3I2DA

Crystal structure of s. cerevisiae sumo e3 ligase siz1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
286
structure length
280
Chain Sequence
TNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDETSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase SIZ1
total genus 59
structure length 280
sequence length 286
ec nomenclature ec 6.-.-.-:
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i2dA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3i2dA02
2M1RA 2VJEB 3ASLA 3ZVYA 4A4CA 5C13A 3N9LA 3ZPVE 4UP5A 5H9MA 5B76A 3RPGB 4BBQA 5B8DA 3MHHA 1JM7B 3U5MA 4UP0A 1ZBDB 4YBTA 1MM2A 2MA6A 2VNFA 1Z6UA 2H0DA 2VJFB 4LKAA 4GNDA 4TKPB 5LKUA 2JMJA 4IC2A 5DINA 1IYMA 2MNZA 4S3OB 2JRJA 3SOUA 2VPDA 3U5PA 3SOXA 2K17A 2YU4A 3PUQA 3QZVA 1DVPA 5TABA 5FERA 1VD4A 2K1JA 2KGGA 3N9NA 3O34A 4I7BA 3O36A 3SOWA 4B86C 2QICA 3KNVA 3ZNIA 2I50A 2EGPA 2CSZA 3PHDA 2E6RA 3M63A 1JM7A 2YHOA 3EB6A 4YATA 3HCUA 2QIZA 1X4JA 4GNEA 4V3LC 2ECGA 2L43A 5TDRA 2L75A 2XEUA 3DPLR 3DQVR 2Y43A 4MVTA 1Z2QA 5KH9A 3T6RA 3PURA 2K16A 2ECJA 3LQHA 4AYCB 4AVXA 2H0DB 5D1KB 3N9PA 1MM3A 4C9ZA 5FB1A 4PPEA 5G05B 3T7LA 4L58A 1WEWA 4PTBA 3V43A 3ZTGA 2MT5A 2KIZA 4W4UA 5H1UA 2VJEA 1HYJA 4Q6FA 2LV9A 5B78A 4R2YA 2VP7A 2LGVA 4YABA 4I7CA 1WEOA 1K2FA 4A4BA 3U5OA 1WENA 2YREA 2MD8C 2VJFA 1WIMA 3N9OA 2VPBA 2DX8A 1V87A 3ZVZB 1WEEA 4YBMA 2K4DA 1WEMA 4N3WA 4R8PK 2E6SA 4S3OC 4LLBA 3L1ZB 3HCTA 5G0FA 3LQJA 5B75A 2RSDA 3FL2A 4GNGA 2F6NA 4ZDTA 4R7EA 2YW8A 5KH7A 2YSMA 2MD7B 2KFTA 4FO9A 2G43A 2YUCA 3KV5A 1X4UA 5C11A 3GL6A 2G45A 4XI1A 5D1LB 2HDPA 2CSYA 3L1XA 2BAYA 3RPGC 1HYIA 4GB0A 3HTKC 3C6WA 2KU3A 2F6JA 1Z60A 1X4IA 3N9MA 5KH3A 2FUIA 4ZUXU 5TDWA 1VFYA 2KYUA 2LGGA 4ZQLA 2MIQA 1WEQA 2LXHC 1BORA 3O35A 1JOCA 4IC3A 1T1HA 1WE9A 1CHCA 2JMDA 1WEUA 2L80A 5H1TA 2CKLA 2KREA 3O37A 2EODA 4AYCA 2EA6A 3LQIA 3ZPV1 2VPEA 1WEVA 3HCSA 5FB0A 2M6MA 1WFKA 4L7XA 4P5OB 2L5UA 2MUMA 2YSJA 2NAAA 2LDRA 4LJNA 2ECIA 2D8SA 4A0CD 4UI9B 2QJ0A 4LK9A 4YBSA 4WZ3B 3LRQA 1N87A 1F62A 2VPGA 2LQ6A 4FIPA 2LGKA 4CA1A 2IDAA 2KWKA 3NG2A 3M99A 2YURA 4YC9A 4LADB 1U6GB 5DKAA 5LKXA 4B7YC 1WILA 2HYED 4N4FA 3EB5A 3L11A 5B77A 2LXPC 2Y1NA 2PNXA 2AN6A 4QF3A 4GNFA 2C2VS 4WA6A 4WZ2A 4YADA 2MNYA 2L0BA 1LDJB 5LCWB 1WEPA 1FP0A 2FUUA 2YHNA 1LDKC 4A49A 5I3LA 2YYRA 5J3XA 2M3HA 5JG6A 3GV4A 2ECWA 2KGIA 5TBNA 3KV6A 1E4UA 3SHBA 2ECTA 2Y1MA 1G25A 2KWJA 4I7DA 3VK6A 3RTRB 5AITA 4V3KC 4MSXA 3MHSA 5FEYA 2F42A 2CT2A 5AIUA 4AUQB 2RI7A 2KWOA 3C5KA 5D1MB 1FBVA 1XWHA 2XB1A 4F52B 3IHPA 4X3GA 2MA5A 5LKZA 2LGLA 2JMIA 4O64A 4FK5A 4QF2A 4WZ0A 3M62A 2KR4A 2LRIC 2KE1A 4FJCA 5H1VA 2YQMA 2ECVA 2C2LA 4BHWA 2PUYA 4CCGX 2YQLA 4NN2A 3KQIA 4YAXA 3ZYQA 4AP4A 1VYXA 1WGMA 3O70A 3U5NA 2KWNA 1WESA 5G04B 5LKTA 2UZGA 5TRBA 2ECNA 2LN0A 3O33A 2M85A 2OXQC 2CKLB 5B79A 2G6QA 1RMDA 5EYAF 3O7AA 3I2DA 3N9QA 2YT5A 2FSAA 2ZETC
chains in the Genus database with same CATH superfamily
2ERFA 1VRH3 2M1RA 3BTXA 4P5YA 4KGGA 4IL7A 2K9ZA 4DXZA 1UY2A 1DQ5A 4P9IA 4RHV3 3VBOC 5A3UA 2EIGA 3JB8A 1IPKA 3RI9A 2CU5A 4CUBA 2UY8A 5FMOS 4LKSA 1QNYA 3H50A 5LY1A 3B3QE 1PO11 2WDBA 5IK5A 3MHHA 1CAUA 1RUG1 1JM7B 3MIGA 2B9UA 1L3JA 1MS5A 2ZGUA 5C3QA 2Y6LA 3VBFB 2GAUA 3P3NA 2GNMA 3TN92 3ZMOA 1ASJ1 1AR63 4N9IA 2VNFA 1RMU3 1H2MA 2TEPA 5A7OA 3R05A 3MW2A 3WG4A 3WG1A 3K46A 4ZY9A 5F9TA 5JOYA 2W39A 1OPMA 1W6MB 5L73A 1JOPA 2HBTA 2ZX3A 2DVGA 1AVBA 2DFBA 2P3JA 3RZLA 4YW5A 5JZGB 2NLRA 3NV1A 2ZGPA 1UNBA 4QGNA 1WD3A 4PJYA 3USUA 5ISLA 1HQLA 4IC2A 5DINA 5CB7A 2MNZA 4S3OB 3ZLIA 3SOUA 1RITA 3RI8A 5C5TA 2WS92 1ZZ7A 2OZJA 5FZ1A 4C8DA 4ATFA 4B7KA 1XQNA 2YU4A 1H1MA 1DVPA 3IM0A 3CL1A 5FAXA 5FYIA 3PU8A 5FERA 3KGLA 2XJUA 1R1A3 1CONA 3U1XA 4TTGA 4XFHA 2KGGA 4PBPA 3UNPA 4EQVA 1IPJA 2WNOA 3B93A 2BNMA 1US3A 3ABZA 5FKBA 4I7BA 1ZA4A 1OF4A 1PO22 2Y6FA 4XF4A 2I74A 5C8CA 1R093 2P5BA 4JDOA 4UW3A 5FIXA 5HXVA 5JOWA 1O3QA 1OF3A 4Q4W2 5IVFA 3WOGA 3ST7A 2JICA 3T9KA 3AYDA 3GALA 3O0VA 2FCVA 4F1PA 5CVRA 3PHDA 2PHXA 1HB3A 2PHLA 2KA3A 2JE8A 2WT0A 3PUSA 1GOFA 4YVSB 1JM7A 2IXJA 4DPNA 3J7HA 5JPNB 1J58A 4IV3C 4OHVA 2DYCA 4Y22B 1AYM2 3WY6A 3FJSA 3RG0A 2YVRA 2FDFA 2G9FA 3I49A 2CWSA 2VE1A 4IE0A 1JZ6A 4XOGA 1W9SA 4DOUA 1W9WA 2WO3A 3J26N 3BKZA 1C5HA 2C9AA 3GM8A 4V3LC 1UKRA 3PU3A 1ZBE1 5CFDB 3JD72 4FAHA 4IESA 1NCRB 1C8M2 4LE3A 1OVSA 1VBB3 4IERA 1HB2A 1TVGA 4LUKA 4Q0PA 1GZCA 1OBNA 4GULA 4WVWA 4A3XA 2XEUA 4XDOA 4AG4A 3N35A 4QGMA 4CDWC 5JZGA 1NT0A 1W0PA 4CU8A 1U5XA 1WKYA 4K9SA 3W5MA 4A7KA 2R041 5BNOA 2AC1A 3ZXDA 4YM0A 3PURA 2LS6A 5DUUA 3L9JT 2LUWA 5ACA2 4Q4Y2 5FZOA 5IAVA 4H2AA 1KEXA 4L8QA 3C7GA 3LEIA 4BQ3A 4O61A 1V6MA 2ZHLA 4PDWA 4QAWA 4INDA 4P9JA 5KXDA 1C4RA 2XXZA 5A3OA 1JZ5A 3C7OA 4HOOA 4IEPA 4AAXA 1PVC2 2VTXJ 4RGKA 5G05B 2DUPA 4PF5A 1AHSA 3UKVA 1IS6A 1O8PA 1LAJA 4OUSA 4WM8A 1LODA 3M7AA 2RS32 4TLFA 1MS1A 1WEWA 5KHJA 3AP7A 1VPHA 3EO6A 5T54A 5SV5A 2M13A 5FUIA 1ZBE3 5IK8A 5C7GA 2P17A 2WAAA 4GH4A 2HEVF 3ZR5A 3UJOA 5H1UA 2J42A 3IDEA 5ABJB 4FP2A 5A6QA 2PFWA 1OLMA 1NX9A 1T2XA 1UWWA 2QBXA 4AQTA 1HYJA 1JYVA 2XPJA 1Y9QA 1HXS1 2QZ3A 1S2BA 4A7YA 4A4AA 2LV9A 5A3TA 2JD4A 5B78A 1G8WA 2RM23 5LASA 4CRQA 2XLGA 3LFIA 1COV1 2D5FA 4GWIA 4CP2A 1ZBA2 4CCDA 5BNNA 2LGVA 5DABA 2VP7A 4I7CA 5CFDA 4XBLA 3CO2A 3O1RA 4A4BA 3UETA 3K4AA 1G7YA 3R4UA 3GZUC 4IETA 4PT6A 4XVHA 1TE1B 3RDIA 1HRI3 5C9AB 3LVQE 1V6OA 5F1RA 3FLPA 4R9CA 1VBE2 1QJZA 4OFGA 4ASLA 1AL23 1OVPA 1ULGA 5CFCA 3DF0A 3O5SA 4ASMB 1WIMA 4P9GA 1QQP3 1YQ5A 4Y5SA 1RXFA 1GMMA 2VPBA 2VZVA 3F2ZA 1V87A 4AF9A 4L97A 4FVVA 2XBO3 4CSWA 1UIKA 3ZIXA 1EAH3 3RZMA 2NP0A 3G6JB 4LBQB 4BPZA 4M01A 1XE8A 4Y3OA 5F6KA 4R8PK 4NN2A 3WDUA 1KJLA 3FZ3A 3ZN6B 1GP5A 1OSGA 3D8CA 3MW4A 3U37A 4BU2A 2RE9A 3L1ZB 3K51A 3GXUA 2R072 1AZDA 4WM8B 1YQ6A 3L2YA 3NMBA 2W1QA 4MX3A 3TBDA 5L7OB 1HB1A 3EJKA 2YC4A 3FL2A 1KXGA 4YM1A 4UAPA 3P6BA 3PLWA 1VBE1 2FMYA 4AHXA 3VKLA 1GFF2 4XZPA 5KXCA 2BYVE 1RUJ3 4UYBA 5FMBA 1AXYA 3SEPA 1CAVA 2YW8A 4R7EA 1OH4A 3I2OA 2W52A 3PUAA 1Q8PA 2YSMA 5AFEA 1QOOA 4CP0A 2KFTA 4RHV1 1COV2 2ZGQA 5A70A 1PK6A 3K3OA 3VBSB 1QXJA 4XCAA 5GZGA 2XKPA 3GYDA 3CDZB 3KV5A 4KGQA 4RL7A 5FMCA 1JBCA 4XI1A 3CLPA 1UZZA 1CZVA 3H7YA 4XBQA 1XXNA 3RPGC 1QJX2 3LD8A 1YJKA 4AFAA 1V6JA 1K5MC 3VGIA 1RUI2 1UY4A 2O14A 3CNAA 2HYKA 1H1IA 4RQPB 1PO12 5FLIA 1KQRA 3NV4A 3MPBA 5CFCB 4COZA 3AKRA 3OF1A 1LHNA 2KU3A 4ZZ8A 2UY9A 4XTMA 1NY72 5FLJA 1XBFA 1ZZBA 3ASIA 3SH4A 1ZREA 2XWJB 1MEC2 2O8OA 2VOWA 2FUIA 1GWKA 4D7TA 1IG3A 2IFRA 3HPNA 5TDWA 4B8EA 2BEOA 5T50A 4CDUA 2CNAA 2P3YA 1O4TA 2ZGKA 2WIIB 2XOZA 3MHZA 1ND3B 4ZQLA 1WBLA 4DY3A 4DQAA 3WDXA 1GV9A 3AMQA 4B4QA 1TMF1 3ZFGA 2VTXA 1VBC3 2Y6JA 4ZXEA 1CPNA 5HCFA 3WDYA 3R0RA 3ZX7A 1K12A 3POYA 3QH7A 1QGLA 5J7MA 4CCCA 1AYN1 1W2OA 3HD8B 1XOYA 2WQZC 1RHI1 1DDLA 2VMDA 5FPUA 1Q43A 1WE9A 1PGL2 3KZ4C 2Y60A 5LA9A 5H1TA 2CKLA 1BQPA 3FHQA 1DF0A 3MW3A 2WLQA 4XFIA 2BFUL 5ANQA 3T0AA 2JG9B 1F4AA 2EXJA 4R8HA 4YNIA 5A32A 2EA6A 4Q4X3 1VBD1 1MS8A 2IUWA 3HNMA 4XAAA 1DYOA 1AR62 2BGCA 1ZZ6A 3CF6E 3TAYA 1DIWA 1YYNA 1RUI1 2HJIA 2J1EA 4YG3A 5CU1A 3V0AA 3FEHA 4CUCA 2ARBA 5FREA 4YPJA 3RZZA 2AREA 3ZOIA 3RVHA 1MVEA 1LHVA 2GZWA 2H6CA 1GQHA 3WP6A 3HCSA 3I8TA 5T3NA 3VD3A 4CDUC 2E7TA 3ZFEB 3M3EA 1KRIA 1ZX5A 3TEZA 3VBHA 1UAIA 3WNLA 4P5OB 4NIGA 1B35B 4XUOA 2R32A 4N43B 3ZXFA 4CDXB 4NOTA 3B02A 1JMUB 5A1FA 4YG6A 3H7JA 1GZTA 2YU2A 2YV8A 2KXLA 2ZEXA 2R043 1WW6A 2LDRA 4URTA 1D0HA 5KWRA 2EGMA 5GZCA 2D8SA 2ECIA 4CTEA 3KV4A 3AMNA 4A0CD 1KDKA 3WR0A 4GB32 4PDWC 4UI9B 1YWKA 1C28A 1LOEA 4WZ3B 3I3BA 3MLLA 4IGPA 1VRBA 4M3CF 1WW7A 4LMFA 2RM22 3K4DA 4UF0B 1N87A 1S0FA 2VUDA 5FZHA 1N1YA 3ORJA 4DZGA 2Z5WA 2GMEA 4OZXA 4Q4Y1 4JRAA 3IMNA 4FIPA 4CCEA 2QQNA 4F8AA 3MV01 3AMMA 4Z1VA 1Q5OA 4LLFA 1UOBA 5C5UA 2CGNA 2FD8A 3E2DA 4YZ4A 4HN1A 4MADA 4NMIA 4RR3A 2VUCA 3B5LB 1ULPA 1QY4A 4UW5A 3WT3A 4B3NA 4COWA 4NHKA 4FAGA 1JYCA 2YU1A 4XJ9A 3PVNA 4D6RA 1Q56A 2W9XA 2JKXA 2YG0A 2VOKA 5F5QA 4EN6B 2FD4A 1LECA 2Y0IA 1TEIA 3ES4A 4RA0A 3LCPA 4CDQB 1U6GB 1LOGA 2OT7A 2VM9A 2ZKLA 4CA9A 4RFT0 2QQOA 1X9TA 4KMQA 1FPN3 3KQ4B 4RQPC 1OI6A 1SMVA 4PIYA 1QWRA 3NVCA 2GNTA 1JHNA 4K1ZA 5E16A 4KH9A 4QX2A 3VDAA 1V9U1 4N9HA 4C90A 2VW2A 3FLTA 3RZJA 2LXPC 4KL1A 4AVCA 2E32A 4OYUA 2R073 2FBEA 3NV2A 2BVVA 4QF3A 1UOJA 1VBA1 3HIFA 1XNAA 1W8UA 5CFCC 1W6MA 4K1YA 5C4WC 4WA6A 2XP0A 4WZ2A 1E5IA 1UKGA 5F3CA 1HKDA 2EF6A 2L0BA 1NCQB 3JB4C 4TLGA 4Q4Y3 5LCWB 5DXDA 4AI8A 2B9VA 1ST8A 5FO7B 4BQ2A 2XDVA 1LHUA 2LTNA 2X8KA 4K6BA 2C5DA 4JKKA 4N53C 3NRUA 2FUUA 2K46A 1YFUA 2XHNA 4QB2A 1SCSA 1OMIA 2AACA 2DSMA 1HW5A 5LY2A 4HN0A 1ULCA 1S0EA 2J1AA 2OS2A 4LHKA 4EWDA 2BERA 3BYWA 4META 5CG8A 1PZ8A 1BZWA 4MG2A 1CVNA 2MPFA 3HT2A 2X5IB 2FDJA 1LGBA 1I6XA 3ECQA 5TBNA 1QJEA 1SDDB 2RS12 2WWJA 1BEV2 3ZFGB 4JGYC 4P5HA 1DCQA 1PIV1 3M1HA 1BLZA 1FPN1 2B4KA 4D0QA 2VMIA 5IWFA 4GWMA 2FDHA 1IOAA 2ZX1A 4FPHA 3RNSA 4JGZB 1GKBA 3D4KA 3GBWA 2VAUA 3E6CC 1ZRFA 1O3RA 3AVRA 2MEV2 4JAAA 4DRRA 2F42A 1XNCA 3BB6A 5FY4A 3SXWA 1DYPA 1ND2A 1XRUA 2ZGSA 3BTYA 4P02B 4WVMB 3LA2A 3H8OA 1UU6A 3BTZA 4HLTA 2QTWB 4L0PA 4QQHA 3T08A 3ZXEA 2XG3A 3POWA 1CIWA 2JDNA 5FPBA 2BVBA 2DVFA 4HSLA 1FBVA 1DQ6A 2TNFA 1OHFA 5CG9A 2XB1A 1AYM1 4OULA 1ZZ8A 2ZEYA 1I9RA 5T5JA 3KT1A 3CIHA 2VOVA 5DMYA 2Q1FA 1CAWA 1FOD3 1WZXA 3B69A 4LKEA 4DFSA 4YGBA 3CZUA 4QQ2A 2BRTA 4MGSA 3LWCA 4N43A 4CDXA 4NR1A 1F5JA 2CSVA 2LRIC 1CJPA 4Q4X2 5ANNA 1W6OA 1CPMA 1D4M1 2JIJA 1JUHA 3P1IA 3THDA 1WMFA 1VRH2 1OFNA 4EN0A 2YQMA 2DCZA 4Z2AA 2JDZA 2C2LA 2YBKA 4QDSA 3RYRA 3MIHA 3SH3A 4BHWA 2WL1A 2YHJA 2OKXA 1RUG2 2ZS6B 2NPIA 3FL7A 5D8AB 2PUYA 2UWAA 2IQJA 1TMF3 1RIRA 3UESA 1H6XA 2NN8A 4UOJA 5FZDA 2A73B 2A1XA 2GMMA 3WF0A 4DUWA 5ACA3 5JMOA 5LWBA 2XOCA 1YQ2A 2CV6A 3KQIA 4YAXA 4AP4A 1NXD1 4N90A 1VYXA 4LUMA 1AX0A 4Q4V1 4CP1A 5C8CC 5I91A 3K3NA 4H7LA 5LEJA 2VO5A 1OQ1A 3BPSA 2P37A 4RR3C 4RR3B 2OIIA 3APBA 1W28A 4QU1A 5EQUA 2DCTA 2KWNA 2XUMA 4UFJA 5G04B 4AEKA 1OURA 5E6HA 2C9KA 5KHGA 2KKXA 3O7OA 1W05A 4A45A 2RDRA 4P9XA 4CCMA 3T0BA 5C70A 5TRBA 1H4GA 4MOAA 4ONUA 1US2A 1O5LA 4YW6A 5GKAC 1DHKB 2JXAA 4D6QA 4IEYA 5DAPA 3LOIA 1UY1A 3JCIA 5F2WA 1A3KA 3M8LA 1WCQA 1C1FA 2G1MA 2RMU3 2XJQA 5LA2A 4AEDC 4BOWA 2G6QA 1POV3 2VW0A 3PL0A 4FPCA 5JXHA 2JDAA 5EFUA 1H2NA 1XYPA 2J22A 3I3EA 1H8VA 3ZKYA 3N9QA 1QF3A 2Y0OA 5FQ0B 3AXEA 2JDMA 4BLIA 5FPXA 2FSAA 2ZZQA 2YT5A 2ZETC 1R1A2 3TNQA 1R082 3UKTA 5I0RA 1LB2A 1ZM1A 2E31A 2VJEB 4GB31 1TQ5A 2P57A 1PNGA 1LCLA 1PX3A 3ZVYA 3WLUA 2B0OE 2RG4A 2JWPA 4GMP1 3UT0A 1O91A 4UP5A 5C3RA 1FXZA 5BPXA 1R092 4AAPA 2RJKA 2QDRA 3VLBB 3WCRA 1VBC2 3ZSMA 3C7FA 3ZDVA 3VHOA 4CP9A 1ZBDB 2VZOA 1EYBA 2SLIA 1QJU1 2ZGOA 4UXAA 1QJFA 1RXGA 4HVQA 2W91A 4K3UA 3VBSC 1CD3G 4JC1A 3AKQA 4DXRA 1BK0A 3E1F1 3AKPA 4R4XA 2A3YA 3Q8FA 2H0DA 1NZIA 2CSGA 2YY1A 2VJFB 1AXKA 4GMP0 2CTVA 4HK9A 2BWCA 5C3OA 1W2NA 4LK6A 1RJ7A 2VY0A 3ZXLA 2HWC3 2O0OA 3PMEA 4Y20B 4XUQA 5FYZA 3WW4A 3ZYBA 3FX3A 4Z82A 4CUAA 4XABA 4EE2A 2MEV1 1FV2A 2GU9A 2RMU1 4G9SB 4ZXKA 1G6NA 3ELNA 4GXLA 3WF2A 5IHRA 4EZHA 2PTMA 3HMYA 3QLQA 3ZFFA 2E7QA 1PZ9A 1UQXA 2ZHMA 1C3HA 2LRPA 5CISA 4OI4A 3BTAA 2X05A 1V6IA 3SHRA 3WUCA 5A33B 2RDQA 1NY71 5JZGC 1YFYA 3FM8C 3SOXA 4TZDA 1QDCA 4Y5Z0 2CRRA 3QZVA 2WNUC 2ZOEB 4JDNA 4DEVA 4AFBA 1YXWA 1VD4A 1O5UA 1PGW2 2ZEWA 3QBQA 3WQ1A 5FXXA 2NZ9A 5FUPA 4YW2A 3O34A 1RGSA 1ASJ2 3O1OA 2Y34A 5KC5A 4QB1A 4YW3A 1QJY3 1MZEA 1OUXA 2VXRA 2VMHA 1QHDA 4LTAA 2QQLA 1RC6A 4Y33A 2R042 3NV3A 3WNPA 4QQLA 1QU0A 2GMPA 5KXEA 3O47A 2N7GA 4A2UA 5JPMB 4QXBA 3VDDC 1CAWB 4LBNA 4QGLA 2CSZA 2D98A 2VOXA 3SCGA 4CPBA 2QQMA 2VBBA 4CP9B 4RFRB 3M63A 3M3CA 2PHWA 5AVPA 5ABJA 4MHRA 4QPGC 4UFMA 1BEV1 3HCUA 1LNSA 3E5UA 5HV0A 3EHKA 1SPPB 4AI9A 5FYYA 4HKOA 5FY9A 4H55A 1EY2A 2RHPA 5FY5A 3WW1A 4H7MA 3R6SA 4ZU5A 4GNEA 1QIQA 1WLWA 2P2KA 2R0FA 4FPKA 4QX8A 4QU2A 5IW0A 2ECGA 3OGVA 5TDRA 5BNNB 3VB9A 4FPGA 4GKXA 3N7KA 2WS93 1XNKA 1YIPA 4YWAA 1V6KA 5A3NA 4P9YA 4N8MA 3DPLR 1CQ9A 5CFDC 2ILMA 4NRMA 3S30A 4ZU4A 3DQVR 2R1DA 5FCCA 3IB3A 4AI1A 1NE4A 1Z2QA 5KH9A 4D3WA 1DQ0A 3UKNA 2UWCA 2XHKA 3EQEA 4I09A 5EPAA 3VZMA 4CEWB 2VOTA 4FSJA 2ECJA 4E4HA 1BVVA 1HRI2 1R64A 3BIWE 3LQHA 4AVXA 1NUKA 1RUH2 4XJWA 1BVP1 1PO23 1Q8QA 2C4XA 2ZACA 1XB9A 3BODA 5CA6A 3PIJA 1UPIA 3LB9A 1SBEA 2YMZA 2DVDA 4C9ZA 3AP4A 1R1A1 5FZBA 2OW4A 4AXOA 5FP9A 2YUEA 2DWRA 2FZ2A 4AI0A 5D1IA 4K7JA 3I54A 3H3LA 3I97A 2EVXA 4V2VA 1MQTA 1IGOA 4L58A 1H2KA 1O7FA 2P34A 4N53A 5FZ7A 5LCWL 3VBHB 5FYVA 4XHXA 5A3MA 3CBNA 4JZRA 5FYCA 5GLWA 5A1AA 1RUC1 5HXMA 3V43A 3ZTGA 3GZTB 5FLHA 5B8DA 2MT5A 1MS0A 1UXXX 4QPWA 4ZKTB 1NLSA 2BZDA 3PDQA 2FCUA 2VJEA 1DGRA 2PQSA 2YB7A 3BUCA 5EHDA 3DEMA 3T2OA 1H8TC 3SITA 5JDBA 4RS5B 3HEIA 5IAXA 3I2JA 3MIDA 1VBA2 1DGWA 3NNGA 4BH9A 4W6WA 4QPGB 1BEV3 3KF3A 1JN2P 4HXCA 1LGNA 3LJUX 4UWDA 4YVSC 3GJBA 1LEMA 2AYHA 2RJ2A 4KWKA 2ARCA 2VU9A 1LOCA 2RMU2 3AZWA 1WEOA 1PVC1 3U5OA 2QQKA 4XFFA 2WWSA 1J83A 1TZOA 1WA4A 1OD5A 1A34A 4QPIC 4LOSA 1OA3A 3LEMA 4L99A 2MD8C 3S5AA 1OOPB 2VJFA 1RVF3 2R7EB 5DUWA 1EPWA 1DG6A 4RQPA 1OQEA 5FRAA 3OD0A 1MZFA 2A70A 1RMU2 3NWKA 4QQOA 4DEQA 2A75A 5C3PA 3N9OA 5GLTA 4AR2A 2DX8A 3HR9A 1LOFC 1N1VA 1OXCA 1WBFA 5FFOC 2EICA 3G7DA 3NJXA 1OLME 2A6ZA 4IDZA 1QNWA 2VMFA 3MUY1 3PUIA 3K48A 4IE6A 1MACA 2W68A 1U5ZA 1ZZ9A 3H8XA 1WEEA 3NAPC 1AR93 1Y3TA 2WNEA 1CX1A 4ATEA 4CDUB 5KC6A 4XFGA 1TNFA 2B42B 3AKSA 1X8MA 5FP8A 1PVXA 4I3GA 1ZBE2 4PI0A 4BYYA 4EJRA 4JCKA 2E6SA 1MS9A 5A7NA 2IXIA 3CU7A 4QXHA 5T52A 2Q8DA 1RUNA 2A6YA 3AX4A 2B5HA 4NRPA 2RS11 4UFHA 4YGDA 3O1UA 4AEDB 1DLLA 2E53A 5FP3A 1GOGA 2GH2A 1UYZA 3I59B 3KGZA 3CKHA 1HRI1 1I1EA 3POJA 2X5IC 3MIFA 5KH7A 3J8F1 1BHGA 3CJIA 2KR2A 2MD7B 3FE5A 1UYPA 2E26A 3IIIA 4DB5A 3GGLA 3H1YA 1X4UA 5A32B 2PN5A 2WT1A 2CL2A 2CSYA 3VHNA 1UW8A 4E8DA 3VBUA 1UCXA 4W4ZA 1SPPA 2VCCA 4QHBA 4Q27A 2VULA 3NJZA 4LA2A 4DINB 4KU8A 1HYIA 2AENA 4R9DA 3O1MA 4GJZA 1CAUB 1IKQA 4WV8A 4K40A 5BY5A 3GZAA 1EUTA 4PIXA 2WBKA 2GC1A 4OI1A 1Q3EA 2VECA 3ACHA 2BUKA 4P00B 1LOBA 1X7NA 2PHFA 2VQAA 3N9MA 1Z60A 4ITCA 2F6JA 4WVZA 2C0ZA 3BU0A 1QQP1 5FYTA 2CGPA 4XYXA 2UWBA 4YRDA 3LFMA 2RS13 1VFYA 2VL4A 1J59A 1EV12 5C3SA 3OTFA 1EAH1 4MV2A 2LGGA 1SLLA 1W8HA 2VVEA 4A6OA 1I3HA 3MI8A 4CXYA 2CGOA 3HAGA 2OZ6A 1XE0A 1F4HA 2DTYA 2VZPA 1Y9GA 3QH6A 4A6SA 1JTZX 2HWB2 3OPTA 5JXJA 1KFUL 1JOCA 2G19A 1PIV2 2KD7A 2VNRA 2W5FA 3FHAA 4HPKB 3T4HB 4MZUA 5E89A 1SQ4A 3WEZA 3RGBA 2L80A 2DURA 2WQ8A 3ACFA 2WNVC 4Z0RA 2WZR3 2KREA 1F2NA 3O37A 2EODA 2OPKA 2Z42A 3ILRA 5I0TA 1CIYA 1MBMA 4OGCA 5FPVA 5A7PA 2JEMA 1HLCA 4BXSV 3GBFA 1W6OB 4IEOA 4RD7A 1WA6X 3WINE 2XJSA 4ZS2A 4I3PA 1NA1B 3QACA 1KS4A 4JDMA 4DRVA 3VHPA 2DCYA 3NJVA 4SLIA 4Y5TA 3ZPV1 2QDNA 3JUEA 3OBZA 4L11A 5GM0A 2VPEA 4UFLA 2WWUA 3AMPA 4AGRA 4JHZA 5JSOA 4LBQD 1S0DA 1WEVA 5GLZA 1AF9A 3POBA 5CADA 4RGGA 3AMHA 1OD3A 1UN1A 1FPN2 3SNMA 4HONA 3ALQA 5EYYA 5A6XA 1VBB1 1ZBA3 5BNPA 2BNOA 4ZONA 3PVOA 4JQTA 5FY7A 4XF9A 2FHRA 2D3RA 2L5UA 2MUMA 1RYYA 1HV0A 2WSUA 3U78A 2V4AA 4O65A 1NLRA 3ZSEA 4CDWA 4LJNA 2A5ZA 2ZX2A 1A78A 4BWOA 3MEPA 3D5OA 4X8PA 1VIWB 5FBZA 5BNOB 5KBFA 1EPZA 1PM4A 4YBSA 1SHWB 3OUIA 4AGGA 3PHMA 2XH6A 3LRQA 3OY8B 5HBAA 5B4NA 4QKDA 4LHSA 1H30A 2F6BA 1J1LA 2XBO2 2GH8A 3IN9A 3VKFC 2CDPA 3ZN5A 1W8FA 1XJAA 1OT5A 3VBRA 4Q8KA 1RUC2 4HPKA 1ENRA 3MF6A 3POGA 2LGKA 4CA1A 5DQ0A 1D2QA 4W8JA 2KWKA 1UY0A 2VUJA 4P08A 4LJHA 2XQXA 3NG2A 2J1UA 4XXPA 1UY3A 5DAQA 1SZBA 4RHV2 3LKJA 2YURA 4S2GA 4LADB 2VR4A 4Y1YA 3AYEA 1TG7A 4I02A 5GZEA 5I8YA 4BM8A 4IEUA 5FZ8A 1YEWA 5F5AA 1SFYA 1LJ7A 1IS5A 1H1AA 2ORZA 2XVLA 5J1XA 1RUJ2 4YARA 1WILA 2YBSA 3L11A 5LK7B 2XJVA 4C1XA 3O0WA 5FKCA 4J1WA 1COV3 1AX1A 2WFPA 2R1BA 3FHIB 1GR3A 1O3SA 2Y1NA 2P6CA 2RVAA 2VC9A 4GNFA 1JZ3A 1AJKA 4ORFA 1QMJA 2WYSA 2C2VS 1J3PA 3E6BA 4YFZA 5FTTC 1LDJB 2V5YA 2XL9A 5C9AA 3URFA 1H2LA 2B7YA 2Z2SB 5BYNA 5IK7A 3THCA 1SCRA 2PELA 5JCTA 3ZXGA 2P3KA 3RWNA 1EV11 1GNHA 2XJTA 4CU9A 1C8M1 4OHXA 5J36A 5HCBA 3WXPA 2YYRA 3AYAA 1BKZA 1R091 2PHRA 4C0BA 1W6QB 4GALA 2ZA9A 2ECWA 2Z69A 5EJZB 2BGOA 3U14A 2W87A 1UOFA 2HWD3 1TNRA 2KGIA 3VL8A 2PLV3 3KV6A 3NSTA 4QM8A 2V09A 3OGGA 1UYXA 3OBTA 4OGEA 1YNAA 5D8AA 3SHBA 3AL5A 2ECTA 2D6NA 5FXZA 2Y1MA 3ZN6A 4AQ2A 5AFBA 5DG2A 3N7LA 3SMHA 4Q4W3 5IYYA 3MIEA 3ZYIB 1HJFA 2IWGB 1HRV2 4YVWB 1VE0A 5EXOA 1J84A 1VBE3 3R4DB 4V3KC 2GP5A 5JXIA 1P8JA 1LKNA 1VBA3 3GDBA 4K8RB 4BZ4A 5FEYA 5JOXA 2O1QA 1K3IA 4EROA 5AIUA 4AUQB 1ULDA 2VZRA 3GCXA 2YDEA 1W8ZA 3S7IA 1UXZA 1ALYA 1UO9A 4DNYA 1YJLA 2KWOA 4Q0UA 4RYDA 3DN7A 3FWEA 3MFCA 3N7MA 4XPVA 3VBSA 4R9BA 3FFQA 1GSLA 4FTSA 1H9PA 1PK6B 1ND2B 1W90A 2BJSA 5H9PA 1E5RA 1XNTA 2XVKA 1UZ0A 3S0MA 2LAUA 2JG8C 1FMD1 3LDRA 4LO6B 3IHPA 2JIGA 5JAXA 4SBVA 3NKTA 4AGVA 5LKZA 5IVCA 2BW8A 2LGLA 5BNPB 2QQIA 5KHIA 4FK5A 4BK4A 5KR7A 1GNZA 3VZLA 3SUBA 3CHXA 2HH9A 2BOJA 4WBBA 4EWAA 1TME3 2VVDA 5APAA 2R30A 4FJCA 3OBAA 1O4YA 1W6QA 2PHTA 4BBQA 2IFWA 1FNYA 2WINB 3ATGA 4FXKB 4MGTA 2NMOA 2ECVA 4JGYB 1FX5A 4PBOA 2P3IA 2GNDA 3HJRA 2ZZJA 4GA9A 4HFSA 3SQOA 2B46X 2WO1A 5FZCA 3WP5A 4BQWA 2YQLA 3UJQA 4CCGX 4P14A 2QQWA 1OPOA 2IVIB 1AXZA 3A4UA 1MQTB 3ILFA 1OLQA 2EAAA 2P4EA 1AJOA 2VZUA 2DV9A 2RS33 4GKYA 3O70A 3DDTA 5A7WB 1AYN3 1HXS3 2R062 3VZKA 1VBD2 1X9PA 2OQ7A 1FATA 4XEZA 1S0BA 1JU4A 1FNZA 5JR7B 1AR73 1REDA 2WO2A 5F32A 1J3RA 5C8CB 5JIUA 2Y6KA 1CAXA 4YM3A 3I2HA 2DJAA 4QKFA 1W9YA 4JHTA 3BIEA 2YROA 3IPVA 1D0GA 1JYNA 2ECNA 2YGMA 1ZA7A 4MSVA 4NWVA 4QPGA 1FT9A 4V2WA 4CDQC 5FZ4A 4F83A 2CKLB 2OXQC 5CYYA 3WG3A 5FZMA 4R52A 4YGCA 3IMMA 1LGCA 4ZZ5A 5K9YA 4K20A 2E33A 5J09A 3KHCA 2WNUA 1C5IA 2ZJCA 2EXIA 1QOTA 3CMGA 3JD71 2E63A 1JUIA 2IXKA 2LALA 2PAEA 2VMCA 5FJKA 2YPDA 3NAPA 4J25A 5CEHA 4KG8A 2I07B 1F8VA 1SLCA 3SCHA 3S7EA 3CJXA 3ASLA 5CIRA 4EN8B 3FBMA 4A4CA 3V65A 1NZCA 1NE6A 1WW4A 3N9LA 3ZPVE 5G04L 3HN1A 1FYUA 4B29A 5K8SA 1VAVA 4LXLA 4COUA 5IFTA 1KFXL 2MHFA 1VP6A 2XLAA 1AR82 5F5IA 2ZTNA 3ILNA 2BDRA 1SACA 1MM2A 3AFGA 2WFF1 5K0UC 2VJXA 1LULA 4AVVA 2QE3A 2XJPA 4O7XA 2MA6A 3JQXA 2UYBA 2VPVA 3KQRA 1KGYA 1Z0HA 2E7AA 2VXJA 2A3XA 2ARAA 3KCYA 5J96B 2ZXQA 4LBMA 4Q8LA 4LKAA 3IWZA 3OCPA 4F7ZA 4E2SA 3S5QA 4GNDA 4NE9A 5LKUA 3GCWA 2VW1A 2RR13 3OPWA 3W58A 2YFZA 2W95A 2HKXA 2IXHA 3MBWA 4QWNA 4YVWA 1IYMA 2WC2A 2VPDA 5AC91 3KS7A 3U5PA 1Q8SA 1C8NA 5FJHA 5FZIA 4CPBD 2K17A 3PUQA 2WYFA 1DZRA 5TABA 2JG8B 4QHZA 2ORXA 1GBGA 3ZFFB 4YLZA 5LBEA 2K1JA 2ZKNA 3DV8A 2BU9A 4QD2A 1I5PA 1H4HA 3W59A 2GNBA 4C1WA 3O36A 3U11A 3SOWA 3EB7A 4AVBA 2WFF3 1AUYA 2FDIA 1JYXA 4QM9A 3D0SA 4IW3A 4FFFA 4CZSA 4P9LA 4B86C 3Q8BA 4KBZA 5F8PA 2XQRA 3ZNIA 2VCMA 5F7UA 3W5NA 4FOQA 4HG6B 2EGPA 1VBC1 2QQPA 1FAYA 1Q8VA 2WUHA 3T2QA 1RL3A 1AL0G 3KV9A 2CRWA 4EN7B 4CEYC 4YATA 4XIOA 4Q1PA 1O3TA 4HKLA 1UX6A 3I2KA 3ZSLA 2JM3A 1URXA 1FOD2 1XSRA 2GSYA 3ZMNA 1W9FA 4BLJA 3S57A 4FTBA 5FYHA 5C71A 3WDTA 4A7ZA 3ZN4A 5GZFA 5LK5A 1I5ZA 3W20A 5AC93 2Y8KA 1M4WA 4LBQA 1WLTA 3DXTA 2L75A 4GH4C 2YYOA 5FY8A 3U10A 1DQ1A 2C26A 2W92A 4D69A 5LBBA 4WM7C 3T09A 1CGPA 3MDBC 4CCOA 3AVSA 4NHLA 1QEXA 1SFPA 4QX5A 3JBG3 1X8EA 4AQ6A 3T6RA 4XC9A 1XSQA 4LT5A 1JXNA 1WLDA 2F4LA 4QPIA 2K16A 4Q0QA 2PYTA 4CCKA 1O8SA 3OG2A 3AZXA 2XWBB 3PNAA 4NROA 3T2TA 2VNOA 3UK9A 4BQ4A 2XGXA 4FPLA 4DO0A 1RVF2 1UF2C 2RDSA 2HWB3 2VD7A 3NO8A 3OGRA 3KT7A 4QXKA 3VN4A 3NNLA 2OUHA 3N9PA 3D6EA 5IVJA 3KSCA 2ZGMA 2CWMA 3P3PA 4MYEA 3K4ZA 3T0DA 5LA1A 1XU1A 3AKTA 2I45A 5G05L 1ONAA 2VGDA 3LZZA 3AP9A 2VCBA 3VKMA 3WNMA 4IGOA 3T7LA 3D3AA 4KU7A 3FFZA 2R49A 1ENSA 4XF1A 5DUXA 1QJY1 1D4VB 1DGWX 2VZQA 1AYN2 3DPRC 4YZ5A 4TXWA 1C57A 2J1SA 4OHWA 1RUF1 1GP6A 4MGYE 1HDKA 2ZGTA 3A7QA 1GOHA 3OUHA 4NPLA 1J1TA 4AEDA 4C91A 3ZXKA 3HT1A 2SBAA 1WW5A 5HPOA 3I59A 4BK5A 5K4LA 1SLBA 1UMZA 5DDJ2 1XNDA 3DL3A 2BTVC 1R083 1HQWA 3V0BA 3MO4A 3U75A 4R2YA 3J7MA 2ZAAA 2JDKA 4EV0A 3LF7A 1PMIA 2VCAA 1CR7A 4LO8A 4BE3A 3ZYJB 5IATA 1HJGA 5DAWA 2Q8CA 5FOJB 3O1TA 4Q4V2 4XE9A 3IZOA 3KB5A 1BBT3 3NJYA 5FP4A 2R061 2Y64A 5F3IA 2R6QA 3M7KA 1PMJX 3NQHA 4AHYA 4RN5A 2J1VA 2C24A 1UMIA 5CZKA 1V6LA 4DY5A 1V9U2 3Q8CA 2YREA 2VBPA 4AOCA 1RUH3 4XF0A 4XF3A 2WS91 4LITA 4KBBA 1ENQA 1PK6C 3WW2A 2WNVB 3H3ZA 5F6LB 3INAA 3WV6A 2JUNA 4XIKA 1R1ZA 1RTVA 3AFKA 3CQOA 1CESA 4XACA 4B1MA 1F31A 2ZX4A 4JGZC 1OOPA 4FQZA 4AK3A 3T1MA 3ZDSA 4A44A 4FPOB 2VQ0A 1RUC3 4GIQA 3SLIA 2W2IA 2DCJA 5FXVA 5DAXA 1X33A 2K4DA 1WEMA 3HBZA 2EXKA 2QFEA 4IV1A 4D8MA 4YZ2A 5C9AC 1JYWA 4N3WA 1HQNA 3VKNA 5CKNA 3TEYA 3LVRE 2JG8A 2W3JA 1SBFA 4AYUA 3M3QA 3WDWA 4QX1A 4S3OC 3FC0A 2Q8EA 4AVTA 3HCTA 3ON7A 3PVBB 1YFXA 1RUG3 4LIVA 4NHMA 3DPRB 3VBHC 4X6QB 4BISA 3FUQA 4GNGA 1QJU3 4FFIA 4KWJA 4LR4A 4N7IA 1GANA 1CZTA 1LHOA 4KWUA 5C4WA 3RWKX 3PLQA 1EUUA 1UD1A 4IEVA 2F6NA 2HYXA 3LSDA 4L2NA 2WLPA 4LNVA 1ZRIA 1SG3A 2ZEZA 4B4RA 1PIV3 3NNFA 3AYCA 4OI2A 1ZZCA 2HWC1 4U2AA 2YUCA 1MZ5A 5J48A 4DS0A 5D2AA 4IEXA 3RMYA 3GL6A 2G45A 2HDPA 4D94A 5D21A 3AJYA 3LPGA 5SVIA 4IV3A 5IVBA 4BXFA 2QVSB 4XUTA 2R063 2GP3A 5DAVA 3H1MA 4XJAA 4GB0A 4WM7B 3HTKC 1GQPA 1DLCA 4UT5A 4J6GA 2DBNA 3IDCB 4MGIE 1RVF1 3B00A 3C6WA 4MH0E 3KT4A 3THTA 2D97A 3WSOA 1S1AA 3MICA 1WCKA 5LATA 3WZ1A 1DCSA 4OI0A 4PLMA 2MEV3 2YPJA 5FWJA 4LEJA 3E6DA 3O1SA 4O9EA 1U0AA 2D6KA 1W2UA 3WF4A 2Y33A 5L9BA 4ZUXU 1WCDJ 4Y1XA 1W3XA 1GWLA 1JW6A 4Y20A 2PAMA 4CDWB 1AYM3 4DXSA 2F17A 5IVYA 2KYUA 1LEDA 4RSUA 5T5OA 2E6VA 1OQDA 1Y7BA 2MIQA 5B4XA 5LB6A 1NCRC 3MF9A 4IGQA 3N3HA 4GWJA 3ACGA 5A33A 3VKOA 3X29B 3J8F3 5LBCA 5FP7A 1RUE1 1F5FA 3DKQA 3PVEA 5A3WA 3O35A 2W1WA 3SISA 2FZ1A 4XJUA 3POIA 1N1SA 2ZMLA 4HZFA 2V5DA 3VBRB 4AEMA 5BNOC 4CEYB 4GJYA 4IE4A 4YFWA 3WHTA 4DMIA 3E5QA 1CHCA 1F35A 3U0ZA 1L7RA 1YIFA 2BWAA 4LIUA 4NVPA 3TOJA 4YGEA 4PHZA 3POEA 5CKMA 5K0UA 1NQDA 3GZEA 1SLTA 5FDBA 4AYCA 1MEC1 5M0TA 2RV9A 4XFBA 3KMHA 4MLOA 5F3GA 4D6SA 2EIDA 4XFAA 5FZFA 1GYKA 1X82A 3ZFEC 2BOIA 4BQ5A 3T1LA 4K21A 1YFWA 3LDKA 2Q0AA 4LBLA 3ZPOA 2J1RA 5H9RA 4JGYA 1WWYA 3MGUA 1SLIA 4CYDA 1W6PA 4FP3A 4E27A 5CAZA 1RUE2 2DU0A 2JB4A 4LBOA 4LORA 5A1LA 5IVEA 3H8RA 4JTNA 5FXWA 5FV3A 1PNFA 4WM7A 5FB0A 4M3CB 4QDRA 4E9KA 2M6MA 1S0GA 1WFKA 2HLEA 2X5IA 2C1FA 3KWVA 4UI9L 2G43A 5J3UA 5BUVA 1SDWA 3WQBA 2CY6A 1MS3A 4NO4A 4IQPA 1WLCA 4QDQA 5DN2A 5LA0A 4NIHA 3WW3A 4F3JA 2NAAA 2ZPXA 1OKOA 2ZGRA 1XE7A 5BXXA 4A41A 5E1RA 2GC2A 4Z92B 3I7DA 3B7MA 3OB8A 3JUUA 3K77A 4DIQA 1H0BA 1HX6A 1KDMA 4LKDA 2QJ0A 4LK9A 3WHUA 4A3ZA 4HANA 1DZTA 1ZYBA 4CEWA 1VRH1 2PQQA 2OVUA 5C6CA 4XUPA 5C33A 4ZS3A 2AR6A 1KJRA 4FFHA 3H0OA 3MZHA 2WZR2 2WA3A 1BJQA 2VVFA 1ZVFA 3VBRC 2ADEA 5SV8A 3VHRA 1JHJA 3ZM8A 1IPSA 1AL22 5E88A 2I2SA 1G9CA 1DZQA 1B09A 1Z7S2 1QQP2 1JS9A 2OUJA 2PLV2 4JKLA 5JSPA 2HWE3 4XUNA 1PGW1 3Q8EA 5JUVA 2L7PA 4CU7A 1AR61 4CUGA 4YC9A 1RUD3 4GAZA 4LO5B 4Y1ZA 5HV4A 1IQDC 2P1BA 2WKKA 3V56A 4B4PA 1ZBA1 1GNYA 4M0NA 1EAH2 1ODNA 2EALA 3ZSKA 4CCNA 1VB4A 3U4XA 5LKXA 4RGAA 5H9SA 1HN1A 2A6VA 4MGZE 2D5HA 3U4SA 3UGFA 3DYPA 3A0KA 4N4FA 3AZYA 3EB5A 5B77A 2HEWF 5FBJA 2WABA 2VZSA 1RB8G 4I0AA 2YGLA 4AHZA 1PGSA 4BJ0A 5EJ3A 2XOMA 4XHBA 5I93A 3GHNA 1SEFA 4IUGA 1W04A 3ZYGA 2AN6A 3EMRA 4IV3B 4LBJA 2X29A 5LRRA 2DTWA 1NYWA 4YVSA 2ET1A 4Y1VA 1YI9A 4O62A 3HBKA 4YADA 5SVXA 2HWC2 2IXLA 1ZRRA 5HCHA 1PX4A 1N3OA 4U36A 1OLRA 4UFIA 4X6RB 4I2OA 4XDQA 3ZIWA 1NG0A 4NWWA 3KVAA 1KS5A 5DZEA 1FP0A 4WZFA 4FPEA 5FZ0A 4Y1UA 1OUSA 4HETA 4BMBA 2VH9A 1LDKC 4FPYA 2ENRA 2AUYA 4Q2FA 4FXGB 4HL0A 4W65A 5J3XA 3ROUA 5FWEA 3LDBA 1OFSA 2DU1A 3LPFA 1U5YA 4LLOA 1AR91 1ULFA 3BVCA 4LBKA 1S2EA 1QXRA 4M3CE 4Z2WA 2WA4A 1B35A 2DUQA 2VQUA 5BNPC 3JZVA 1E4UA 4COVA 3IIAA 5T5LA 3TYJA 3A23A 1WCSA 4JKMA 1RJ8A 1PGL1 1W0OA 2Y38A 1G25A 3TWIA 4CU6A 4BQXA 4I7DA 3VK6A 2W94A 4CCLA 5AITA 4H9DA 3RTRB 3GBGA 4E4ZA 4MO3M 1VMFA 3UYJA 3AJZA 3ZPYA 2HWE1 1LR5A 3DECA 3OGJA 3ZYPA 5FR3A 3VDDB 5L19A 1D4M2 1XNBA 3I2GA 5ABJC 4H14A 4YW7A 2D7FA 3BOPA 2QQJA 4DUVA 2QKDA 1STMA 5GLUA 1A8DA 2TUNA 1GP4A 2IXCA 4LE4A 1AR81 1BBT2 5F37A 1JODA 1W3VA 3IPVB 1E57A 3OJBA 3H3UA 3LQCA 1K42A 1WGPA 3IKWA 1L7QA 2ET7A 3MDPA 5A6ZA 4FI9A 1LESA 1XWHA 3VBUB 1BYHA 4MXWA 2GDFA 3DGTA 4PLOA 5LW9A 5DDJ1 1BK1A 2WNUB 4M3CA 4RS5C 5FZGA 3WNOA 3PTYA 4O9GA 4FBFA 4YW1A 3RZKA 4X3GA 2MA5A 4MXVA 1S55A 2CHHA 2PMWB 4OQ9A 1BXHA 4BA6A 4QHOA 4E8CA 3WVJA 5EWSA 1G9AA 3JQWA 4O64A 1WMXA 2HWD2 2YFUA 1UX7A 3WNNA 4ASKA 1W8NA 3OBRA 5I0UA 1RUF2 2X10A 2KE1A 2YZ4A 3BCWA 1RHI3 3LA3A 5J37A 1C8M3 2VUAA 3JXSA 1W39A 4LQRA 4XBNA 5T55A 4AVAA 2RR4A 2ZAHA 5H1VA 4YW4A 1MR5A 3ETPA 4NRQA 3J7LA 1IZ3A 4LHNA 2LM3A 1ZRCA 2IVJA 1RMU1 4FOWA 3RQ0A 1LHWA 3ITQA 5EZWA 4M4PA 1NCQC 3A22A 1AR83 2D6PA 2H6BA 4EWEA 3LAGA 3WNXA 3Q8AA 4LULA 1W6NB 4Q1RA 3ZXJA 2DF7A 4L92A 4QQ4A 3MLKA 4D7SA 3SEEA 5IT6A 4OUEA 1VAKA 3PTRB 4MGQA 3K75B 3W9AA 1OA2A 2PXJA 3U5NA 2RM21 2ZMKA 1IHMA 1G86A 4FFGA 1WESA 5FYUA 3VBOB 3B01A 1PVC3 5F39A 3T30A 4BIFA 1W2AX 4CCJA 3CZJA 4IXLA 1W03A 4R9AA 5A7WA 2EXUA 5BNQA 4BMEA 2OXBA 4W6YA 4HVRA 1ACCA 3FMGA 4AHWA 2WO7A 3KLSA 1AL21 3RFRA 3O1PA 1NKGA 2OX0A 1LU1A 5D8AC 2E61A 2M85A 3AP5A 1UU5A 5LZ6A 4KNCA 4JRLA 5I0SA 4JGZA 4AE2A 5LEKA 2A7AA 3VUOA 5EYAF 4S2FA 4MXWB 5FPZA 3O7AA 4D7YA 3I2DA 4QQPA 1X36A 1DYKA 5EJ1B 3TB0A 2FFWA 5DDJ3 2XJRA 1W99A 4JX0A 2WT2A 1YO8A 3FN9A 5FYBA 1ZNPA 4YZ1A 3WG2A 3I2FA 1WCUA 4URAA 5FYSA 1RUD2 5A6YA 3TNPB 5JWPA 5C13A 1XPWA 1M06G 3AZVA 3NAPB 2CONA 5H9MA 5LKTA 5B76A 3RPGB 3TEXA 4Q0VA 2CAUA 3UL2A 3RSJA 1JZ2A 3U5MA 2UU8A 2ZGLA 4UP0A 5L9RA 4YBTA 1AR92 4QXCA 1L7LA 5FPAA 3LIHA 1QKQA 1JZ8A 2GC0A 3Q1DA 3J7NA 5FZAA 2OYZA 1Z6UA 3RZHA 1IS4A 3Q9OA 2EA7A 4TWTA 1B35C 2BBVA 1H9WA 1U5IA 2QCSB 2XMLA 2Z4FA 4UFKA 1CZSA 4OVEA 2OA2A 4PI2A 1POV0 3OY8A 2D93A 2RS31 1UU4A 4ES8A 1O6UA 4TKPB 1ND3A 4H3WA 2CAVA 2JMJA 3H9AA 4HMZA 4Y4YA 1W9TA 1YCIA 4WM8C 3B9IA 4AQSA 3JD73 2R071 3KCCA 3ZXAC 1S4CA 4GQ7A 5TSWA 3ZSJA 4ARXA 2UURA 4N43C 4CDXC 1UZYA 2XVGA 3ACLA 3CJIC 4IEZA 1K5JA 2DBIA 3PMSA 4CVUA 1XC6A 5CKQA 2ZABA 2PHDA 4GZ9A 4E2GA 3SKJE 3WNKA 2Q1MA 1Y9MA 1E5SA 3N9NA 5L36A 1FI2A 1G9FA 3RJ2X 2NM1A 5FZ9A 4JQRA 2JG9A 3LA7A 3VZNA 1AX2A 2EXHA 1CJDA 2NQYA 2QQVA 1ODMA 1WMDA 3O0XA 1ENXA 3RYKA 2FDGA 3DUIA 3I4IA 3LE0A 1QH6A 3I3DA 5JXGA 2HWD1 2QICA 3KNVA 3BALA 2JG9C 2I50A 2JDUA 2HEYF 1H6YA 3MPPG 4TN7A 2EIBA 1YC61 3TN93 2E6RA 4PLNA 1VMHA 1LU2A 3WF1A 3O14A 4X8NA 3J4UH 2Q30A 1UMHA 2W1SA 4NPRA 4XXAA 2YHOA 3MFAA 1RUI3 5FZ6A 4AI2A 2LROA 2DUOA 1EV13 3EB6A 3NNMA 2QIZA 3AXDA 1NAEA 3FBYA 4WZCA 1HIXA 3VV1A 4E4SA 3OSDA 1X4JA 4NIDA 5FOBB 1NQJA 1GZ9A 1FV3A 4K8FA 3POSA 5FZLA 4PCRA 3O1VA 4BDVB 5HI0A 2WQ4A 2ADDA 5F3EA 2L43A 4KG0A 1KITA 3F95A 3FLRA 3OOXA 4Q4X1 4MHUA 4I01A 2QZ2A 1GLHA 2WR9A 4XQDA 5CBLA 3FANA 2X09A 3B9CA 3A21A 2A6WA 1DQ2A 2Y43A 2AH2A 4MVTA 4ARYA 5KXBA 2WN3A 4XAEA 4UF0A 3HVDA 2OWAA 1DQ4A 2WNVA 2XBO1 4MUVA 1CWPA 2G9ZA 2K0GA 4AEJA 4AYCB 2RJLA 4NUBA 5H9QA 2JE7A 2DDUA 2H0DB 5D1KB 2WFF2 2J1TA 4ZU7A 2XONA 3IDAA 1PZ7A 2VZTA 3VD9A 2FDKA 1MM3A 3OPZA 2BP6A 2RS53 1RUOA 1HB4A 3VD7A 4ES9A 4LOTA 4PPEA 5FB1A 2AEYA 2JJ6A 1VJ2A 4LO7A 4OCTA 4E4DX 1T6BX 3KF5A 5GLVA 4LHLA 4PTBA 2OQ6A 2TBVA 5L7OC 1WMEA 3DXUA 3HQRA 4CXWA 4CDQA 2D6OX 3DPRA 1FMD3 2DFCA 2F4PA 1GWMA 1MS4A 1UIJA 1XYNA 1YRZA 1C1LA 2KIZA 4W4UA 2HYED 4Y22A 4Z0OA 1DBNA 3TN91 2Y26A 5ACA1 1HRV3 2E9QA 2JKBA 2IC1A 4G4FA 4UW6A 2BPA2 4Q6FA 1QJU2 5A7SA 2O8QA 5FMDA 1YQ8A 1YLLA 4M0HA 1TME1 4J1XA 3M4FA 4AFMA 5A3PA 3T4VA 3OUJA 4YABA 1NCRA 2FMDA 1AR71 3DYMA 4JVAA 4NAMA 5DUVA 3WF3A 3GHMA 1K2FA 1DP0A 4DXTA 1NCQA 1RUJ1 4KI5M 1N1TA 2FQPA 2WAOA 2QNKA 3LEKA 4QT6A 5SVIB 3VD5A 1WENA 1W8WA 1JI6A 3BOWA 3THPA 4ISRA 3E5XA 2ZCWA 5JIAA 2DVBA 3M3IA 4I30A 5GALA 1S0IA 4Y24A 1ZRDA 5FZOB 4KQ7A 1VMJA 3LEGA 1NOVA 1IG0A 4XTPA 3KHBA 2CYFA 5FY0A 1CX4A 3H42B 3BI3A 4BIOA 5A3LA 2D44A 5CNAA 4ZPIA 3ZVZB 3VZJA 3EYPA 3ZYHA 1QH7A 3BN6A 4AVSA 1OOPC 4YBMA 1JYTA 3HWJA 3HNYM 2Q1ZB 1H8TB 2RR12 2WZEA 3AP6A 5L7OA 4GD4A 1VAMA 3OEAA 5JSRA 4G3YC 2RS51 1CAXB 4GMP3 2WJSA 5FPLA 4LLBA 4YVWC 1NA1A 1JZ7A 4Y4RA 5G0FA 4TSVA 3LQJA 4N7UA 5B75A 2RSDA 2FCTA 2VNVA 3DCQA 3AK0A 4EN9B 5EP9A 2W1UA 1NA1C 1D2SA 3QCWA 4WVMA 1E5HA 4YM2A 1RUF3 3USUB 3BU7A 4ZDTA 1RHI2 1HXS2 1IKPA 2PLV1 2Q4SA 3T2PA 1UPSA 5JR2A 1VBD3 5JLVA 3TRSB 3RYPA 4YG0A 2YBPA 1HRV1 1UL9A 1YQCA 2PA7A 3GNEA 3IDBB 4FO9A 1UZVA 5C4WB 4QX0A 5K0UB 1Z7S1 5JVVA 5C11A 4XETA 4OHYA 2V73A 1K5MB 3ZYRA 1S0CA 5D1LB 1TMF2 4CE8A 4Q4W1 4N53B 2VMGA 2BAYA 2BNNA 3I2IA 2QQUA 3L1XA 4XMIA 3H8UA 4CEWC 3IAQA 2JX9A 1PMHX 1YHFA 4ISQA 5JI9A 2Q8OA 5FUNA 5K3QA 5FZKA 3C3VA 4XILA 2HWF3 1D7PM 1VALA 3H7HA 1JOBA 3ENRA 1ND3C 1RUH1 5I0DA 3CEWA 2GC3A 1BMV2 4YYOA 3WQ0A 5AC92 3MUZ1 4JV4A 2AZ5A 4Z07A 3UV9A 1X4IA 5EIYB 2W47A 2WN2A 4XURA 5DZGA 5KH3A 3KVBA 3SH5A 2YC0A 2UYAA 4DUXA 2XLFA 2RR11 1QDOA 3D82A 1MZ6A 4NHYA 5DG1A 1NLQA 2DVAA 2XR4A 2ZHKA 3N7JA 3OYWA 1IS3A 1DU3D 1H8TA 4QX7A 4UW4A 2D8UA 3RRDA 2X53S 4FT8A 5EV7A 5BNNC 5KHKA 1Y43B 1WEQA 2LXHC 1F15A 1UOGA 4FPFA 4XJZA 1BORA 1LENA 3QOPA 4QB6A 2E51A 4XZUG 3LGRA 1GU3A 4PIZA 3U07A 2Q5TA 4S2DA 2W08A 3MYXA 1RINA 4HK8A 4QPYA 1ULEA 4XCBA 3VBUC 3P5BA 3WX5A 3ZVXA 1D4M3 4BQ1A 4IC3A 1ND2C 4S2HA 4C0HA 3ES1A 4W6XA 1KD7A 1CAVB 1T1HA 1W8TA 2JMDA 1WEUA 1HN0A 3M3OA 1OH3A 2OPWA 4AW7A 2NYYA 3FUOA 1A6CA 1QJX3 2ZHNA 1W8OA 1PM7A 4AFCA 4HSJA 3LIGA 4UBHA 4L9BA 1TME2 4NHXA 2GN3A 5E8AA 3PUHA 4YSFA 3HQUA 3HQXA 1BCXA 3LQIA 3HOBA 1K5MA 2ZMNA 1O4ZA 4PDWB 5FQ0A 1Z7S3 4Q0SA 4Y26A 3JBG1 2DCKA 2V4VA 3ZFEA 2HWE2 1OC1A 4PF1A 4YZ3A 3KCXA 2VZ3A 1Z78A 3K2OA 4HT1T 5FMOL 3RPQA 3VDCA 4AL9A 1OKQA 2D40A 1REFA 2HWF1 3CJIB 3WQ7A 3L2HA 1JYIA 4L7XA 4OHZA 4EYUA 1GZWB 1K45A 3KD4A 3IT8A 3W21A 4XQ4A 1V70A 1DGLA 3NNJA 2YSJA 1SLAA 4LO4B 4QMAA 4IE7A 1AR72 2JENA 2C6SA 1V9U3 3VBOA 3C8XA 1POV1 2JDHA 1F9KA 3AZZA 5I8TA 4Q5OA 1V00A 2KM2A 1Q8OA 3RMXA 2MNGA 4W50A 1Y4WA 4M00A 3C7HA 3EBRA 3ME2A 3OEBA 1ASJ3 4FTEA 2VBDA 2Y6GA 1QJX1 3NW4A 2HWB1 1LOFA 2YXSA 2QUOA 4QPIB 3VL9A 1WD4A 3ZO0B 1F62A 2VPGA 4TYSA 4LA3A 4OQ8A 3DYOA 1UZWA 2LQ6A 1VR3A 1N47A 4IEWA 5FY1A 5A7QA 1GICA 2Y6HA 4QKNA 4AFDA 2PAKA 2ARXA 1JZ4A 3TEWA 4NN0A 4HBNA 2IDAA 2D6LX 1SBDA 4IV1C 5AVAA 1VBB2 3NKGA 2HBUA 1YUDA 3ZKUA 2ZBJA 5FZ3A 1G9DA 3JU9A 2EIEA 2WZ8A 4XJ8A 3VZOA 3M99A 3GJAA 4FPJA 3WUDA 5LBFA 3JBG2 5IUQA 2A6XA 4NIAA 3O12A 5T5PA 3V64A 4AI3A 3WD5A 5HCAA 3I3MA 2D3SA 5DKAA 5FZEA 3SC7X 2D43A 4B1LA 3DWDA 4B7YC 4JTOA 2G9GA 4BQYA 3USSA 2Z79A 2R0HA 3DKWA 2H0BA 3HNBM 4P9WA 1UYYA 4IE5A 3UGGA 2PNXA 3V0BB 1DGRN 4PQQA 2L9LA 4CXXA 3KDEC 1YI7A 3RS6A 4XDPA 5EYXA 3WP3A 5GZDA 4HKWA 2KKYA 2BQPA 2MNYA 1QOSA 2B8MA 2VG9A 3BGAA 3R4SA 2ZX0A 4NPMA 5FK7A 2A71A 2XOYA 5K7PA 1WEPA 2ETEA 5FO9B 3AL6A 5GJ6A 5LRSA 1NXMA 4OUMA 5DPNA 5IK4A 3T3YA 2JB8A 2YHNA 3D0JA 5FYMA 3N4MA 1V6NA 2D3PA 3LSEA 4LKFA 4A49A 5I3LA 1MPXA 4V1PA 4FOYA 2H0VA 5KHHA 3OYWB 4MGKE 2M3HA 5JG6A 4OMCA 3S6PA 3POFA 3GV4A 3ETQA 2BGPA 2WRAA 1RUD1 4AZZA 1DFQA 1POQA 1VLNA 3AC0A 4KWLA 1BMV1 4Q26A 3NL1A 5JOZA 3ZFFC 1W06A 3LDYA 1FOD1 2W46A 4Q29A 2VTFA 2P6HA 3FJUB 1T6GC 1GUIA 1REEA 4Q4V3 3LOBA 2AGSA 4IV1B 4BHPA 1APNA 5IFPA 3BPZA 2KWJA 2V72A 1QXPA 3M2MA 2LW8A 4OLLA 1PHMA 4A42A 5ERLA 3SKVA 3MHSA 4MSXA 4BB3A 4B7EA 2CT2A 2ES3A 4EZ4A 3ACIA 1PO21 1U12A 4UBGA 2B39A 2RI7A 3GF6A 1O59A 2JECA 2QJVA 1EP0A 4FCAA 5BV6A 5FK8A 1QJY2 2ID4A 4ZHNA 2BBAA 3UGHA 3C5KA 5D1MB 4XQWA 2JDPA 1MVQA 4AWDA 5J98B 2VMEA 1JU3A 3VDDA 3WDVA 4QKBA 2CDOA 3PJQA 4R4ZA 4PQ9A 4XMAA 5FO8B 5SVYA 2JE9A 1G9BA 3AM2A 1LOAA 3C7EA 4F52B 2D6MA 4NAOA 4ET7A 4HVOA 4LPLA 5JI7A 3WP4A 4IEQA 2WSVA 4RS5A 3ZYFA 2BFUS 3ZFGC 1RUE3 2JMIA 2K2SA 2YC2A 4QF2A 1GZWA 4WZ0A 5I8SA 5C8WA 3M70A 4FQ4A 4XW3A 2KR4A 4OMDA 3M62A 1XYOA 1OA4A 3E97A 5DZFA 5IJRA 3MIBA 3N36A 1JOJA 2WZPP 1LTEA 3IBMA 1SFNA 3I3QA 3ZR6A 1CN1A 1S0JA 2G4IA 2VNGA 4I0BA 2VZ1A 2A3WA 2WZR1 2GN7A 3AB0A 3VBFA 4QX3A 5F2SA 5IVVA 3SCFA 1W2TA 2RDNA 2XB6C 4I0WB 4GB33 1ULOA 2XL7A 3IAPA 3VD4A 4GWNA 3ZYQA 1JH5A 3VBFC 1N3QA 1WGMA 1R081 3J9SA 2GALA 1PO13 2R16A 5L9VA 3FAOA 2JDYA 2EAKA 3OD4A 3H1WA 3RZGA 2IZWA 4Z8BA 3VDBA 2JRJA 3MV11 2RS52 4BCUA 1GQGA 3KM5A 2W0XA 3EXUA 1X50A 1BBT1 2ATFA 1W6NA 4NJ4A 1A8MA 3QD6A 4CEYA 5JMCA 3B94A 1V0AA 1MQTC 2B45X 2JD9A 4LK7A 3C2UA 4WVVA 4NIIA 2UZGA 1MEC3 5B2GB 2LN0A 4XFCA 3MLJA 1J3QA 3RJRA 2XUEA 2VQTA 2ZGNA 1WUVA 2NMNA 3OGSA 3O33A 4FOVA 5B79A 2AEZA 2BV4A 1LRHA 1VB2A 2HWF2 5F5CA 3WCSA 1FMD2 2XKOA 1IQAA 3V0AB 3HN3A 3PJYA 1RMDA 4OZOA 1N3PA 3J8F2 1XU2A 2MKEA 2PHUA 4COYA 1S2KA 4M4RA 4E2QA 1W0NA 5A80A 2J7MA 3PIGA 1W6PB 4GH4B 3A0NA 1HV1A
chains in the Genus database with same CATH topology
2ERFA 1VRH3 2M1RA 4KGGA 4IL7A 2K9ZA 4DXZA 1DQ5A 4P9IA 4RHV3 3VBOC 2EIGA 3JB8A 1IPKA 3RI9A 2UY8A 5FMOS 1QNYA 3H50A 3B3QE 1PO11 5IK5A 3MHHA 1CAUA 1RUG1 1JM7B 3MIGA 2B9UA 1L3JA 1MS5A 2ZGUA 3VBFB 2GAUA 3P3NA 2GNMA 3TN92 3ZMOA 1ASJ1 1AR63 4N9IA 2VNFA 1RMU3 1H2MA 2TEPA 3WG1A 3R05A 3MW2A 3WG4A 5F9TA 5JOYA 2W39A 1OPMA 1W6MB 5L73A 2ZX3A 2DVGA 1AVBA 2DFBA 2P3JA 4YW5A 5JZGB 2NLRA 3NV1A 2ZGPA 4QGNA 1WD3A 4PJYA 3USUA 1HQLA 4IC2A 5DINA 5CB7A 2MNZA 4S3OB 3SOUA 1RITA 3RI8A 2WS92 1ZZ7A 2OZJA 4B7KA 1XQNA 2YU4A 1H1MA 1DVPA 3IM0A 3CL1A 5FAXA 5FERA 3KGLA 2XJUA 1R1A3 1CONA 4XFHA 2KGGA 4PBPA 1IPJA 3B93A 2BNMA 4I7BA 1ZA4A 1PO22 4XF4A 2I74A 5C8CA 1R093 4JDOA 4UW3A 5HXVA 5JOWA 1O3QA 4Q4W2 3WOGA 3ST7A 2JICA 3AYDA 3GALA 3O0VA 5CVRA 3PHDA 2PHXA 2PHLA 2KA3A 2WT0A 4YVSB 1JM7A 2IXJA 4DPNA 5JPNB 1J58A 4IV3C 4OHVA 2DYCA 4Y22B 1AYM2 3WY6A 3FJSA 3RG0A 2G9FA 2CWSA 4XOGA 4DOUA 3J26N 1C5HA 2C9AA 4V3LC 1UKRA 1ZBE1 5CFDB 3JD72 4FAHA 4IESA 1NCRB 1C8M2 4LE3A 4Q0PA 1VBB3 4IERA 4LUKA 1GZCA 4GULA 4WVWA 4A3XA 2XEUA 4AG4A 3N35A 4QGMA 4CDWC 5JZGA 1W0PA 1U5XA 4K9SA 4A7KA 2R041 5BNOA 3ZXDA 4YM0A 3PURA 5DUUA 3L9JT 2LUWA 5ACA2 4Q4Y2 4L8QA 1V6MA 2ZHLA 4PDWA 5KXDA 4INDA 4P9JA 1C4RA 4IEPA 1PVC2 5G05B 2DUPA 4PF5A 1AHSA 3UKVA 1IS6A 4OUSA 4WM8A 1LODA 3M7AA 2RS32 4TLFA 1MS1A 1WEWA 5KHJA 3AP7A 3EO6A 5T54A 5SV5A 1ZBE3 5IK8A 2P17A 4GH4A 2HEVF 3UJOA 5H1UA 3IDEA 5ABJB 4FP2A 2PFWA 4AQTA 1HYJA 2XPJA 1Y9QA 1HXS1 2QZ3A 1S2BA 4A7YA 2LV9A 5B78A 2JD4A 1G8WA 2RM23 4CRQA 5J37A 2XLGA 1COV1 2D5FA 4CP2A 2VP7A 1ZBA2 2LGVA 5BNNA 4I7CA 5CFDA 4XBLA 3CO2A 4A4BA 1G7YA 3R4UA 3GZUC 4IETA 5C9AB 1TE1B 3RDIA 1HRI3 1V6OA 5F1RA 3FLPA 4R9CA 1VBE2 1QJZA 4OFGA 4ASLA 1AL23 1ULGA 5CFCA 3DF0A 3O5SA 4ASMB 1WIMA 4P9GA 1QQP3 2VPBA 1V87A 4AF9A 4L97A 4FVVA 2XBO3 1UIKA 3ZIXA 1EAH3 2NP0A 3G6JB 4LBQB 4BPZA 4M01A 1XE8A 5F6KA 4R8PK 3WDUA 1KJLA 3FZ3A 3ZN6B 1OSGA 3D8CA 3MW4A 3L1ZB 2RE9A 3K51A 2R072 1AZDA 4WM8B 3L2YA 3TBDA 4MX3A 5L7OB 3FL2A 3EJKA 1KXGA 4YM1A 1VBE1 2FMYA 4AHXA 3VKLA 1GFF2 4XZPA 5KXCA 2BYVE 1RUJ3 4R7EA 1AXYA 2YW8A 1CAVA 2W52A 1Q8PA 2YSMA 5AFEA 1QOOA 4CP0A 2KFTA 4RHV1 1COV2 2ZGQA 1PK6A 3VBSB 1QXJA 5GZGA 2XKPA 3GYDA 4KGQA 3KV5A 4RL7A 1JBCA 4XI1A 3CLPA 1UZZA 3H7YA 4XBQA 1XXNA 3RPGC 1QJX2 1YJKA 4AFAA 1V6JA 1K5MC 3VGIA 1RUI2 3CNAA 2HYKA 1H1IA 4RQPB 1PO12 5FLIA 1KQRA 3NV4A 3MPBA 5CFCB 4COZA 3AKRA 3OF1A 1LHNA 2KU3A 2UY9A 4XTMA 1NY72 5FLJA 1ZZBA 3ASIA 3SH4A 1ZREA 2XWJB 1MEC2 2O8OA 2VOWA 2FUIA 4D7TA 2IFRA 5TDWA 4B8EA 2BEOA 5T50A 4CDUA 2CNAA 1O4TA 2ZGKA 2WIIB 1ND3B 4ZQLA 1WBLA 4DY3A 4DQAA 3WDXA 1GV9A 3AMQA 4B4QA 1TMF1 3ZFGA 1VBC3 1CPNA 5HCFA 3WDYA 3R0RA 3ZX7A 3POYA 3QH7A 1QGLA 5J7MA 1AYN1 3HD8B 2WQZC 1RHI1 1DDLA 1Q43A 1WE9A 1PGL2 3KZ4C 5H1TA 2CKLA 1BQPA 3MW3A 1DF0A 2WLQA 4XFIA 2BFUL 2JG9B 2EXJA 4R8HA 4YNIA 5A32A 2EA6A 4Q4X3 1VBD1 1MS8A 1AR62 2BGCA 1ZZ6A 3CF6E 3TAYA 1DIWA 1YYNA 1RUI1 2HJIA 4YG3A 5CU1A 2ARBA 5FREA 3RZZA 2AREA 1MVEA 1LHVA 2GZWA 2H6CA 1GQHA 3WP6A 3HCSA 3I8TA 5T3NA 4CDUC 2E7TA 3ZFEB 3M3EA 1KRIA 1ZX5A 3VBHA 1UAIA 4P5OB 1B35B 2R32A 4N43B 3ZXFA 4CDXB 4NOTA 3B02A 4YG6A 3H7JA 2YV8A 2KXLA 2R043 1WW6A 2LDRA 4URTA 1D0HA 5KWRA 5GZCA 2D8SA 2ECIA 4CTEA 4A0CD 3AMNA 1KDKA 3WR0A 4GB32 4PDWC 4UI9B 1YWKA 1C28A 1LOEA 4WZ3B 3MLLA 4M3CF 1WW7A 2RM22 1N87A 1S0FA 1N1YA 4DZGA 2Z5WA 2GMEA 4OZXA 4Q4Y1 4JRAA 3IMNA 4FIPA 4F8AA 3AMMA 4Z1VA 1Q5OA 4LLFA 2CGNA 4YZ4A 4HN1A 4RR3A 4UW5A 3B5LB 4B3NA 1QY4A 4COWA 3WT3A 4NHKA 4FAGA 1JYCA 4XJ9A 3PVNA 1Q56A 4EN6B 2VOKA 1LECA 2Y0IA 1TEIA 3ES4A 4RA0A 3LCPA 4CDQB 1U6GB 1LOGA 2ZKLA 4RFT0 1FPN3 4RQPC 1OI6A 1SMVA 4PIYA 1QWRA 3NVCA 2GNTA 1JHNA 4K1ZA 5E16A 4KH9A 2HYED 4C90A 1V9U1 4N9HA 2LXPC 2VW2A 3FLTA 4KL1A 4AVCA 2R073 2FBEA 3NV2A 2BVVA 4QF3A 3HIFA 1VBA1 5CFCC 1W6MA 4K1YA 5C4WC 4WA6A 4WZ2A 1UKGA 1HKDA 2EF6A 2L0BA 1NCQB 3JB4C 4Q4Y3 5LCWB 5DXDA 4AI8A 5FO7B 1LHUA 2LTNA 2X8KA 4K6BA 2C5DA 4N53C 2FUUA 1YFUA 1SCSA 1OMIA 1HW5A 4HN0A 1ULCA 1S0EA 4LHKA 4EWDA 4META 5CG8A 1PZ8A 1BZWA 1CVNA 2MPFA 3HT2A 2X5IB 1LGBA 1I6XA 3ECQA 5TBNA 2RS12 1BEV2 3ZFGB 4JGYC 4P5HA 1PIV1 3M1HA 1FPN1 2VMIA 4GWMA 1IOAA 2ZX1A 4FPHA 3RNSA 4JGZB 1GKBA 3D4KA 3GBWA 3E6CC 1ZRFA 1O3RA 2MEV2 4JAAA 4DRRA 2F42A 1XNCA 3BB6A 3SXWA 2ZGSA 1DYPA 1ND2A 1XRUA 4WVMB 3LA2A 1UU6A 4HLTA 4QQHA 3ZXEA 2XG3A 3POWA 1CIWA 2BVBA 2DVFA 4HSLA 1FBVA 1DQ6A 2TNFA 1OHFA 5CG9A 2XB1A 1AYM1 4OULA 1ZZ8A 1I9RA 5T5JA 3KT1A 2VOVA 1CAWA 1FOD3 3B69A 4DFSA 4YGBA 4QQ2A 3LWCA 4N43A 4CDXA 4NR1A 1F5JA 2LRIC 1CJPA 4Q4X2 1W6OA 1CPMA 1D4M1 1JUHA 1WMFA 1VRH2 1OFNA 4EN0A 2YQMA 2DCZA 2JDZA 2C2LA 3RYRA 3MIHA 3SH3A 4BHWA 2WL1A 2YHJA 1RUG2 2ZS6B 2NPIA 5D8AB 2PUYA 2UWAA 1TMF3 1RIRA 2NN8A 4NN2A 2A73B 2GMMA 5ACA3 3KQIA 4YAXA 2CV6A 4AP4A 1NXD1 4N90A 1VYXA 4LUMA 1AX0A 4Q4V1 4CP1A 5C8CC 5I91A 4H7LA 5LEJA 1OQ1A 2P37A 4RR3C 4RR3B 2OIIA 3APBA 2KWNA 2DCTA 2XUMA 5G04B 4AEKA 5KHGA 3O7OA 4P9XA 5TRBA 1H4GA 4ONUA 1O5LA 5GKAC 1DHKB 2JXAA 4IEYA 3LOIA 3JCIA 1A3KA 3M8LA 1C1FA 2RMU3 2XJQA 4AEDC 4BOWA 2G6QA 1POV3 2VW0A 4FPCA 5EFUA 1H2NA 1XYPA 1H8VA 5FQ0B 1QF3A 2Y0OA 3N9QA 3AXEA 4BLIA 2YT5A 5FPXA 2FSAA 2ZZQA 2ZETC 1R1A2 3TNQA 1R082 3UKTA 5I0RA 1LB2A 1ZM1A 2VJEB 4GB31 1TQ5A 1PNGA 1LCLA 3ZVYA 3WLUA 4GMP1 4UP5A 1O91A 1FXZA 5BPXA 1R092 2RJKA 2QDRA 3VLBB 3WCRA 1VBC2 3ZSMA 4BBQA 5B8DA 3VHOA 1ZBDB 1EYBA 2SLIA 1QJU1 2ZGOA 4UXAA 4HVQA 3VBSC 4K3UA 1CD3G 4JC1A 3AKQA 3AKPA 4R4XA 2A3YA 2H0DA 2YY1A 2VJFB 1AXKA 4GMP0 2CTVA 4HK9A 2BWCA 1RJ7A 2VY0A 3ZXLA 2HWC3 2O0OA 3PMEA 4Y20B 3WW4A 3FX3A 4Z82A 2MEV1 1FV2A 2GU9A 2RMU1 4G9SB 4ZXKA 1G6NA 3ELNA 4GXLA 2PTMA 3HMYA 3QLQA 3ZFFA 2E7QA 1PZ9A 2ZHMA 1C3HA 2JRJA 4OI4A 3BTAA 5A33B 1V6IA 3SHRA 3WUCA 5JZGC 1NY71 1YFYA 3SOXA 4TZDA 1QDCA 4Y5Z0 3QZVA 2WNUC 2ZOEB 4JDNA 4AFBA 1YXWA 1VD4A 1O5UA 1PGW2 3QBQA 3WQ1A 2NZ9A 4YW2A 3O34A 1RGSA 1ASJ2 5KC5A 4YW3A 1QJY3 1MZEA 2VXRA 2VMHA 1QHDA 4LTAA 1RC6A 2R042 3NV3A 4QQLA 1QU0A 2GMPA 5KXEA 2N7GA 4A2UA 5JPMB 3VDDC 1CAWB 4LBNA 4QGLA 2CSZA 2D98A 2VOXA 3SCGA 3M63A 3M3CA 2PHWA 5AVPA 5ABJA 3HCUA 4QPGC 1BEV1 3E5UA 3EHKA 4HKOA 4H55A 1EY2A 2RHPA 3WW1A 4H7MA 3R6SA 4ZU5A 4GNEA 1WLWA 2P2KA 2R0FA 4FPKA 4QU2A 2ECGA 5TDRA 5BNNB 4FPGA 4GKXA 3N7KA 2WS93 1XNKA 1YIPA 3DPLR 1V6KA 4P9YA 3DQVR 1CQ9A 5CFDC 2ILMA 3S30A 4ZU4A 2R1DA 5FCCA 4AI1A 1NE4A 1Z2QA 5KH9A 4D3WA 1DQ0A 3UKNA 2UWCA 2XHKA 3EQEA 4I09A 3VZMA 4CEWB 4FSJA 2ECJA 1BVVA 1HRI2 3BIWE 3LQHA 4AVXA 1RUH2 4XJWA 1BVP1 1PO23 1Q8QA 2ZACA 3BODA 5CA6A 1UPIA 3LB9A 1SBEA 2YMZA 2DVDA 4C9ZA 3AP4A 1R1A1 2OW4A 4AXOA 2YUEA 2DWRA 2FZ2A 4AI0A 5D1IA 4K7JA 3I54A 2EVXA 1MQTA 1IGOA 4L58A 1H2KA 1O7FA 2P34A 4N53A 3VBHB 4XHXA 5A3MA 5GLWA 3V43A 1RUC1 3ZTGA 3GZTB 5FLHA 2MT5A 1MS0A 4ZKTB 1NLSA 2VJEA 1DGRA 1H8TC 3SITA 5JDBA 4RS5B 3MIDA 1VBA2 1DGWA 4BH9A 4W6WA 4QPGB 1BEV3 1JN2P 1LGNA 4YVSC 1LEMA 2AYHA 4KWKA 2VU9A 1LOCA 2RMU2 3AZWA 1WEOA 1PVC1 3U5OA 4XFFA 2WWSA 1WA4A 1OD5A 4QPIC 1OA3A 4L99A 2MD8C 2VJFA 1OOPB 1RVF3 5DUWA 1EPWA 1DG6A 4RQPA 1OQEA 5FRAA 3OD0A 1MZFA 2A70A 1RMU2 3NWKA 4QQOA 2A75A 5GLTA 3N9OA 2DX8A 3HR9A 1LOFC 1N1VA 1WBFA 5FFOC 3G7DA 2A6ZA 1QNWA 1WEEA 3K48A 1MACA 2W68A 1U5ZA 1ZZ9A 3NAPC 1AR93 1Y3TA 2WNEA 4ATEA 4CDUB 5KC6A 4XFGA 1TNFA 2B42B 3AKSA 1X8MA 1PVXA 4I3GA 1ZBE2 4BYYA 4EJRA 2E6SA 4JCKA 1MS9A 1RUNA 2IXIA 3CU7A 5T52A 2A6YA 3AX4A 2B5HA 2RS11 4YGDA 4AEDB 1DLLA 2E53A 2GH2A 3I59B 3KGZA 1I1EA 1HRI1 2X5IC 3MIFA 5KH7A 3J8F1 3CJIA 2MD7B 3FE5A 4DB5A 3H1YA 1X4UA 5A32B 2PN5A 2WT1A 2CL2A 2CSYA 3VHNA 1UW8A 3VBUA 1UCXA 4QHBA 4DINB 4Q27A 2VULA 3NJZA 4LA2A 4KU8A 1HYIA 2AENA 4R9DA 1CAUB 1IKQA 4WV8A 4K40A 5BY5A 3GZAA 4PIXA 2GC1A 4OI1A 1Q3EA 2VECA 2BUKA 2F6JA 1LOBA 1X7NA 2PHFA 2VQAA 1Z60A 3N9MA 4ITCA 4WVZA 2C0ZA 1QQP1 2CGPA 4XYXA 2UWBA 4YRDA 2RS13 1VFYA 1J59A 1EV12 3OTFA 1EAH1 4MV2A 2LGGA 1SLLA 2VVEA 1I3HA 3MI8A 2CGOA 3HAGA 2OZ6A 2DTYA 3QH6A 1JTZX 2HWB2 1KFUL 1JOCA 1PIV2 4HPKB 2VNRA 4MZUA 5E89A 1SQ4A 2L80A 2DURA 2WNVC 2WZR3 2KREA 1F2NA 3O37A 2EODA 2OPKA 2Z42A 3ILRA 5I0TA 2JEMA 1HLCA 3GBFA 1W6OB 4IEOA 4RD7A 3WINE 2XJSA 4I3PA 1NA1B 3QACA 1KS4A 4JDMA 4DRVA 3VHPA 2DCYA 4SLIA 3ZPV1 2QDNA 2VPEA 4L11A 5GM0A 3AMPA 4AGRA 5JSOA 4LBQD 1S0DA 1WEVA 5GLZA 1AF9A 5CADA 4RGGA 3AMHA 1UN1A 1FPN2 3SNMA 3ALQA 5EYYA 1VBB1 1ZBA3 5BNPA 2BNOA 3PVOA 4XF9A 2FHRA 2D3RA 2L5UA 2MUMA 1HV0A 2WSUA 1NLRA 3ZSEA 4CDWA 4LJNA 2A5ZA 2ZX2A 1A78A 4BWOA 3MEPA 3D5OA 4X8PA 1VIWB 5FBZA 5BNOB 5KBFA 1EPZA 4YBSA 4AGGA 3LRQA 3PHMA 2XH6A 3OY8B 5HBAA 1H30A 2F6BA 1J1LA 2XBO2 2GH8A 3IN9A 3VKFC 3ZN5A 4Q8KA 3VBRA 1RUC2 4HPKA 1ENRA 3MF6A 2LGKA 4CA1A 1D2QA 2KWKA 2VUJA 3NG2A 4XXPA 4RHV2 3LKJA 2YURA 4S2GA 4LADB 4Y1YA 3AYEA 4I02A 5GZEA 5I8YA 4BM8A 4IEUA 1SFYA 1LJ7A 1IS5A 1H1AA 2XVLA 1RUJ2 4YARA 1WILA 3L11A 5LK7B 2XJVA 4C1XA 3O0WA 2Y1NA 4J1WA 1COV3 1AX1A 2WFPA 2R1BA 3FHIB 1GR3A 1O3SA 4GNFA 1AJKA 4ORFA 1QMJA 2C2VS 1J3PA 3E6BA 4YFZA 5FTTC 1LDJB 2V5YA 2XL9A 5C9AA 3URFA