH9A 3WW1A 3EBRA 1X4IA 5A1AA 1SG3A 1AX1A 2QZ2A 1DIWA 3DL3A 4UW6A 3OF1A 2KWJA 4IXLA 4P5YA 4F8AA 2X29A 3I3DA 3FLTA 5D2AA 4KG0A 1G9BA 1UY3A 1UYYA 1N47A 3M2MA 5JWPA 4CDWC 2VMCA 3PVOA 1GZTA 4KWLA 4EE2A 3ON7A 3QZVA 1DGLA 1J3RA 2D6PA 2RS13 1VBE2 1U12A 2MPFA 2XLAA 5BPXA 2R30A 3M7AA 1G9FA 3ZYJB 1QQP3 3J26N 1Y9QA 5C3PA 3I59B 4CDUB 5FUIA 4A7ZA 4MG2A 1S2BA 5CFDC 4YGDA 1W3VA 4LHNA 1QIQA 5BNPB 1AR62 3ZFEB 2JMIA 5LKXA 2VXRA 1AHSA 1AL23 1N1SA 4QXBA 3AXDA 2IWGB 3FHQA 4MXWB 5FQ0A 3D5OA 3ELNA 4XOGA 3DECA 3RWKX 4MHRA 2EAKA 1VMHA 1X33A 3LPGA 3OUIA 4Y1ZA 3SHBA 4E9KA 4NIDA 2XHKA 3VBHA 4AFDA 1FPN1 2QQJA 4ES8A 2L43A 1O8SA 1VBA3 2VJFA 2PAMA 3FJUB 4C9ZA 3WOGA 4CPBA 1WGMA 4IUGA 3LQHA 5K0UB 1Y4WA 1JHJA 3AP5A 4AYCA 2XJUA 1ZBA2 2ZEXA 3EJKA 2E61A 1HB4A 2H6BA 3NKGA 4O9EA 5DZGA 3L2HA 2D5FA 1W0PA 1JOPA 2ZJCA 3IDEA 5FP4A 4MGKE 4H9DA 2V4VA 1W99A 5FPZA 5SVIA 3MF9A 4JHZA 2ARBA 1DZQA 4R4XA 4AVTA 3LE0A 4D69A 1JTZX 1NCQA 3MIBA 3POSA 4Q4V3 3WNNA 5KXEA 4EWAA 1GOFA 2VOXA 3ZYHA 3RYPA 4CEYB 3LCPA 4LHSA 1KFUL 3VL8A 2EA6A 5FV3A 1ZZ8A 5FMCA 3T2PA 4BJ0A 3MLJA 2K2SA 2BV4A 3HT2A 3K77A 5L7OC 3O70A 1LECA 5FZ7A 2ZHLA 3VBUC 4YBTA 2ZHNA 2ARXA 1C8M2 4I01A 4R2YA 1VBD2 2EAAA 3ACIA 4WM7C 1VLNA 1JM7B 1VALA 2ZX1A 1GP4A 1ODNA 4HKOA 4QX8A 3TB0A 4AGGA 2M6MA 2HKXA 1MZ6A 3EQEA 5KHKA 3VD7A 4K3UA 2NQYA 1PHMA 4G9SB 3VV1A 4BE3A 1HQNA 2X10A 2WN3A 5F3EA 1PK6B 3T2OA 2D8SA 4NWVA 2A6VA 4LNVA 1D4M2 4K8RB 4Q0PA 2Q1FA 1GLHA 4BQ4A 1HB3A 4ZS3A 1ND3A 4LKDA 4S3OB 4Y20A 1HN0A 4YAXA 1P8JA 2F17A 3S7EA 1SFPA 5A33B 1EP0A 4ZHNA 1OA3A 5IVCA 1JS9A 2XGXA 2W5FA 3LOIA 2KREA 2GMMA 2VW0A 5CFCA 2BRTA 2AGSA 4FO9A 1Q8VA 4QQ2A 3AKRA 1ZRCA 3AX4A 1PVXA 5B4XA 4GMP3 3OBAA 5C8WA 3LQIA 2ZGPA 3T1LA 4KL1A 2FDGA 4QPGC 1K5MA 3OPWA 4UFHA 4B29A 1QJFA 3SMHA 3HNBM 2JUNA 4PDWB 3FC0A 4QQLA 1IYMA 2XBO1 1OPMA 2OPWA 3RI8A 5TDRA 4ISRA 3HOBA 1UO9A 2HWC3 2YREA 3KM5A 1R1A2 2KA3A 1QMJA 3DPRB 1TME3 3B3QE 2GC1A 4O61A 4YG3A 1JXNA 4IQPA 5F39A 2DU1A 3EMRA 4CDWA 3B7MA 5FYHA 5A3UA 5LA0A 1KGYA 2DVGA 2MEV1 2JKBA 5KC6A 1YNAA 5F8PA 3NAPA 1G9CA 3M3QA 3NNJA 5ISLA 4LBKA 4QKFA 3BIWE 1R092 2LGLA 2DVFA 4BQ5A 4B86C 4Q4Y3 3ACGA 1V87A 3AZWA 1DP0A 2ZAAA 2IXKA 2OS2A 3VZKA 3W58A 1F8VA 1X82A 2M3HA 5KC5A 4WZ0A 3MEPA 4YW2A 5J37A 5CFDA 1JZ2A 2YC2A 2B0OE 4MSVA 1PZ8A 4UFLA 5H9SA 1OVPA 2RS52 4QPIC 4LBQB 3R6SA 5LK7B 1HXS1 3RZHA 3ZNIA 1E5HA 4KH9A 4XCAA 3WR0A 2G4IA 4LKSA 1W06A 5F5CA 2WJSA 4O62A 5APAA 2Q8OA 4BXFA 4AE2A 2YVRA 1X50A 1LHNA 2MD8C 3CBNA 2ENRA 4E2GA 5C4WC 1DGWX 1DQ4A 2XXZA 3ZFGC 4F3JA 3IM0A 4NRMA 2ARAA 1D0GA 3CHXA 3SITA 1DQ0A 4QX0A 2VNGA 3DYMA 4I7BA 1U5XA 4CXXA 4MVTA 5AC92 1O5UA 4I7DA 1Q3EA 2GNDA 1IPJA 1FMD1 1FAYA 4DINB 4UF0B 2PFWA 2D98A 2KU3A 4AR2A 5I8TA 4JRLA 1W9TA 4LORA 4N53B 1GWKA 1VRH3 2DU0A 4UOJA 5LBFA 4XJWA 1KRIA 5AITA 3IPVA 4E2QA 4IV1B 3EB6A 2C9AA 3MIEA 5LWBA 4U36A 2CGNA 4W50A 4CUGA 1JI6A 4DZGA 1UU4A 2Q5TA 3K4AA 4HSJA 2YU2A 1ZBE1 4FFHA 2YFUA 2TNFA 2KWKA 1S4CA 3IIAA 5A7PA 1H6YA 1MR5A 5L7OA 2D6LX 4BWOA 5AFEA 5B2GB 5BY5A 4R8PK 3T0BA 5CKMA 4WM7A 5DN2A 3CIHA 1OHFA 3VBSA 4CSWA 2QQUA 5L36A 2JDKA 2QQVA 2OA2A 3KQIA 1BJQA 1BEV3 2WABA 1U6GB 2VPBA 4CCLA 1QJY1 3LFIA 3RI9A 4LT5A 2ADEA 3ZXLA 1W9FA 1T2XA 1ZZ6A 2VMEA 5FPVA 2PHDA 2R32A 2B45X 1DHKB 3POWA 1LESA 1DGRN 3N9QA 4N90A 4FOVA 2CSVA 1YQ6A 4W8JA 5E88A 3WZ1A 4ASMB 2W3JA 5FYBA 3VZLA 5FQ0B 1XYNA 1HDKA 2WDBA 1MS4A 3W59A 3ZXKA 3PVEA 4A49A 4AVVA 4IERA 2E31A 4MADA 5A6QA 3TRSB 4XILA 5J98B 2DSMA 2G9GA 2RMU1 3DWDA 1VBC1 3RNSA 1PIV1 2NPIA 3VBHB 4ORFA 4IEOA 1XJAA 2VJFB 2GNBA 2OUJA 3I97A 5FEYA 2Y0IA 2W2IA 3PUAA 2YGLA 3AZYA 4OUEA 4AYCB 1O4ZA 4O7XA 5ACA1 4ZXKA 2EXIA 2BTVC 5D21A 4QPGA 1WCKA 2ZACA 2XKOA 3CKHA 3ZYBA 2RJLA 3POEA 2UZGA 1V70A 4HG6B 1XNKA 2EICA 5C8CC 3ZXDA 5TRBA 1HRV1 1RUI3 4QDRA 1W9WA 5SVIB 3RPGB 4FXGB 4FBFA 1KITA 2C0ZA 1FYUA 2VMGA 3K3OA 3HT1A 1NCQB 4GB0A 1UYZA 1PGW1 4FPYA 4QXCA 1QNWA 3BTAA 2HWE1 4AVSA 2A3XA 4ZQLA 2R043 1UZYA 1SLBA 4B4RA 2F42A 1RJ7A 3ILFA 4KGGA 3N4MA 2GC2A 3N35A 4HVRA 4H3WA 4YNIA 1AR71 4W6YA 4GWJA 4XZUG 2VZSA 1BKZA 3MFCA 3M3CA 2WKKA 4BK5A 4IEXA 4Z0OA 2F4PA 5DUXA 3ENRA 4MGYE 2ECWA 1RVF2 4M00A 3IDBB 2HWF2 4PT6A 1IG3A 1ZZ9A 2P2KA 5DXDA 1R082 4CU6A 2VO5A 3AMPA 3MI8A 5CISA 4DFSA 3AZVA 1XC6A 2JEMA 2E51A 4BQ2A 3OTFA 4NWWA 5DAWA 4IW3A 2IXHA 1C4RA 4D7SA 3H8OA 4YW6A 3UETA 2PHUA 2TBVA 3BGAA 5C4WA 1ND3B 4Y20B 5FYIA 1B35C 1JU4A 2LW8A 2VZQA 3ZFGA 5A7NA 4XXAA 3SOWA 2WT2A 2D44A 2RI7A 2DV9A 5C5TA 4KGQA 3HCUA 1I5ZA 3CNAA 3GL6A 4A4CA 2VQ0A 5T5JA 4FQZA 2W52A 5FWJA 2R16A 5A6XA 5FZHA 2FDHA 4D7TA 5CFCB 5LCWB 2MNGA 4QDSA 1F4AA 5CKQA 3VD5A 2KKYA 3MPBA 4NVPA 5F6LB 1D4VB 2JD4A 3LQCA 3WDUA 3ZKYA 2KFTA 3LF7A 4XFAA 4Y24A 4YATA 1ND2C 1NX9A 1VFYA 1EUTA 2RJ2A 1GQPA 1PX4A 3OBZA 1W03A 4FK5A 1BBT3 3V0BB 2P4EA 3IKWA 4S2FA 2KWOA 1WBFA 3LVQE 5FREA 3D6EA 5I0UA 3RDIA 5IYYA 3OBTA 4P00B 4K7JA 1XB9A 1X7NA 5HCHA 2ZZJA 4CDWB 3GF6A 5J09A 1QJX3 2RDNA 3ILNA 3NV3A 5KXDA 4ZZ8A 2RG4A 3WNPA 3NAPB 5GZEA 1R1ZA 1XNAA 3NJZA 2A7AA 4C90A 1B09A 3ACLA 4M4RA 1PZ9A 4UFJA 3MLKA 3HD8B 3LWCA 2L80A 4DXSA 2FDKA 2A73B 4FPFA 2HYXA 1WMFA 5IWFA 3ZYGA 2ZCWA 1L3JA 4AXOA 4E4ZA 3V0AB 4L9BA 5CFDB 5FZCA 1Q5OA 5G0FA 4XABA 1AR83 1A6CA 4W65A 3LVRE 1H8VA 3PLQA 1JYIA 4AHWA 3UT0A 4B8EA 3I8TA 2A6WA 5I0SA 1M4WA 5FZEA 5EJ1B 5EP9A 5FAXA 5CADA 3VZNA 1QGLA 1AR92 1RGSA 3GALA 1AJOA 1ENXA 4HZFA 4R9AA 4TYSA 4Y22A 5A3PA 1JZ5A 2KIZA 2QIZA 4JVAA 3L2YA 1BMV1 4GWMA 1W05A 3K4ZA 1RITA 1AYN1 1UIJA 1C8NA 2ZBJA 2VOTA 5FY7A 1A34A 2FUIA 1V6JA 2VOKA 5JOYA 3THCA 4IEWA 2ZEYA 3KMHA 3ZSLA 1LDJB 3MDBC 4GH4C 4ZONA 3NG2A 2NMOA 3R4DB 5J1XA 2F6JA 4YZ3A 1Q8PA 5K8SA 1NY72 3PU8A 4JTOA 1RIRA 1XSRA 1O3RA 3HN3A 1EAH1 1IS4A 1KQRA 1N3OA 2VVEA 1AR63 3ZIWA 4A42A 5C8CA 3T30A 4YW1A 3FEHA 2JB4A 1OKOA 3VDCA 3FWEA 4QXHA 4A44A 1SBDA 3RYKA 2EIEA 3VBOC 2EGPA 3ASIA 2DUOA 1UU6A 2WZR2 1HLCA 4JDMA 2DX8A 5T5LA 1UIKA 2RM22 3ORJA 3WINE 4PQ9A 2Z4FA 3Q8EA 3KF5A 5A3MA 2RS11 5L7OB 4R9DA 4NO4A 3A4UA 3ZSJA 1V9U2 3POYA 4Y26A 2B9VA 3O1RA 4TLGA 4FQ4A 1LNSA 4WM7B 3VBSB 3WUCA 1H8TC 1GANA 1RUG2 2VECA 4HN1A 2ZMKA 1ZBA3 4CP0A 1AJKA 3AJYA 2B4KA 2WFF2 1OF3A 2RV9A 4NRQA 2W87A 3E6CC 1AL21 2AACA 2LV9A 4QU1A 2H0DA 5SV8A 2OYZA 2XVLA 4AK3A 4Z2WA 3VKNA 4QF3A 5CIRA 4D6RA 1RHI3 2W9XA 1JH5A 4QKBA 3INAA 2YBPA 3N9MA 4D6QA 2DYCA 5JIUA 4QAWA 3VDAA 2C5DA 1GR3A 2J1SA 3KB5A 1YJLA 3GZTB 3O7OA 5EZWA 5BXXA 3BB6A 1Z6UA 4HSLA 5JLVA 3PVNA 1B35A 1VBA1 2XKPA 3FL2A 1J3QA 2PLV3 3RQ0A 3ZDSA 1GBGA 5D1IA 2E9QA 2VH9A 2JE7A 3VGIA 3J8F2 4Z2AA 3CJIA 1RUC2 1J3PA 2GALA 5DKAA 2QDNA 1XXNA 4EV0A 5GZGA 4MO3M 5CEHA 4KQ7A 3M62A 1VBD3 5T5PA 2K4DA 3Q8FA 4EN0A 1ULOA 3GNEA 2LDRA 1OLQA 2ZHMA 3NRUA 4Z1VA 5LY2A 2PELA 4UP0A 1NZIA 1RUD2 2GN3A 5JR2A 1SACA 4B4QA 4AGRA 1Z0HA 2VCMA 1OH4A 1ND2A 1MS3A 2ADDA 4QPGB 1WUVA 5FOBB 4Q4V1 2WQZC 5A80A 2VJXA 5FPXA 1D4M3 2ETEA 1NLRA 5FUPA 4PTBA 3POBA 4KWJA 4JDNA 1WW7A 1XE0A 2FCUA 2A6YA 3OB8A 4GNEA 5EYAF 3FZ3A 2BVVA 1WEQA 1W6PA 5KH9A 4B7KA 4SLIA 1QH7A 3BOWA 4QB1A 5EYYA 5LW9A 3IB3A 1YFXA 1WW5A 4AI9A 5IK8A 1PGL1 1PMHX 2J1RA 4HXCA 4OUMA 3T7LA 4LPLA 2D3PA 2FZ1A 2X09A 5GJ6A 3WQ0A 5HCAA 4KWUA 1ZBDB 3P1IA 5IVJA 1IHMA 3AMMA 1JYCA 1WLTA 2WQ4A 1RUJ3 3AP4A 4FPCA 4ZU4A 1QH6A 2XG3A 3DXTA 3ZXJA 2E33A 5LBEA 1CAUA 3GZEA 4GB32 3U0ZA 2BEOA 2BJSA 2RS32 2DJAA 2XP0A 4COUA 3WY6A 1ODMA 1JZ4A 3VLBB 5B76A 5F3CA 2EF6A 1RMU2 2JICA 1TG7A 5FPLA 2W1WA 4DUWA 4D94A 5T54A 1Q8SA 4CP9B 1R1A3 2J1AA 2BGCA 2JB8A 4XIKA 5C4WB 2HEVF 3NSTA 4AP4A 5I8YA 5FZ3A 3ZFGB 3K3NA 1ULFA 5J7MA 5IJRA 3NW4A 4BQWA 2YG0A 4XFCA 4OHXA 4AW7A 2FMYA 1N3QA 3RMYA 1S0BA 3D0JA 4H14A 4OHZA 5C33A 2MUMA 1W6NA 4GMP1 3ZMOA 3POFA 3S30A 5FZKA 1RB8G 1WLCA 2LALA 1AXKA 1H2LA 3U14A 3HNYM 4GMP0 3E5UA 1Z7S3 3SEPA 4C91A 5I0DA 3RJRA 4HK8A 2GNTA 2RS53 1NCRC 4IGPA 5FCCA 3ST7A 2HWC1 4C1WA 1AYM3 3VBOA 1MEC2 1CAVA 1TME1 4HONA 2UU8A 3W9AA 2E32A 4CXWA 1SLCA 1IS3A 1I3HA 2ZTNA 4X6RB 4RSUA 2JRJA 1RXGA 4Q4Y1 3LOBA 4BBQA 4LBQD 1H8TA 3T08A 4BDVB 5G04B 2WWJA 5EXOA 3WUDA 1W8HA 4Q0SA 2A70A 1YUDA 3GGLA 3RGBA 5FFOC 3VL9A 1EPZA 4BPZA 2Z42A 2X8KA 3MFAA 1IKPA 1RUE2 3KCXA 1MM3A 3FM8C 2ZEWA 4R4ZA 4FCAA 5A6ZA 2KKXA 1X9TA 4P08A 1VRBA 4LKAA 1BQPA 4GJYA 4GKYA 4PIYA 4AFBA 1UX7A 3O14A 3KGZA 5FJKA 3ZX7A 2ZKLA 4IC2A 1ASJ2 1YRZA 2HWD1 4PF5A 3E6DA 4PBPA 4PI0A 5FO9B 4Y22B 5LK5A 2XLFA 4XI1A 2EXHA 4RL7A 1JOBA 2GP5A 1C3HA 3KQRA 1UY0A 1O59A 4Q1PA 1NQJA 1ENSA 1UOGA 4XJUA 3J7NA 1Y9GA 4GQ7A 4PF1A 2ZGUA 2WO2A 4CEWB 4LR4A 4V1PA 2ATFA 3GCXA 2F6NA 3DUIA 4I0WB 1DQ5A 1O91A 3SCHA 3VZOA 3WG3A 2VP7A 3LDRA 4BIOA 2FD4A 1VRH1 4CE8A 1J1TA 2WYSA 4K6BA 5FR3A 3O1OA 5EYXA 1GICA 2QQNA 3PUHA 1GZ9A 2ECIA 4IV3C 3LDYA 3GCWA 4LIVA 4EN6B 3B9CA 2D6MA 4UAPA 5LRSA 5LKUA 1CONA 1F4HA 1EV12 1LR5A 2ECJA 4AEMA 5ABJC 2JDMA 1JODA 2GU9A 5JVVA 2G6QA 1J59A 5G05L 3B02A 4W4UA 3B9IA 2BDRA 2P34A 5DZFA 2CRWA 2BNNA 2EA7A 4KU8A 3RSJA 4I09A 2OQ6A 4LUKA 1W6OA 2VOVA 2JX9A 4P9GA 3O1PA 2YQLA 4HFSA 2OXBA 1DQ1A 1OQEA 2VTXJ 3SEEA 3U78A 3WDVA 1ZVFA 3SCGA 4OI1A 2QZ3A 5D8AC 3WDTA 4XDQA 2OT7A 3UL2A 2H0DB 4CDXA 2MIQA 3C6WA 3C7EA 4UW4A 1HRI3 1W8ZA 2XUEA 2YC0A 3AM2A 2ZXQA 4XYXA 4FFFA 4Q0UA 5FWEA 2YHJA 1MPXA 3CU7A 3OGJA 2HDPA 3KCYA 2KGGA 3O1VA 4GULA 5FB0A 1B35B 1XYPA 4KWKA 1NXMA 2ECTA 1TQ5A 1FPN2 2DFCA 1QOSA 1YI7A 3CJIB 5JZGC 4LA3A 2AUYA 3FLPA 2CSZA 2BU9A 5DAPA 4XTMA 1FV3A 4NRPA 2IVIB 2VZUA 3HQUA 4RGAA 1UYPA 3WW4A 2HWF3 2JDPA 4XZPA 5GKAC 2VU9A 2YUCA 1R083 1BCXA 4LJNA 5D1LB 4NPLA 2BZDA 1RUI1 2WC2A 1ND2B 1NCRA 4I0BA 1TVGA 4XW3A 2WFPA 2Y64A 4MHUA 5CNAA 1QY4A 1S0FA 3NL1A 5BNOB 1KJRA 2XHNA 5JSRA 3B93A 4A2UA 2ECNA 1YJKA 2R041 4YADA 1U5YA 3PDQA 3TOJA 3ZO0B 1N3PA 3UGGA 2ES3A 3WP4A 2WRAA 4OUSA 3HN1A 3GZUC 4NAMA 2BOIA 1VIWB 4WM8C 1OUSA 4LULA 5BUVA 1D2QA 3RFRA 4PPEA 1TMF3 5H9MA 5FYTA 1O4TA 3BKZA 3POIA 1CZVA 4XUTA 1WEUA 1HX6A 1OD3A 3OSDA 4A7KA 5HCBA 2R072 1F35A 1AL0G 3E5QA 4DMIA 4YBSA 2AN6A 5L9VA 2D6NA 4G3YC 1T6BX 4DEQA 1GNYA 3PJQA 1CAUB 2P3IA 5FLJA 1JZ8A 4LK6A 2ZX3A 4ATFA 3Q9OA 3E1F1 2QJ0A 3DEMA 1JUIA 5JSOA 1DZTA 2VQAA 4FFIA 4RA0A 2BW8A 2IUWA 4CYDA 4L58A 5TBNA 2XL9A 4NROA 4IEYA 1F5FA 3NNGA 2P57A 3VBRC 1Y9MA 2L7PA 3AMHA 3FBMA 3VZJA 5FZ9A 1UKGA 2CYFA 3NWKA 4XFBA 2D5HA 1W6NB 3K48A 2HH9A 2VTXA 2VW2A 1AXYA 4N4FA 4JGYC 3OEBA 5FK7A 1S2KA 3ZPV1
chains in the Genus database with same CATH topology
3E97A 4HK9A 1U0AA 1BBT1 2JG8C 2CWSA 4I0AA 3FJSA 4MV2A 4IV3A 2V5YA 4AHZA 2EIGA 2XBO2 2RJKA 3VBOB 4EN7B 2BYVE 3OD4A 4AI8A 1CAVB 5ABJA 1AR93 5TDWA 1QJX1 5KXBA 4S2DA 1LHWA 1VBB2 3ZN6A 4META 4QT6A 2UURA 3AFGA 4U2AA 4K9SA 5CBLA 2KXLA 2K0GA 2VGDA 3AMNA 1T6GC 2D43A 1G6NA 1H8TB 1QOOA 1F2NA 4LBNA 3LAGA 5HXVA 1QJU2 1POV3 5HI0A 1AR81 4YVSC 3L11A 3PUQA 5D8AA 4MXVA 1CGPA 4H55A 3ME2A 1FNYA 5GZDA 3AZZA 4KNCA 2A5ZA 5J3XA 1VD4A 3J9SA 1DZRA 1XYOA 2DWRA 4LK9A 1K2FA 2RM23 1A8MA 4OULA 1QDCA 4XMIA 1MS5A 1Z78A 4Y1UA 1ZZ7A 2DCJA 1SCRA 4XBNA 5JZGA 3AP7A 1V9U3 3BOPA 2Y1NA 4LTAA 4NN0A 1J59A 4YG6A 1RUF2 1PGSA 4WVZA 1IKQA 1ZM1A 1LODA 1RUG3 4RS5B 3WD5A 3QD6A 1FMD2 4QQPA 4QQHA 3URFA 4W6XA 2ZGKA 2PN5A 2ZS6B 2R1DA 4UI9B 2LN0A 4FTSA 1KFXL 4IEQA 4K8FA 3ZIXA 3K51A 1ZBE2 3ZVYA 4BMBA 2DURA 5IK5A 5FMOS 2E7QA 4QGMA 2WA4A 4QM8A 2LXPC 2HYED 1RUC3 4PBOA 2UWAA 1UL9A 4OI4A 3UJQA 1ZBA1 2BNOA 3QLQA 1LGNA 3ECQA 3HWJA 1T1HA 1W6QA 1W6OB 1QJY2 2UWBA 1RUD3 4HPKA 2TEPA 3MICA 1RHI1 3CO2A 1W2UA 2CTVA 4G4FA 4Y4YA 5GLWA 4CDXB 2Y43A 3AYAA 5CB7A 2YY1A 4ZU5A 2PLV1 3KSCA 4CTEA 4YZ2A 4OVEA 4CRQA 2FSAA 5A3LA 1MVQA 1ENRA 3WG1A 1SMVA 2RMU2 1QNYA 4XQWA 2CKLA 3VBRA 3JUUA 2HYKA 3MDPA 1VB2A 2D40A 4GA9A 3JD73 4DNYA 4OI2A 1QJZA 1SCSA 4YM1A 4JGYA 5ACA2 2PA7A 2WINB 2XEUA 1XNBA 4D7YA 1D4M1 1PZ7A 2JG8A 3A0KA 3P3NA 4MLOA 3AZXA 2RS33 1NCRB 1CESA 1HRV2 4RGGA 3WCSA 4IETA 5AIUA 4AVAA 3HCSA 2FZ2A 3CEWA 2E6VA 1LHOA 3QCWA 5DZEA 1D0HA 5DDJ3 5GLUA 4DS0A 1CQ9A 5DG1A 3PURA 3TN93 2OZJA 3AYDA 4MSXA 3VBUA 2VPDA 1ZRRA 3ZXAC 1RUJ1 1AR72 1TEIA 1OA2A 5KHHA 1HQLA 1V6OA 3HR9A 4YVSA 3ZFFC 2OUHA 1RL3A 3ZYPA 4NHMA 4YZ1A 2WSVA 4QM9A 5JMCA 4MZUA 4QD2A 4ISQA 1VB4A 1ULCA 3ROUA 4R9CA 1REDA 1MEC3 2ERFA 4PLNA 1CN1A 2GH2A 2YYRA 3H8UA 2ECVA 2WT1A 5JDBA 2NAAA 1PO12 2O8OA 1NXD1 1NZCA 4H7LA 4LUMA 4QU2A 1LEDA 4WZCA 2XPJA 1IZ3A 2Q1MA 3AP9A 1DF0A 3H3UA 4NHLA 3ZYQA 1XE7A 4W6WA 1WILA 4LE4A 4OHYA 4FVVA 4FTEA 1Z7S1 1Z60A 3LRQA 3MIFA 2RS51 1FOD3 4HVOA 3ASLA 1AYM1 1RUE3 1ZYBA 3PMSA 4BM8A 3U10A 2GN7A 2CWMA 3KT4A 4IV3B 4UW5A 3RTRB 5FO8B 4AVXA 2Y1MA 1ASJ3 5ABJB 4AQ2A 5C11A 5I0RA 2VPVA 3O34A 2Q0AA 2QFEA 3VHOA 3ZN6B 4AFMA 4B7YC 2Y26A 1V6IA 4N7IA 3PVBB 4IESA 3RS6A 5AVPA 1PVC2 1H4HA 4Y1VA 1ULGA 1WFKA 3FMGA 1EY2A 1CAXA 2IFRA 2YSJA 4Z82A 2WS92 5D8AB 4ONUA 1GNZA 1GV9A 2ZGSA 4N9HA 3MGUA 4QPIA 2ZGNA 4CA1A 2YMZA 3HAGA 1UPSA 4FPLA 2YV8A 1ZNPA 5JPNB 2NMNA 1HYJA 1EV13 1H0BA 3B69A 2MT5A 2B39A 1FP0A 4COZA 5BNNC 1RINA 3BODA 1NYWA 3RYRA 2ZGRA 2ZGLA 5JZGB 2F6BA 1AYN2 2BVBA 1WEPA 1AX0A 5KHJA 5FOJB 3LA3A 5E8AA 5K9YA 3C3VA 2H6CA 2XJQA 4Q0QA 1QU0A 3WP5A 1K5MB 5KH3A 2EXKA 1YIFA 4DY5A 5DG2A 4BHPA 5E1RA 1COV2 2G43A 1E4UA 1MQTC 4OLLA 4C0HA 1VAKA 3S0MA 2HWB2 1RMDA 2IXIA 4Q27A 4YW3A 3EO6A 3PMEA 1S0GA 1WD4A 1FV2A 3N7MA 3I4IA 4WA6A 3C2UA 1SFYA 1OFNA 3ZFFA 3I54A 1W6QB 3KV5A 1GQHA 1V6KA 4OFGA 4Q4W3 5LRRA 4HPKB 4EWEA 3DF0A 4COYA 1AL22 4YYOA 2PQQA 2XL7A 1HRI1 1URXA 1X8EA 4XTPA 4PLOA 1XNCA 4JAAA 5KHGA 5I0TA 3SLIA 3N36A 4AEJA 3G6JB 5D1KB 5DUVA 2CY6A 5BYNA 1ZREA 3SOUA 2ZETC 2CKLB 3VBRB 1KXGA 4BA6A 2P3JA 3U5MA 3SISA 4M3CE 3IWZA 1VBE3 3TYJA 4AEKA 2YYOA 3HTKC 2ZGMA 2XVGA 4FIPA 2B9UA 2WLQA 3H9AA 2ZX2A 1RUNA 2R062 5BNPC 2R073 4AG4A 4JGYB 3ZFEC 2IZWA 3FLRA 4YGCA 3VHRA 2YU4A 3BALA 5KBFA 4Q4V2 1ZX5A 4N7UA 1QF3A 3O7AA 2ZABA 4GALA 3IDCB 3IPVB 1G9DA 1LOBA 4L99A 2RR12 2JMJA 4L11A 1WEVA 1YIPA 4AGVA 4ES9A 1TMF1 4CP1A 5K0UC 4WVVA 1PGL2 2AENA 1I1EA 3WQ7A 3VBUB 2K1JA 3AFKA 1QQP1 4F52B 2OPKA 2OIIA 4Z07A 1WEOA 4YVSB 5FRAA 5FB1A 5H9QA 3OYWA 1CVNA 4L2NA 3CL1A 5JOXA 2W39A 5I91A 4M0HA 1OOPC 4CEYC 2XBO3 1FX5A 3M3IA 3G7DA 2RE9A 5BNNA 1VBB3 4K20A 3M4FA 5CA6A 1LHUA 1NG0A 1FNZA 2DTWA 1LHVA 1UN1A 3E6BA 4Y1XA 1EPWA 1C8M3 4F83A 3WXPA 5GALA 5H9PA 4XJAA 1J1LA 4HL0A 2MHFA 1BXHA 1QJU3 1DDLA 1CPMA 3IN9A 1CAWA 5KXCA 2V09A 5LKZA 1WEEA 4AWDA 2FHRA 4INDA 1AVBA 4FP2A 2HEYF 2Z2SB 3TBDA 5JAXA 2HWC2 1AR91 3MIGA 3TWIA 2BFUS 1MQTA 5IUQA 2YHNA 1SQ4A 1UD1A 4LO5B 4Q26A 3D82A 4QHBA 1U5IA 3E5XA 4XXPA 3RMXA 4BIFA 4I30A 2B8MA 4M01A 5JI9A 4Q4Y2 1DBNA 4YM2A 1RUF3 4XF1A 4GNFA 4BYYA 1POV1 1RUH2 3SH3A 2FBEA 5JIAA 5H9RA 1WENA 5LEJA 5FLHA 1CAXB 1JOCA 3WHTA 1ZA4A 4TSVA 4FOYA 4QPIB 4EN8B 2GC0A 2RM21 3DPRC 3EXUA 3N3HA 4COWA 4E27A 5FO7B 3L1XA 1E57A 2BFUL 3IT8A 2HWD2 5A32A 1V9U1 3JQXA 1BVVA 3S6PA 3O5SA 1XNDA 3MLLA 2HEWF 1S0IA 1O5LA 5J96B 1WLDA 1R093 1X4UA 5I8SA 4GH4A 5EJ3A 2JJ6A 1H2NA 1IS5A 2NP0A 2PAEA 1C5HA 1VRH2 2WL1A 1ONAA 2WSUA 3P3PA 2M1RA 3ILRA 3LSDA 4AFCA 4WZ2A 2JG9C 2GH8A 3KLSA 4Y1YA 4P9LA 4LO8A 4R8HA 2ZAHA 2WLPA 3HBZA 2O0OA 2ZGQA 5K0UA 4X3GA 2XJVA 4CCGX 4WZFA 1LOFC 3AK0A 4Q8LA 4BLJA 1PO22 4YFWA 1SDWA 5AC93 1Y7BA 4O64A 2JXAA 4PCRA 3ZFFB 3VBFC 3B01A 3LA7A 4N53C 5ACA3 2YT5A 2PHWA 4MUVA 3EHKA 4YGEA 5LEKA 1CR7A 2WIIB 1OOPA 4CEYA 4B7EA 1G25A 2DVBA 1BVP1 3RPQA 3M99A 4P9YA 4RHV2 4IC3A 3H1YA 4I3PA 4Q4X2 2LXHC 5CG8A 3ZVZB 4PJYA 5JCTA 1WMDA 1FT9A 3ZSEA 1DQ6A 2NZ9A 3ZXFA 1LOAA 4YG0A 3JD71 4V3LC 3BCWA 4BHWA 3SH5A 1CJDA 4YARA 1O3SA 1AR73 2QNKA 3WW2A 1XWHA 2QIZA 2VOWA 4YBSA 4XFIA 2ZA9A 5T3NA 4B4PA 5B78A 4UXAA 2RS31 4Q1RA 1W0OA 4TWTA 1V00A 3JB4C 4XJ8A 2P37A 3JBG2 4QXKA 3A0NA 5FLIA 3U5PA 3OGGA 5C8CB 3FBYA 1WW6A 4XFHA 5DINA 2P17A 4L92A 5DDJ1 1X36A 2E7AA 2PHXA 3TN91 4LO7A 5IK4A 1MS0A 2R042 2VJEA 4LLBA 1MZ5A 4MGZE 3H1MA 5KHIA 1PO13 1NQDA 5B75A 1DYKA 4X8PA 2FQPA 2GSYA 1BEV1 2VULA 3MIDA 4JRAA 1RJ8A 1TNRA 2VG9A 4HANA 1DVPA 1SLIA 4I02A 4XHXA 5DUUA 1BORA 1AUYA 1UU5A 4RQPC 2PHFA 1LTEA 4JCKA 3NKTA 3WNXA 3OYWB 1LENA 2W68A 1NCQC 1SLLA 4XMAA 1ZRDA 2QCSB 3DPRA 4DPNA 4Q6FA 1LOGA 3KT7A 4XF4A 1PNGA 4DQAA 1BYHA 2ZGOA 2HJIA 2QKDA 3AXEA 4K1ZA 5EWSA 4P9WA 4PLMA 4Q2FA 2IXLA 3GBGA 3BPZA 3VDDC 3PTYA 1ULDA 4XETA 4CDQC 2ZZQA 1YXWA 2B5HA 1PVC3 1FOD1 4GNDA 3FE5A 1RVF3 3J4UH 1RUE1 3WVJA 4CZSA 4EJRA 4LBQA 4AI0A 2QJVA 2WS93 2ZX0A 2MA6A 2JG9A 1LB2A 1MVEA 1BBT2 2GMEA 2N7GA 2MD7B 2VY0A 2RHPA 5TABA 4LHLA 3FHIB 1Y3TA 4DRRA 3R4UA 4R7EA 1MZEA 5J36A 3QH7A 4YFZA 1MQTB 2DTYA 2PNXA 5GZCA 4FPOB 1W6PB 1XE8A 1V6LA 3L1ZB 3DPLR 1YFUA 1LOFA 1SBFA 1UAIA 2K9ZA 2NLRA 4P9XA 4YGBA 3MHSA 4UBGA 4PIZA 2VMHA 3IHPA 3RWNA 3UKNA 4MX3A 3VBFA 4N53A 4UW3A 2GDFA 4MGIE 3O33A 2D3SA 3U5NA 2A71A 3OBRA 2YHOA 3VZMA 3N9OA 3FUQA 3KV6A 4YBMA 4AFAA 4YRDA 1GZWA 2A6XA 3PHDA 4K21A 5C9AC 3SXWA 1EV11 4YABA 3FUOA 5SV5A 2SBAA 2WNEA 1COV3 1XU2A 4JC1A 4QQOA 1HIXA 2GAUA 5A32B 1UZZA 1H9PA 2HWB3 3NAPC 4XBLA 2Z79A 3WG4A 2WNVC 2XLGA 1AZDA 5HCFA 1A3KA 3OJBA 4FP3A 4GH4B 4N43C 1G86A 3NV2A 3V56A 2R49A 5K7PA 1XRUA 1HKDA 2PHRA 2UWCA 4AUQB 1JN2P 1WCSA 2R0FA 1ZZCA 4P14A 2LGKA 2A6ZA 4MYEA 2YW8A 3M70A 2JDZA 5T55A 2TUNA 4FSJA 1H30A 1S0DA 2MEV2 3QOPA 2VVDA 1EYBA 5J3UA 4HVQA 4Q4W1 1UPIA 1GQGA 2DCZA 2VNRA 3MF6A 4RQPA 2R063 1RHI2 2G45A 1YHFA 3RRDA 3KGLA 1YWKA 2DCKA 1A8DA 3NV1A 3B94A 3T2TA 4JTNA 5JPMB 2QICA 1OOPB 4XIOA 1HXS2 2AH2A 4AVCA 3L9JT 1HV0A 2PLV2 3U07A 2RR13 4FPHA 3ZPYA 2WZR3 1U5ZA 1F62A 4A7YA 3JB8A 2I74A 1VBE1 2ET7A 3VBSC 3VDDA 3ES1A 4CDQA 3RJ2X 3N7KA 1ALYA 4FPEA 1H2MA 2LGGA 5F6KA 1NA1C 2R071 2W0XA 3JU9A 1LGCA 4NPRA 1QXPA 3IBMA 2KR4A 2X5IC 2PTMA 2WFF3 2D97A 1AR61 4RD7A 1FBVA 1BZWA 3WV6A 1GKBA 2PHTA 4TLFA 2CNAA 4X6QB 4F7ZA 1V6MA 2FMDA 4UP5A 1UCXA 2I2SA 5JI7A 3WT3A 3MZHA 4FOWA 1WD3A 4URTA 3VKFC 3KZ4C 4HLTA 4FXKB 2K16A 4A0CD 4LLOA 2PAKA 2VJEB 1OA4A 4HBNA 4HMZA 2XB6C 3J8F3 1AXZA 1J58A 5I3LA 4JV4A 4WM8A 4GXLA 4XHBA 2VNFA 4X8NA 3M1HA 4AI1A 3GHMA 1RUJ2 3LGRA 4M3CA 3AKSA 4BOWA 4WZ3B 2FUUA 1N1TA 2UY9A 3NV4A 4XF9A 4H7MA 5IT6A 1W6MA 3VUOA 1LGBA 2WNUC 1QKQA 1IQAA 1CPNA 1Q8QA 3NO8A 2EODA 5C9AA 3V0BA 1QWRA 3ZSKA 4AVBA 4M0NA 4LO4B 4E2SA 2Q4SA 5L19A 2DF7A 3H3ZA 1KD7A 3OPZA 5FLJA 1Q43A 1VBB1 1VJ2A 2D3RA 2I45A 3OD0A 1YLLA 3WHUA 1GFF2 2VPGA 3V43A 4LE3A 1VBC2 5FMOL 1WESA 1C8M1 1PIV2 1VBD1 1HQWA 3HIFA 4NHKA 2XJPA 2WNVA 3ZSMA 3THPA 2GZWA 1UF2C 4AI3A 1QJU1 4IEZA 2Q30A 3TAYA 1SBEA 1RUH3 2IFWA 4N43A 1C57A 1WBLA 3R0RA 4QX5A 3V0AA 2YSMA 1Z7S2 1N1YA 4XFGA 2YZ4A 2PHLA 4SBVA 4XE9A 1WE9A 1AYM2 4ZKTB 1YO8A 4GB33 1F9KA 1ULEA 2CAUA 1WLWA 2JG9B 3MPPG 1PMIA 4LA2A 4LEJA 3RMYA 4AQSA 5HBAA 3HCTA 4ZUXU 1IS6A 1RMU3 4YM3A 4P9JA 2L0BA 3QH6A 4OZXA 2ZX4A 1UMZA 1PGW2 2HWD3 1H4GA 1TE1B 2OZ6A 3RZZA 2HWE2 1LCLA 1RUF1 4AEDC 3T6RA 3SNMA 4JGZC 3GV4A 1CJPA 3N7JA 1LDKC 2E6SA 1PM7A 4BCUA 2XWBB 4S2HA 4R52A 4LO6B 1KS4A 4KBBA 4FTBA 1WA4A 3VBFB 3OY8A 3C5KA 2XWJB 2CV6A 1MM2A 4L8QA 2I50A 2O1QA 4KG8A 2H0VA 2M85A 4A3XA 2YPJA 1GZWB 3H7YA 4Y5Z0 1MZFA 5FTTC 1R1A1 1QDOA 2UYAA 2BBVA 1DU3D 3ZTGA 3PHMA 3H1WA 3VKOA 3WLUA 4QMAA 5JOWA 1R091 4LBLA 4XJ9A 3WDYA 1JBCA 1FATA 2Y38A 2KM2A 4LBOA 3SHRA 3H0OA 1NA1A 4LLFA 1PO23 2CAVA 4PIXA 4YLZA 2X53S 2X5IA 1IPKA 3WP3A 4HT1T 3RG0A 1OLRA 3DGTA 4QPYA 3AYEA 1M06G 2XJSA 1AX2A 2BUKA 2AREA 5GLTA 4XJZA 1VAVA 4JDOA 2BWAA 1DGRA 1Y43B 1LU1A 4RR3C 5F5QA 3USSA 3BU7A 4OHVA 3HMYA 4HKWA 2AR6A 4RHV3 2LGVA 1LKNA 4A4BA 3WDWA 4Q4X3 5AVAA