3I2DA

Crystal structure of s. cerevisiae sumo e3 ligase siz1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
286
structure length
280
Chain Sequence
b'TNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDETSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase SIZ1
publication title Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 59
structure length 280
sequence length 286
ec nomenclature ec 6.-.-.-:
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i2dA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3i2dA02
4LKAA 4MSXA 3U5MA 2F6NA 1Z6UA 2FSAA 5DKAA 1WEMA 2E6RA 2JRJA 1XWHA 2G6QA 5LCWB 5D1KB 2YREA 2ECTA 2VNFA 2CKLA 3LQJA 1WGMA 3C6WA 1N87A 3O33A 2YU4A 1V87A 1WE9A 2L5UA 2YQMA 1WIMA 2MNYA 2RI7A 4YADA 3T6RA 3MHSA 4A4BA 4BHWA 5J3XA 1BORA 2XEUA 5C13A 1WEVA 3QZVA 2CSZA 2YUCA 3PUQA 5KH7A 4YATA 2K4DA 3LQHA 4AUQB 2QJ0A 4AP4A 1U6GB 2M6MA 2EODA 3N9MA 4LK9A 3U5PA 2ECWA 2VPBA 3SOWA 1WEQA 1JM7A 3KNVA 2KWOA 3PHDA 4YBSA 1WEUA 1MM2A 2VJFA 2I50A 5H1TA 4N4FA 2YSMA 5TABA 2QICA 2C2LA 4A49A 4X3GA 2AN6A 1VYXA 2FUUA 4FJCA 2DX8A 2PUYA 3EB5A 2E6SA 4YBTA 2OXQC 4YAXA 1F62A 4I7BA 4A4CA 4B86C 4GNDA 4UI9B 3LRQA 1ZBDB 4FIPA 3HCUA 1WEOA 4BBQA 3ZVZB 3FL2A 2YURA 4GNGA 2IDAA 3HCSA 4P5OB 4LJNA 3SOUA 2YT5A 4S3OC 4ZQLA 3ZVYA 4R8PK 3O7AA 1Z2QA 4CA1A 4TKPB 1HYJA 2QIZA 2L75A 3V43A 3T7LA 4XI1A 2ECGA 3NG2A 1DVPA 2ECVA 4PTBA 4C9ZA 5JG6A 5C11A 4LLBA 2G45A 5KH3A 2BAYA 2F42A 3DQVR 1WENA 2KFTA 2Y1NA 2MA6A 1IYMA 1WFKA 3M63A 2LGVA 2KE1A 2LV9A 3O35A 2K17A 1WESA 2CSYA 4S3OB 5B76A 2ECJA 2LN0A 2D8SA 3N9QA 3SOXA 4V3LC 4N3WA 2JMJA 2KWNA 3M99A 3O70A 4WZ3B 3HTKC 5FEYA 2VPDA 1JOCA 4WZ2A 1X4JA 5D1LB 2H0DB 4AYCB 4MVTA 2ECIA 4I7DA 2MUMA 5G05B 2LGGA 2YHOA 1WEWA 3RTRB 4GNEA 2YW8A 2YQLA 4WA6A 5LKXA 5AITA 2YSJA 3KQIA 1JM7B 2VJEA 1E4UA 4QF2A 2MNZA 2HDPA 5B79A 2NAAA 3LQIA 2YYRA 4L7XA 4O64A 4FO9A 1X4UA 3RPGC 5D1MB 2EA6A 2VJFB 3ZYQA 1LDKC 4AVXA 5TDWA 4W4UA 3MHHA 1VFYA 4R7EA 5KH9A 5I3LA 4I7CA 3KV6A 3C5KA 3N9PA 1RMDA 2L80A 2RSDA 4UP0A 5B77A 4GNFA 5H1VA 4IC2A 2Y1MA 2HYED 1G25A 3N9LA 2M3HA 3ZPVE 2MD8C 4FK5A 3IHPA 5AIUA 1FP0A 2YHNA 2XB1A 3HCTA 5G04B 3RPGB 2KGGA 2M85A 4R2YA 3KV5A 2VPEA 3O34A 4Q6FA 3GL6A 4YC9A 2ECNA 3L11A 3I2DA 3GV4A 1WEPA 2CKLB 3ZNIA 2LRIC 5TDRA 3L1ZB 5TRBA 2LXPC 2VPGA 2LGLA 4B7YC 3U5OA 2KIZA 2MD7B 2JMDA 4A0CD 4ZDTA 2LGKA 2VP7A 5H9MA 3N9NA 5B78A 4IC3A 4F52B 4PPEA 1T1HA 3ZTGA 2M1RA 3DPLR 2JMIA 2EGPA 1HYIA 2H0DA 4YABA 4AYCA 2C2VS 5B75A 2PNXA 4YBMA 5FB1A 1VD4A 5G0FA 5H1UA 1LDJB 3U5NA 2MIQA 3O37A 2LDRA 5TBNA 2MA5A 5DINA 3EB6A 4GB0A 2KR4A 3ZPV1 2KU3A 4WZ0A 1WEEA 5EYAF 5B8DA 5LKTA 1CHCA 1X4IA 3N9OA 3VK6A 4LADB 4QF3A 2UZGA 2VJEB 2F6JA 2L0BA 2FUIA 4V3KC 2LQ6A 1Z60A 5LKUA 2KREA 2Y43A 2MT5A 3L1XA 2K16A 5LKZA 4CCGX 1FBVA 2KWJA 3O36A 1WILA 1MM3A 2ZETC 2KWKA 4ZUXU 2CT2A 5FERA 2G43A 4UP5A 3PURA 1K2FA 2KGIA 3M62A 2LXHC 3ASLA 4NN2A 2L43A 4L58A 3SHBA 5FB0A 2K1JA 2KYUA
chains in the Genus database with same CATH superfamily
4YM0A 4LA3A 1FI2A 4L0PA 4UBGA 2D6KA 1AJKA 4RQPB 5FLIA 3J8F1 3SEPA 4ARYA 3VBOB 4CU6A 4CP9B 4DXTA 1WLWA 4EZ4A 3AFKA 1C57A 1FXZA 4N43A 1H8TC 1ND2C 1WLTA 3AP7A 4NRMA 4FBFA 5CFCB 3V56A 4P5HA 5BUVA 4P9LA 5FQ0A 1XC6A 3CQOA 5FMDA 4CDXB 4XFCA 1N1VA 3LSDA 3ZSMA 1MQTA 4XOGA 5D1KB 2XWBB 2XGXA 3HT1A 3VHOA 5JMCA 4Q26A 4OUSA 1NCQB 2WC2A 1SACA 3RI9A 3UGHA 5JZGC 3ZKUA 1BYHA 5KHJA 4UW4A 1C5IA 3SH3A 1RUH2 1HRI1 3O0VA 1WGMA 3N3HA 5EJZB 5JXGA 3UESA 5CG9A 1BK1A 3C6WA 2A6WA 2VNRA 4JGZA 2YY1A 1COV2 2J1UA 4NAMA 1LJ7A 4C90A 1WE9A 2FFWA 1GP4A 4BQXA 1W8FA 2W9XA 1D4M2 4DINB 5IW0A 2YQMA 2VMDA 1ZZBA 4DUVA 5E88A 5FJKA 4LIUA 1W8UA 3HR9A 5I0TA 2TEPA 3HN3A 4IE5A 4BYYA 4LO4B 2P3YA 3CKHA 5LBFA 1PNFA 4A45A 1C8M1 1DQ0A 3NNGA 3LWCA 1JZ3A 3GHNA 2RI7A 4QDRA 4YADA 4AVBA 1XU2A 3E5UA 4A4BA 3W58A 2HWF2 5FY7A 4HKWA 1S2BA 3FBMA 1PMHX 1IHMA 3SNMA 3FJSA 5ABJC 4JGYC 1WEVA 2RS13 2J1VA 4FOWA 3AP6A 5FZFA 2CSZA 2YUCA 2R062 4R52A 2XJUA 4CCJA 5T5OA 1KS4A 2K4DA 1DZTA 3URFA 4K40A 3M3EA 4BQWA 5HCHA 3KQ4B 3BYWA 4BE3A 4DXRA 1TEIA 4JX0A 2JDAA 1HN0A 2ZMNA 5EXOA 5FYSA 2VOKA 1RMU1 1W6OA 4EN0A 2VVDA 2BRTA 5T5PA 3D6EA 1QF3A 1S0FA 2ZX2A 3DUIA 3WOGA 3WNOA 5JOZA 1D0GA 2ZX3A 1OUSA 1UYYA 2NLRA 2WAOA 2M6MA 5IAVA 5FUPA 5FZHA 5LA0A 4LO7A 3N9MA 3WNXA 3ZFEB 1QOSA 4R8HA 4U36A 1TMF3 2RDRA 1FPN3 3H3UA 3MICA 4BIFA 3OGRA 1UMHA 1IOAA 1O7FA 1OXCA 3MUZ1 4RGAA 5C3OA 4CUCA 2VPBA 4W6WA 4BB3A 4CU7A 2LS6A 1RIRA 3ZO0B 3KNVA 1MPXA 5L9BA 1IKPA 4NAOA 2VAUA 3AJYA 3HJRA 5AC92 1YWKA 1TME2 3M1HA 5D8AC 5IVCA 2VGDA 4CDWB 4UBHA 3BIWE 1BEV2 2FDIA 3HQRA 2VJFA 4QX2A 3EQEA 4NPMA 4QX8A 3LPFA 3DECA 3J9SA 5A6QA 1BLZA 1AL21 1V70A 1AL22 2W1UA 2O1QA 1T6GC 4CXWA 3PVOA 3THPA 1VBD1 3WUCA 1U12A 4MOAA 2Q8EA 2YC0A 4LOTA 1UY2A 2VZSA 5LBCA 4CEWC 4Q4W1 3M8LA 1ENRA 4UFKA 4DY5A 3OBRA 5A7QA 1QJU1 3R4DB 2PHWA 1QJU2 5LZ6A 3GNEA 1BHGA 1KEXA 2WUHA 4XMAA 2VO5A 4PIZA 5GLVA 1WCSA 1UY0A 4N90A 1XYPA 3WNNA 4CE8A 4META 2Q8DA 5C3RA 3RZGA 5E89A 2RS52 1ZBE2 2E6SA 4BXSV 3VDDC 5FXWA 1NXMA 2PYTA 1H4HA 1R091 1Q8SA 1R092 2JD9A 1F62A 4QWNA 4A4CA 3UYJA 2FZ2A 4OMCA 4XFHA 3ILNA 3BPZA 3POSA 2ID4A 3PHMA 4KH9A 5IHRA 4F83A 2PN5A 2X09A 3BPSA 3LPGA 5FLHA 1ZBDB 4NPRA 2QBXA 3MLKA 3HD8B 4NHKA 3NVCA 4S2DA 4CUBA 2WNOA 2DVGA 3S6PA 3HCUA 4QPGC 2VMHA 4QGLA 4XFAA 2MPFA 1YEWA 4YWAA 2A73B 4ISQA 3ENRA 1O4YA 1GOGA 4Y20B 3ORJA 1H1AA 4H14A 1W6NA 1ND3A 2K0GA 4RR3B 4XQDA 3W21A 3SQOA 1REFA 2IDAA 5ACA2 1GQGA 3SOUA 4KWLA 4MYEA 2W46A 1W6MA 3VLBB 4WM7A 1W6PB 1C4RA 1C8NA 1PM4A 2JXAA 4V2WA 3O7AA 1Z2QA 1HYJA 2GC3A 4WVVA 1EV11 3ZYRA 3USSA 2G1MA 4UFLA 1OPOA 4HKLA 5A33A 4IEVA 1YNAA 3I3MA 3NG2A 5JUVA 5B2GB 5EV7A 1IKQA 2JDYA 5HI0A 4DXZA 5IWFA 1ZRFA 2PA7A 3ZR6A 1LU1A 4DIQA 5HXVA 1ONAA 1UPSA 4C9ZA 2ORXA 4Q1PA 2Q30A 4NUBA 3PU8A 4OZXA 4YVSA 3VKMA 4ZHNA 1JYVA 4CU9A 4HSLA 2B45X 4LULA 1F2NA 1VRH1 3OD0A 2H0BA 5C4WA 1WLDA 1OQDA 4JKKA 4FAGA 4YM2A 2YGMA 3KCYA 2XVLA 3CLPA 2QKDA 1NCRB 2RM22 4COVA 1F4AA 3I7DA 4FQZA 3P6BA 1OKOA 2G9FA 5IK4A 5C8CB 2CY6A 1ND2A 2WA4A 3TNQA 5CKMA 2LGVA 3DF0A 3N35A 3O1VA 5I0UA 2LV9A 5JMOA 4LBOA 5K9YA 1XE8A 5ISLA 5F39A 1NA1A 4IEPA 3N7KA 2ECJA 5J98B 1LKNA 4ATFA 3OY8A 4TXWA 2RDQA 3WP4A 1AYM1 1KD7A 2VU9A 2VMFA 3OJBA 4LBQB 5A32B 3RSJA 2XOYA 4O9EA 2VNOA 1E5HA 3JD72 5LEJA 1K12A 3LE0A 3KV9A 4B4QA 1KXGA 3QACA 3M70A 3BOPA 3ZFFC 3TBDA 4A4AA 3TNPB 5J36A 2GU9A 5HCFA 4HK8A 1VMHA 4IV1A 1TG7A 5H9RA 2ZMLA 3ACFA 3VHRA 4FSJA 1BBT1 2HWC3 2H0DB 4I0WB 3T2TA 5JSOA 1URXA 3S57A 4QQPA 1UZVA 3EO6A 4MVTA 1AX2A 2C9AA 3K3OA 4YW2A 1QH7A 2CNAA 5FZ6A 4B7KA 3WHUA 1GANA 2VQUA 4OYUA 2PHRA 3WD5A 4E4HA 1WEWA 1GOHA 2LGGA 3N4MA 3MDBC 1US2A 4R9CA 1ULOA 3WLUA 1W8NA 4Q4Y3 1UOFA 3RZLA 4URAA 3VL9A 4GXLA 2HEWF 2YBKA 1JZ8A 3OGGA 5ABJA 1PZ8A 4JGYA 3IMNA 5K3QA 5AITA 5F37A 2YSJA 2IXCA 3PTYA 2FCTA 2Y60A 2ERFA 3ZPYA 4CRQA 2KA3A 2WS92 2VZPA 4LBJA 5EPAA 4GB31 3ZXFA 5GZCA 4HVQA 4FFGA 4KL1A 1BKZA 2GNBA 4Y5SA 1OUXA 2NAAA 3LQIA 4L7XA 4O64A 5IVEA 1GBGA 4MGSA 3ZYQA 4XHBA 3JQWA 1JYXA 1AXKA 4HLTA 3VBHA 1UN1A 2V5DA 1UNBA 1QY4A 5TDWA 4HPKB 2XJSA 1EPWA 4D7YA 4W4UA 4QPIC 4PQQA 2W2IA 1V9U1 3BU0A 2HWD3 3C5KA 1CAXA 2R071 2DF7A 4UP0A 2WNUB 2VTXJ 1UYZA 1XYOA 2W92A 4PF1A 1U0AA 3O1OA 3NL1A 4FPOB 1AYN1 1HXS1 1UIJA 4Q0VA 4GNFA 2ATFA 2I07B 4Q4V1 2FMDA 3J7LA 1D2SA 2A6ZA 3RRDA 3JBG1 1RUNA 2M3HA 1VE0A 5IK7A 5SVIB 3C7FA 1DBNA 1RITA 3AZYA 3C3VA 3JCIA 2D40A 3IWZA 5EJ3A 1AR61 4MGZE 4JQRA 5FZ9A 1SBEA 1V6KA 1Q5OA 2WBKA 4HN1A 1JOJA 1RUD1 1W3VA 4CEWA 4LKSA 2ADEA 2IZWA 4ZS2A 2WZR2 5LY2A 2XLFA 4DZGA 4MGYE 1QXJA 3AMMA 4XJWA 5E6HA 3WF0A 3RPGB 1DCQA 4Y1YA 4Z82A 4AR2A 5H9PA 2DURA 2Y6HA 2KGGA 3O1TA 2W95A 1N1YA 5T50A 4MLOA 3MI8A 2JD4A 3A22A 2ET7A 1IG0A 1R1A3 2EXIA 3MLLA 3L2YA 2BW8A 2W68A 2ZCWA 4B3NA 5BNPC 2VPEA 3MF9A 1NLRA 4AK3A 3S0MA 2E7TA 2B5HA 3VDDA 1SHWB 4BQ1A 5CA6A 3HOBA 3AXEA 1YYNA 4FP2A 2J7MA 4FI9A 1PIV1 1O59A 3H1WA 2D6MA 1PIV2 1IPSA 5CFCC 1MZEA 1K5JA 3NNJA 4FXGB 1QU0A 4O9GA 3POIA 1VBE3 4QHOA 4C0BA 5A3PA 2JIGA 2CKLB 3WG3A 3ZNIA 4XILA 1RUC2 4AEJA 4LO6B 2PHDA 3B9IA 1ZBA2 4JQTA 3T1MA 1PO23 1PMIA 3V65A 4CUAA 4A6OA 2VCCA 3WV6A 2JENA 3OUIA 2C24A 3IIIA 4QPGB 2LXPC 2QJVA 2WJSA 3ETPA 2HWB2 2DCYA 1I3HA 5DUWA 1KJRA 3TN92 4BHPA 3RPGC 3WW4A 4MSVA 1LODA 3KSCA 5H9QA 1IGOA 1PZ9A 1WKYA 2Y0OA 1EAH3 2VMGA 2QQUA 2ZGSA 1M06G 3M3IA 3MW3A 4XJUA 4YLZA 1LNSA 1ULGA 4QM8A 2R042 4L97A 1G86A 2GMPA 2QQPA 1WBLA 2XBO2 4X6QB 1YC61 3VBFC 1XRUA 5CFDA 4BQ3A 1CJDA 2Y8KA 3K4DA 3MV01 4IC3A 4QQLA 4QQ4A 1SPPA 2ZGNA 1AXYA 2AZ5A 3OBZA 2PQSA 3DEMA 5JWPA 5KHIA 4Q5OA 4Z07A 4EJRA 1PVC1 1RUJ3 1UOJA 2OZJA 4AEDC 4DXSA 2UY8A 3WDXA 4SBVA 1Y7BA 4OCTA 3LJUX 3AMPA 2EGMA 4P02B 4JC1A 1CIWA 2LROA 3HBZA 5LBEA 2EGPA 3IDAA 2PELA 4EN6B 2YZ4A 3ATGA 2JECA 5CZKA 5FXXA 3WUDA 4YABA 4NROA 4Y26A 3R6SA 2C2VS 4FCAA 4LBKA 1FMD1 4UXAA 5DUVA 1S0BA 3OF1A 5A7PA 3I4IA 3ILRA 3K75B 4H2AA 4ZKTB 2JWPA 3TEZA 1VD4A 5FB1A 3WNPA 3H0OA 4NRQA 2Y33A 3N36A 4BDVB 4QX1A 4XJZA 1NOVA 1AX1A 5K0UC 3U5NA 3NW4A 4BXFA 2MIQA 4E2QA 4BM8A 2JDUA 2CDOA 4XURA 5AVAA 3RYRA 4XMIA 2IQJA 1S0DA 1AR81 1J1TA 1XNDA 3OUJA 2V5YA 1AR82 1D7PM 1BCXA 3ES1A 5DINA 2NYYA 1MZ6A 4MXWB 4IV3B 1RUE1 4RD7A 3MFAA 5DUXA 3I8TA 5FPLA 4BQ5A 5AVPA 1DDLA 4OI1A 5DG2A 3OPZA 2ZS6B 3KQRA 4G3YC 2JKXA 1J3QA 3KT7A 1FATA 2WQ8A 4RQPC 3WSOA 1W8WA 3VBOC 2DUPA 5FP9A 2XB6C 4MXVA 3VBRA 2NP0A 1RB8G 3POGA 3ZKYA 1F9KA 3ZSKA 1XNTA 4K9SA 4PJYA 3HMYA 3PVBB 2D93A 5IJRA 3ZFFA 4Q4X1 1F31A 1O8PA 4TZDA 5JOYA 4NIDA 4Q4X2 2A6XA 5BNNB 4CDXC 4RN5A 4FTSA 1I5ZA 2YHJA 2B0OE 2VPVA 3VKFC 3KT4A 1ST8A 4ZU5A 2RS32 3WQ0A 4V3KC 3RQ0A 3GDBA 1UU5A 1UCXA 2OYZA 5JPNB 1W6QA 5LKUA 2VJXA 3USUA 1KGYA 1NCQC 3AX4A 2B9UA 3AZZA 3ZDSA 3HT2A 4BK5A 5IFTA 2K16A 4IEOA 1DQ6A 4AHWA 5BYNA 1LOCA 2TBVA 3FEHA 2Q1MA 1ULEA 4D7SA 5FK8A 1US3A 2HWE2 3D0SA 1FBVA 2BBVA 4X6RB 2AGSA 4LJHA 5BNOA 2BEOA 2KWKA 2DFCA 5FERA 1JMUB 2DUQA 4UP5A 1AVBA 4ZXKA 1GR3A 3ZIWA 2LUWA 1X50A 3CEWA 1J83A 2A3YA 1ASJ1 1CJPA 1B35A 1F35A 3CJIB 2A6YA 2LXHC 4B29A 3ASLA 3AMNA 3FHIB 1NAEA 1XNAA 2DV9A 4MX3A 4XFFA 4NN2A 2WO1A 4LBNA 3SHBA 2Y34A 5JXHA 1Q8OA 5M0TA 5T55A 2DYCA 2JM3A 2C0ZA 1I9RA 4FPCA 4LKAA 5HCBA 4BQ4A 3U5MA 1BXHA 4CCOA 2J1EA 5DPNA 1SZBA 1Z6UA 2F6NA 3DDTA 2FSAA 1MEC1 5DKAA 1WA4A 2HKXA 4QPIA 2WA3A 1TZOA 3VD9A 2ZGPA 4MO3M 5FO9B 3I3BA 1F5JA 2VMEA 2K46A 1XWHA 4HKOA 3O1MA 1VBA3 1YI7A 1RUI2 2ZEWA 4BLJA 2VZVA 1QQP3 3VKLA 4CCDA 3BIEA 4E4DX 2ECTA 1X4JA 5L19A 4XAAA 5EQUA 3OYWB 3SC7X 4KG8A 1NQDA 2MEV3 3NAPB 4W6XA 3AC0A 2X05A 5JIUA 2RR13 3I2HA 2OIIA 1CAWA 1JHNA 1HB3A 1FYUA 3VUOA 3T1LA 1WCDJ 1WCUA 1XOYA 2PLV3 3ZFEC 3NV3A 4Q0PA 3KF3A 2BWCA 5CAZA 3H7HA 1AR92 1KQRA 4XZPA 1PGW2 3AP5A 2L5UA 2SLIA 4GH4A 4GMP3 1H0BA 3B02A 3QH6A 2VW0A 5EYYA 4QX3A 4B1LA 2GNDA 4OHWA 3T2PA 4WZCA 5HV4A 1OA3A 1K42A 1WIMA 2K9ZA 4N53B 4QU1A 3WG1A 4FT8A 4I09A 2YFUA 4QKBA 4GZ9A 3HNMA 3MIFA 4MGQA 4CDWC 1I1EA 1ENXA 2IXHA 1SLLA 2GH8A 2XOMA 5CU1A 4YGEA 1SLBA 1OQEA 3T6RA 3O0XA 4M3CB 4MV2A 3PLWA 1JU3A 4BHWA 2R1DA 2AUYA 2XL7A 3PIGA 1WZXA 5BNPA 1BORA 4XVHA 1SCRA 5C13A 3AP4A 1Q3EA 4Z0RA 1OLME 5JI9A 2JG9B 5FYCA 4KU7A 5CKNA 2FZ1A 3LQHA 4FPJA 4C0HA 3BALA 4Q27A 2XQRA 1X9PA 5EZWA 2WT1A 1RHI3 1W0OA 1CESA 3C2UA 2JDPA 2DDUA 3NNLA 2GC1A 2EF6A 4LHKA 5FYBA 3W5NA 2OX0A 3IKWA 4RGKA 1LU2A 2D7FA 4PCRA 1QJY1 2VTXA 2R6QA 1S0JA 4M4RA 4EE2A 4QQ2A 4LBMA 4NR1A 4LK9A 4EYUA 1AJOA 2ZBJA 3K46A 1G9AA 5JIAA 3POEA 4RHV1 5IVFA 4NHLA 1FNZA 4OHYA 3QCWA 4OUMA 3KWVA 3UKNA 3ZYPA 1XNCA 3VZKA 3WT3A 4N8MA 1WEQA 1S1AA 2V72A 5AFEA 4J25A 2PHLA 2VUDA 2DFBA 4OHZA 3WR0A 5A7WA 3VB9A 4YBSA 2WAAA 3H8UA 2ZAAA 1CD3G 2ZEXA 3GZAA 5LK7B 3MDPA 4IL7A 2AACA 2F4PA 1UD1A 5C71A 4YFZA 4QD2A 1G9DA 5C9AB 3KV4A 2YSMA 1DGRA 1MACA 1W06A 2V4AA 2VOVA 3TOJA 3WP5A 1GZWA 5BXXA 5CB7A 1IS4A 4OGEA 1RUG3 3KHCA 1HRV1 4RR3C 2HJIA 2QQMA 1Z7S1 4A49A 4XC9A 5A7NA 4PQ9A 4PBPA 1PK6B 4F1PA 4LKFA 1W9SA 2WNVB 3ABZA 4XDQA 2PFWA 5EYXA 3A4UA 1UYPA 3W9AA 1ZZCA 1J3PA 1SDWA 3NJXA 3MUY1 4FJCA 2RE9A 4OZOA 3ST7A 1LHVA 5G0FA 2PUYA 4WVWA 3M3OA 4S2HA 1G9BA 4IERA 3THDA 1DLCA 4N9IA 3B93A 4AFDA 3PUIA 1C1FA 5FXVA 1E57A 3ZXEA 1R083 3IT8A 1OH4A 5K0UA 4OVEA 1OF3A 1JZ4A 3VBUA 2WQ4A 2J42A 2VZOA 1M4WA 3LEKA 2YMZA 4Y33A 1MZFA 3ZYGA 2ZHKA 4E27A 3NRUA 4XUOA 4YVWB 4ZZ8A 1V6OA 3GXUA 1SDDB 5J1XA 4LITA 3LEIA 4NIGA 3PUAA 3T2QA 3OGSA 1NCRC 2XG3A 1K5MB 3IAQA 4D3WA 3ZVZB 2B9VA 2RS12 4IE0A 4GKYA 4CP9A 3FL2A 5F2SA 4Y3OA 4YG0A 5C8CC 4GALA 5LY1A 4Y24A 4HXCA 4YW7A 2DCTA 4JV4A 3O7OA 4QX5A 5A70A 1XQNA 3HCSA 4CDXA 3GCWA 4XQWA 2VBPA 3RWKX 4YRDA 3ZVYA 1OBNA 4UF0B 1RXFA 4AGRA 3U0ZA 4CA1A 1YLLA 2VCBA 1NCQA 1YXWA 2L75A 1FV3A 3V43A 2RJ2A 1RUH1 1GP5A 1VBC3 5FTTC 4XCBA 2WZPP 1UY1A 1XSRA 2JICA 4IEUA 5FO7B 3WCRA 3FHQA 4LA2A 4N43B 2DVAA 1TMF2 1DZQA 1ULPA 1FPN2 3D5OA 1COV1 1MS5A 4P08A 3GF6A 5I8SA 3U1XA 4E2GA 3RZHA 2VW2A 1D4M1 3GCXA 4Z0OA 2WFF3 3ZXJA 4G9SB 5IVVA 4KWJA 5F7UA 3JB4C 2NPIA 1MQTB 4OLLA 1GWKA 5LK5A 4CDQB 5T54A 5I91A 5JG6A 2EXKA 5J96B 1FOD3 1Q43A 3FZ3A 1JZ7A 3ZSEA 1LOBA 3WNMA 4ASKA 4XZUG 4CYDA 2C9KA 1GLHA 4EN7B 2XR4A 1YQCA 4LOSA 1CAVB 2LW8A 2IWGB 3BU7A 3PUHA 4COYA 2HWF1 3IDBB 4QHBA 4DEQA 1ZVFA 3VGIA 5C7GA 2BVBA 4GJYA 4Q0QA 3X29B 2OKXA 1IYMA 3H1MA 1U5YA 2R061 4XFBA 4FOVA 4YM1A 2ZAHA 3M63A 1W05A 3ZMNA 4PIYA 2KE1A 2W94A 3MW4A 3PNAA 5J09A 2UWBA 3WF1A 4EN9B 1OMIA 4DFSA 5I93A 2CSYA 5B76A 1RTVA 2Q0AA 2LN0A 2XKOA 4GULA 3N9QA 1EUUA 5I0RA 2FDFA 2D8SA 2DJAA 2WSVA 2X8KA 1DQ1A 1H2KA 4AOCA 3DN7A 4MH0E 1A8MA 2EIDA 3U37A 3AL5A 1PGL2 1DQ5A 1JN2P 3FUOA 4FTBA 2ZOEB 4N3WA 4XF1A 1POQA 3R0RA 5CISA 5FXZA 4ASMB 3NO8A 1KJLA 4LBLA 4LHLA 3M99A 3O70A 4WZ3B 1ZNPA 4M0NA 5FPZA 2Q1ZB 3J8F3 5FPXA 3ZFEA 3FL7A 4CDUB 3JUEA 5FEYA 3LKJA 4FPHA 3POBA 4EWAA 5SVXA 3D0JA 4CP1A 1UYXA 4IEWA 1W2AX 2WNUC 1W9YA 3PU3A 4J1WA 4RSUA 2D6LX 3UGGA 5I0SA 4U2AA 3LB9A 4BQ2A 2VCAA 2X5IC 1WBFA 4YZ4A 1WW5A 1NZCA 1W6OB 5AC91 5D1LB 3VZOA 1C5HA 1TME1 2GALA 3I3EA 4AEMA 4AFBA 1JUHA 3NNFA 1BEV1 1D0HA 1I5PA 4H7MA 3SITA 4CDWA 2YHOA 3I97A 2ZHNA 4XUTA 1XNKA 3RTRB 4GNEA 3IBMA 4N7IA 4QQOA 3RZKA 5E16A 3WNKA 1WGPA 2P2KA 1MR5A 1V6MA 1IS6A 2BOIA 1HRI3 4PLMA 4OQ9A 4BQYA 1EUTA 2XOCA 2GNMA 5I0DA 2YQLA 5A7SA 2EIGA 4WA6A 4YGBA 1Z78A 3KGLA 1GV9A 3KQIA 1MS8A 2VJEA 3RZZA 3UJOA 2G9ZA 4A44A 3DYPA 1H2MA 5FUNA 1LRHA 1PX3A 2RMU1 5DZFA 2HDPA 1G7YA 3BGAA 2RMU2 1H9PA 1WLCA 5F6LB 2W1SA 1OHFA 2QQKA 2BBAA 2ZZQA 5FZ3A 4QB1A 2WIIB 5D1MB 2BUKA 2BNOA 1JXNA 1WMDA 4AVVA 3VN4A 2EA6A 4QXCA 1QH6A 2VJFB 4LPLA 3MFCA 1O5UA 3ECQA 2D3RA 1C8M3 1OLMA 1W2TA 2EXHA 5IFPA 2CRRA 2RS51 1QWRA 1ZBE1 3MHHA 4Q2FA 4R7EA 2VQ0A 4LR4A 1LCLA 5KH9A 4I7CA 4JTOA 1W9WA 1ULCA 3IB3A 5FMCA 4HFSA 3WQ7A 3O1UA 3ON7A 2ZACA 5G04L 1ZRDA 1LENA 3ACIA 1OVSA 2ZEZA 2OW4A 3MIHA 4B4PA 1LEDA 1QJX3 1AHSA 1ZA7A 5JAXA 2J1SA 5E8AA 1QXRA 3U4SA 2OS2A 2A75A 5A6XA 5B77A 4TN7A 5EFUA 1RMU3 3FLRA 4QXKA 4AQ2A 4DOUA 3PUSA 5KHGA 5FZBA 3N7MA 2TNFA 5T3NA 5C3QA 2HYED 1AUYA 2Y1MA 3WHTA 1ALYA 3WQ1A 1G25A 1CAUA 4FK5A 2JDHA 4P9WA 2E32A 3EHKA 3O14A 5FZ8A 4BH9A 2BDRA 3ALQA 2LALA 3AZXA 1N1SA 3I54A 4IEYA 3AZVA 4PDWA 4OI0A 1OI6A 1SQ4A 3WF4A 2JDZA 2JE7A 4CCLA 2XXZA 3LEMA 1LECA 5ACA1 2XB1A 1W8HA 2DUOA 4O62A 3VD3A 3IAPA 4DRVA 2W52A 3AB0A 2OWAA 2YC4A 4JTNA 5JXIA 5F5IA 1W6PA 2ZTNA 3ACLA 2HEYF 4COUA 1JU4A 5LA2A 5D21A 3WP6A 3LEGA 3VBSC 3I2IA 3E2DA 2R32A 3KV5A 3MIBA 5F3CA 4Q6FA 3AYAA 3H8XA 4I0AA 1AL23 1UZZA 3LQCA 1U5ZA 3I59A 2ECNA 2CU5A 5FYYA 2J22A 3SUBA 1V6JA 1RINA 1W6NB 2Y6JA 1VR3A 4V2VA 1QOOA 4WM8B 1S0EA 1VBD3 1SMVA 2Q5TA 2HH9A 2HWC1 2YUEA 2P4EA 2HWC2 3I2DA 5SV5A 5EIYB 2P3IA 1W6MB 3WDYA 4JHZA 4Q4W3 4WM7B 3VL8A 2EAKA 4K6BA 1WEPA 4XYXA 1O4ZA 2WYFA 2GP5A 3KM5A 3LFIA 4CCCA 5TDRA 5FYHA 1VJ2A 1UO9A 3LA2A 2XUMA 3R4SA 4Q4Y2 5A33B 1VBB1 2RM21 3HPNA 3LOBA 1VBB2 2GC0A 2AR6A 3NMBA 4LKEA 4P9YA 3AKTA 3O47A 4ISRA 4QMAA 2JB8A 5DQ0A 2LGLA 2UURA 3T3YA 5D1IA 2DCJA 4I3PA 4B7YC 2XQXA 2WABA 4XABA 3FAOA 1H8TA 1LTEA 3FE5A 3U5OA 1JS9A 1R093 2D44A 1WMEA 4QPWA 4YVSB 3KS7A 3ZFGB 4P9GA 2KIZA 2PMWB 2PXJA 1OFNA 1RUF3 4ZDTA 1ODNA 3INAA 3RWNA 5FMBA 2CSGA 3KD4A 4MHRA 1BMV2 4OHXA 3LCPA 4IV3C 5F3GA 3DXUA 5H9MA 4XACA 3N9NA 1OKQA 1LHOA 1VLNA 4K7JA 4AHYA 3AZWA 4LQRA 5BNQA 2XKPA 2W39A 4XJ9A 5JZGA 3UK9A 2VULA 2UY9A 3WZ1A 5A32A 5IAXA 3J26N 1G9CA 3JD71 1DIWA 4WZFA 1DQ2A 2D6PA 3UNPA 1X82A 2HWD2 2Y0IA 4MHUA 4IGQA 3NJZA 4GWNA 4YYOA 4PI0A 2ARBA 2A6VA 1H2NA 3S7IA 4OFGA 4D0QA 3F2ZA 3WG4A 5FYTA 5BNNC 3ZYFA 4I0BA 5C70A 4KNCA 4Y1ZA 5EWSA 2M1RA 3DPLR 2CRWA 2JMIA 3H7YA 4IUGA 1YFXA 4UFHA 5DXDA 2G4IA 5HV0A 3OY8B 2V09A 4BMBA 5FZ4A 1GICA 2EXJA 2CSVA 2H0DA 1H6YA 2DU1A 4DMIA 1O3TA 1HN1A 4AYCA 1ODMA 1W99A 2PHFA 1VAVA 3QD6A 4WVMA 1NYWA 1Y43B 4AF9A 2VMIA 4AI2A 4FPEA 2D6NA 2P6HA 1EV13 2GMMA 3FLTA 3LA3A 3LDYA 2JDNA 2WR9A 5IUQA 5IVJA 1VMJA 4YZ3A 1LDJB 2VZ1A 5H1UA 1W2NA 4IV1B 2PHTA 4JVAA 2WS91 3ILFA 4EQVA 1ZREA 2LDRA 3CJIC 4JRAA 4J6GA 3PMSA 1AL0G 4CA9A 3OD4A 1E5IA 2PQQA 4Q8KA 2MA5A 4AGVA 4QXHA 3ZLIA 3PIJA 5F5QA 4TTGA 3EB6A 1WCKA 4AAPA 2W47A 2HYXA 1R1A2 4WV8A 1VRH3 3MYXA 4NPLA 3W59A 5IT6A 2KU3A 5DAQA 5B8DA 2DWRA 3M3CA 1NLSA 1MS1A 3I2JA 4XF9A 3I2KA 4CTEA 4HPKA 1W8ZA 4A42A 4NHYA 3C7GA 2XJTA 2WL1A 3QH7A 4D7TA 1GFF2 4XUNA 1GOFA 1YJLA 3S30A 1EP0A 4JDOA 1YFWA 4PHZA 1UKGA 4W8JA 1CZSA 5C5UA 2FUIA 2X5IB 1Z60A 2LQ6A 1VBE2 1LULA 4ORFA 2AENA 3C8XA 5FZMA 1DFQA 5D8AA 1PO22 5JLVA 4YW1A 1DF0A 3VBHB 1S2EA 2OUJA 3JB8A 4DEVA 3NAPC 4FPGA 5FOBB 4Y1XA 1AYM3 4JRLA 4CCEA 3P5BA 2XOZA 2YYOA 3CNAA 5SVIA 2VUAA 3WNLA 3U75A 5FLJA 2KWJA 3KB5A 4UAPA 1F15A 2WDBA 5T5LA 2WO2A 4ZZ5A 5LCWL 1WILA 2YG0A 1Q56A 5F3IA 1EAH2 5A3NA 1Q8QA 5HXMA 1NT0A 1SLIA 3T4VA 2L7PA 2XLGA 1CR7A 2D3SA 2X53S 5TSWA 2FD4A 2WZR1 3K4AA 2CDPA 4N53C 4QT6A 4HANA 5FZAA 2ZEYA 2BOJA 2NZ9A 3C7OA 1BBT3 2Y6LA 1KITA 3UGFA 5L7OB 5J48A 5FB0A 2K1JA 3HQUA 3Q8CA 1JYCA 2GN3A 4R9DA 2IFWA 3FN9A 1RYYA 5FY1A 1QDCA 4MSXA 4NRPA 3K2OA 1UOGA 3K3NA 1OLQA 5GALA 5DMYA 2LRPA 1RUJ2 1X33A 3HWJA 1JYNA 2JG9C 1HV1A 2A3XA 2QNKA 4YG3A 3RPQA 4GAZA 4CP0A 3AMQA 2NN8A 1HW5A 2JE9A 1O91A 1YIFA 4XF0A 1OVPA 4YFWA 4MGTA 4GB33 1RUC1 2FBEA 4H9DA 3RMXA 1NG0A 1ZBA1 2CKLA 1RVF3 3V0AB 2D97A 2GP3A 2QVSB 3IMMA 4RS5B 3O1RA 2LM3A 1GNHA 3H42B 1H6XA 5HBAA 3LQJA 2CONA 1NLQA 2HWB1 4QPGA 3SCGA 3TN91 4Y1UA 2DCKA 5APAA 3O33A 3AXDA 2YU4A 3MLJA 1PVXA 1LEMA 3ZN6A 3POYA 3MF6A 3FWEA 2YGLA 1N3OA 4I30A 4IESA 1POV0 2P5BA 1V9U3 4XBNA 5FP8A 2R1BA 3M7KA 2R073 1WW6A 1J1LA 2D5HA 3KT1A 5A6ZA 3RVHA 2R041 2Z69A 3TEXA 3WINE 2BTVC 2XBO1 3AL6A 4CU8A 2QDRA 2WN2A 3KVBA 4C91A 2MNYA 1VP6A 2ARCA 1AYN3 2WZEA 4S2FA 5E1RA 1HXS3 5FY0A 4XF3A 4QM9A 4Q4V3 5FZ7A 3MHSA 2G9GA 5FAXA 3VBSB 4LMFA 5C9AC 5J3XA 2Q4SA 3NJVA 3JBG3 4YG6A 2J1TA 3LVRE 5FZIA 1XU1A 3KCCA 5JXJA 5FDBA 2XMLA 3QZVA 5KH7A 4RYDA 4YATA 2CL2A 2YV8A 3ASIA 2AH2A 1AR63 3PL0A 5A3UA 3B5LB 1UU4A 3NV4A 4HSJA 2I74A 4AL9A 1I6XA 2VCMA 1PK6C 1RUD3 3U10A 2WNVC 4AP4A 3ZYHA 1HQLA 1A78A 2ZA9A 2D6OX 4NMIA 4Q1RA 5DAVA 3W20A 4OGCA 4XJAA 1U6GB 2ZGKA 4XE9A 1SPPB 2VQTA 1OA2A 1QHDA 5A3LA 4JDMA 2EODA 4HZFA 5JCTA 3SHRA 2C4XA 2VXJA 2Z4FA 3U5PA 2ECWA 1POV1 2F6BA 1UY4A 3OG2A 4OMDA 4DQAA 5I8TA 5KC6A 3KDEC 3W5MA 4BJ0A 4KQ7A 4LHSA 4PBOA 2YBSA 5C8WA 1D4VB 4P9JA 4FFHA 4D69A 4Y22B 3OB8A 2FDKA 3TAYA 1PIV3 2VECA 2KWOA 1H1MA 3PHDA 3M7AA 2JE8A 2WT0A 2EICA 4MXWA 4AI8A 3LOIA 4YVWC 1JI6A 2ES3A 5FK7A 1MM2A 1OURA 4HVRA 3WF2A 1OF4A 1UF2C 2VUCA 3ZMOA 4KBZA 1K5MC 4M00A 2GNTA 3GZTB 2QQOA 4AVAA 3TYJA 3DV8A 3RGBA 4AGGA 3MIDA 1OPMA 2XJPA 3NSTA 2EA7A 4KBBA 5TABA 2E7QA 4DUXA 4D8MA 2X10A 1CZVA 1VBA2 3AKRA 5A7OA 5F9TA 2QICA 2RS31 1DGRN 2R7EB 4NIHA 1QQP2 1YI9A 2CGOA 4FAHA 4YW6A 3FFZA 3R4UA 3H9AA 2UU8A 4XFGA 2WKKA 2TUNA 5L73A 4HN0A 4DS0A 3THTA 3RYPA 1YO8A 2RR11 2MEV2 5K8SA 4X3GA 2BFUS 2RR12 2X29A 3KMHA 1VYXA 1OD5A 4Y4RA 2ZX0A 4LE3A 2P1BA 4QHZA 2BERA 2PLV2 2DX8A 5EHDA 4UYBA 2HWE1 4N43C 5BV6A 1CGPA 3EB5A 2ZKNA 3IPVA 2VOTA 4YBTA 2QCSB 3SISA 1W2UA 2VVFA 2H6CA 1OOPB 1UAIA 3WW1A 2VE1A 2IXJA 1PVC3 2QQLA 1MQTC 4CDQC 2AC1A 2W0XA 3JUUA 4B86C 1UZ0A 5B4NA 4PLOA 4QB2A 4AVTA 1SFPA 5F32A 5FPVA 1J84A 3PLQA 3USUB 4XUQA 4XF4A 4UI9B 5IATA 2E33A 1W04A 1MS0A 1W39A 4FOQA 4AI9A 5FZCA 2QQVA 1L7QA 3U4XA 4HG6B 3G6JB 3J7HA 2Y6GA 1WEOA 3NV2A 3OOXA 2JB4A 4BBQA 1QOTA 3JU9A 1FMD3 3AYEA 1WW7A 2Y6FA 3LD8A 4XAEA 3ME2A 4A3XA 2BQPA 1CONA 5BNOB 2ZXQA 1L7RA 3V0BB 3WW3A 4HT1T 2E61A 4AQ6A 4I7DA 1QEXA 1B35B 1RUI1 1UU6A 1RHI2 3NV1A 3PVNA 4FPKA 3WY6A 4LJNA 2YT5A 2QDNA 4KWKA 1FX5A 2PHXA 4JZRA 4XW3A 5L9VA 2XWJB 4ZQLA 1AR83 2XHKA 4R8PK 3NNMA 4XTPA 4AI0A 2MNGA 1HLCA 4AHZA 1TVGA 2VBDA 2M13A 2QIZA 1RUE3 1WD3A 2RHPA 1AZDA 3OYWA 3SH4A 3WG2A 4V1PA 5GZGA 2A3WA 4BMEA 2E51A 4ITCA 1CX4A 1YFUA 2L9LA 3DPRB 4GKXA 1AR91 1DYKA 3WDWA 4AI1A 4CDUC 4MGKE 1PGW1 4NVPA 1DVPA 1O8SA 4L8QA 5FPUA 2ECVA 4PTBA 4GWJA 3MPPG 1WA6X 1O6UA 5A3WA 4OUEA 4AFMA 1VB4A 4Q4X3 2P3KA 3MPBA 4LLBA 3P3PA 1GP6A 3LA7A 5FKCA 2ZGLA 3H3ZA 2F42A 4AVSA 2FDHA 2W1WA 2YXSA 3ES4A 1NY72 4RGGA 1CAWB 2DTYA 1N3QA 1CZTA 3MW2A 4GA9A 4LUKA 1AXZA 3H3LA 3TB0A 4K1YA 4M3CA 1NE6A 2BGOA 5EJ1B 3OEAA 3O12A 3Q8AA 1NKGA 1SBDA 3CIHA 3QOPA 5FYVA 1RUG2 4D6SA 4DRRA 1XB9A 4YNIA 1WFKA 4GH4B 1QDOA 3VD5A 1SFNA 2DBNA 1GWMA 2E6VA 2E7AA 4OULA 4DUWA 2BZDA 2JG9A 3AVSA 2B4KA 3CDZB 4WBBA 5A6YA 1JZ2A 2K17A 1WESA 3IN9A 4S3OB 5FYZA 5A3OA 2YDEA 3O1SA 4AYCB 5SV8A 5C3PA 1ASJ3 2HBTA 4GIQA 1HV0A 3O5SA 2CWMA 5DAXA 5FFOC 1GZ9A 3SOXA 2VH9A 2WSUA 2VC9A 1JTZX 1WW4A 3SEEA 1OD3A 4V3LC 1GKBA 2NMOA 4R9BA 1GWLA 2ET1A 2KWNA 3JZVA 1QNYA 1NZIA 1XPWA 3H7JA 5DDJ3 4DY3A 1R082 3KF5A 5KXCA 3FM8C 1MEC3 4FOYA 3BCWA 4WZ2A 2Q1FA 3M4FA 3IM0A 1XE0A 4YSFA 5F1RA 1J58A 3WDUA 1DZRA 2ZJCA 3U07A 5J3UA 3FHAA 2IXKA 3U11A 4CEYB 2WO3A 1JYWA 1PO13 1Y9QA 1YQ6A 2MUMA 1GSLA 5KC5A 4FVVA 5JOXA 2DCZA 3GJBA 3VBFA 2E53A 2J1RA 1NQJA 2MKEA 2XJRA 4OI4A 2FDGA 3B69A 2JG8B 4EWEA 3E6CC 2P3JA 4UT5A 5FZ1A 1Y3TA 3RFRA 3ZM8A 4AEDA 3KCXA 1RC6A 1F8VA 1LOFC 1E4UA 3T09A 4QF2A 4FFIA 1IPKA 1JODA 3ZN5A 2D3PA 2MNZA 1JHJA 5A7WB 1LGBA 3S5AA 2RG4A 3AKSA 3ZX7A 2YYRA 1V00A 2IC1A 3V64A 3ZN4A 1X4UA 1GNYA 2A7AA 2IXLA 2WNVA 4CXYA 1VBC2 4Z92B 5BY5A 4OHVA 3SKJE 2FCUA 4IEQA 3VHPA 3E5QA 3LDKA 1HB4A 3TEWA 4XHXA 1JZ5A 2WFF2 5I3LA 2WT2A 2BNNA 4LHNA 3G7DA 1AR73 1D2QA 1ND3C 1GMMA 3N7JA 4URTA 4WM8C 5FZOB 4AQTA 4B7EA 1JZ6A 1DP0A 3LIGA 2UYAA 3BTAA 1FOD2 1A34A 1SLTA 3DWDA 1TE1B 3EB7A 3ROUA 4WM7C 5FYIA 2ENRA 1ZA4A 3ZYIB 4F3JA 5IVBA 2B7YA 2KXLA 1QMJA 4NIAA 2YU1A 3BI3A 3ZYJB 4QXBA 4X8PA 3ZPOA 3RI8A 3WF3A 3N9LA 1V0AA 2NMNA 2PAMA 4K3UA 3T2OA 4LIVA 3ZPVE 5L36A 1QJY3 1XBFA 2RS11 4IGPA 4RQPA 5EP9A 5FV3A 4ZPIA 3VBOA 3IHPA 1LHNA 5DAPA 2P37A 4AXOA 4RHV3 2DTWA 5FMOL 5CFCA 3VBUB 5GJ6A 4YVSC 4W50A 2XONA 3WDTA 1YUDA 2XJQA 2EIEA 3RMYA 3ZFGC 2YHNA 5G04B 2OPWA 3I3DA 3HIFA 4PT6A 1YHFA 2W91A 5FZLA 1OFSA 2CWSA 2VD7A 2ZHLA 4PF5A 4EV0A 1YCIA 1TNRA 2FHRA 5FY5A 5D2AA 5F8PA 2QFEA 1VMFA 3BUCA 2M85A 1SEFA 1LESA 4K1ZA 4R2YA 2EIBA 4AFAA 1TMF1 4OQ8A 1FPN1 3J8F2 4G4FA 2WYSA 3K48A 3GL6A 1STMA 5FQ0B 1BJQA 2LTNA 1ACCA 2B39A 3FX3A 4HL0A 2HLEA 5C6CA 3BODA 5KXEA 3L11A 1NA1C 4KI5M 3OPTA 2AEZA 4C1XA 1K3IA 2WO7A 1S0IA 4ZU4A 1OSGA 3T9KA 1HRV3 1YIPA 1KFUL 2IXIA 4CDQA 1TNFA 3DCQA 4A6SA 1YQ8A 2IUWA 1Z7S3 3BVCA 3K4ZA 3MBWA 2R30A 2ZZJA 2LRIC 3P1IA 4MZUA 1W8OA 1GNZA 1CX1A 2I45A 1H1IA 3L1ZB 1CAVA 3LAGA 5TRBA 1VPHA 1C1LA 1S55A 1HRI2 4TLFA 1QJFA 1ZRRA 3LDRA 4JGZB 5FZEA 3SLIA 2VPGA 3MV11 2VZQA 3T0BA 2OQ7A 2OPKA 1DGLA 2N7GA 4IV1C 1ZM1A 4QQHA 4XQ4A 5FZ0A 1BQPA 1A3KA 1N1TA 4Z2AA 1QJEA 1ZYBA 3EBRA 3O1PA 1ZRCA 5FY4A 2MD7B 1SBFA 5A80A 3Q8FA 4QGMA 2CHHA 2LGKA 2VP7A 1N47A 4IW3A 1DYOA 1XNBA 4UFIA 1W9FA 1OLRA 1PGL1 3CO2A 5B78A 4QX7A 3ZXDA 1C8M2 1IG3A 3CHXA 3ELNA 2KD7A 2RJLA 4F52B 1DG6A 1WUVA 4QKDA 1QIQA 4UW6A 4NWWA 2GDFA 1RJ8A 2CAUA 4AEKA 4BU2A 4YPJA 4IEZA 5JI7A 1T1HA 4CDUA 3CU7A 4YGCA 2AREA 1XJAA 1QJX1 1Y9GA 2XJVA 3ZTGA 3Q8BA 1QJX2 5H9SA 2GC2A 2YROA 2DBIA 2QUOA 2Y6KA 2ZGMA 4IDZA 2QZ3A 3SXWA 5DN2A 2DVDA 2OUHA 1SLAA 3DL3A 3NWKA 1RMU2 4EN8B 2G19A 2W1QA 3D3AA 3VBHC 5GLTA 2XVGA 1UY3A 3EMRA 4LTAA 5IK5A 4NHXA 3POFA 2PNXA 2ETEA 4IGOA 4AYUA 1UL9A 3RDIA 1RUH3 1HJFA 1REEA 2YPJA 5GZDA 3TEYA 3FBYA 3T0AA 4XJ8A 2RV9A 3VV1A 3AVRA 1COV3 1JYTA 5LWBA 5CIRA 5T5JA 1D4M3 4QKFA 4JAAA 2RR4A 3C7EA 1MBMA 5TBNA 4K8RB 5FZGA 5CBLA 1RL3A 4BLIA 1UZYA 2VOWA 2VVEA 4Z2WA 3MHZA 4NJ4A 4D6RA 5FR3A 2WN3A 4A7YA 3I49A 5L7OC 3AFGA 3L9JT 4CUGA 2KR4A 2ZHMA 4JDNA 4M4PA 4WZ0A 4AFCA 5EYAF 1TQ5A 4W4ZA 1JW6A 5FP7A 3F95A 5ANNA 1CHCA 1VIWB 2HWF3 2JDMA 1X4IA 5FCCA 3VDBA 2UWAA 2A70A 2ZGUA 3R05A 2O8OA 3U78A 3WX5A 4LADB 1VBD2 2J1AA 4QF3A 3BN6A 1W8TA 4Q29A 2UZGA 3RS6A 2VJEB 1SFYA 3IZOA 2R063 4RFRB 2VZTA 3ZSLA 2F6JA 4P14A 2YC2A 5GZEA 3AKQA 4Q4W2 4XBQA 1RUOA 4GD4A 3FMGA 2H0VA 1MS4A 2BU9A 3EJKA 5FJHA 5FUIA 4H7LA 4CP2A 4CZSA 5CG8A 2KREA 2L0BA 3L1XA 3BB6A 3GZUC 1L7LA 4RS5C 4YM3A 3RJRA 1GQPA 2NQYA 5FMOS 4CCKA 2VQAA 5LKZA 3SMHA 3BTXA 4CCGX 1OQ1A 4TLGA 3S5QA 5CKQA 1A8DA 3B3QE 3AK0A 3O36A 3HN1A 1MM3A 3A23A 4A41A 4ZUXU 5KBFA 5FZKA 1RUF1 2ZGTA 1RUF2 2RDNA 4RR3A 4Y20A 4YZ5A 4ES9A 5LW9A 1LOFA 2BJSA 2CGNA 2BWAA 4UW5A 2Z42A 4E9KA 1W28A 1K2FA 3MIGA 5DABA 1H4GA 1VALA 5KHKA 2UYBA 1IQDC 3VHNA 4L92A 5AC93 1O5LA 2L43A 1TME3 3I3QA 5IVYA 3TWIA 3D82A 3RJ2X 2VNVA 4XXAA 3WW2A 1CAUB 2KYUA 2VZUA 3AMHA 1BEV3 3JXSA 4EWDA 1Q8VA 1QXPA 2LAUA 1CPNA 4C1WA 4YZ2A 2AYHA 2Q8OA 4PDWB 3OEBA 3AKPA 1WEMA 1ND3B 2C1FA 1QJZA 1U5XA 2E6RA 4XDOA 1EY2A 4INDA 4WM8A 3ZOIA 3FUQA 2R0HA 2JRJA 1JM7B 2DVBA 2G6QA 5LCWB 4TSVA 5KXBA 1IS5A 1HJGA 2Q8CA 5ERLA 2YREA 4AAXA 2RMU3 1QJU3 5CFDC 2VNFA 5JOWA 2ARAA 3AP9A 2ZGRA 3ZSJA 3SCHA 2XP0A 2VZRA 3N7LA 4Q4Y1 4R4ZA 4COZA 4QKNA 3T30A 1OT5A 2MHFA 4A3ZA 5LA1A 1HQWA 1EV12 3KZ4C 4KGGA 1UMIA 3L2HA 3WP3A 2PHUA 2CAVA 1N87A 1NCRA 3I59B 2O14A 3BTZA 2RS53 1ZBE3 2JDKA 2OVUA 2WQZC 3JQXA 1FV2A 4SLIA 4YW5A 4ATEA 5A1LA 1V87A 1U5IA 2JUNA 5C8CA 1P8JA 3WQBA 4B4RA 3OPWA 1KRIA 2C6SA 1HB2A 2VL4A 3O0WA 4ONUA 3ZFGA 4A7ZA 1BMV1 2V4VA 3LF7A 3TRSB 3GALA 5C4WB 5LRRA 2P57A 4MUVA 1ZX5A 3LZZA 1VRH2 4L11A 1T2XA 2Z2SB 4ASLA 5CYYA 4LBQA 5CEHA 3U14A 5G05B 4AVCA 2HWD1 3UT0A 2XEUA 1AF9A 4K8FA 4ARXA 1H8TB 1ND2B 1IZ3A 5LASA 4C8DA 5JDBA 2VOXA 1FAYA 3PUQA 2V73A 1REDA 4HETA 1Y9MA 2I2SA 3AYCA 4K21A 1UIKA 5CNAA 1NA1B 5DG1A 3MEPA 5FY8A 1VAKA 4HOOA 4RFT0 4E2SA 4B8EA 2KKXA 5ACA3 1HKDA 4W6YA 2YU2A 4AUQB 2QJ0A 1H30A 2RDSA 3GBGA 1E5RA 3KGZA 4MGIE 1V6LA 5JZGB 1F4HA 4QAWA 4COWA 1AYM2 1UXXX 1J3RA 3IIAA 4Y5Z0 4I2OA 4P00B 5GLWA 3VBRC 4ZU7A 4AWDA 3QLQA 3B01A 4UFMA 5ANQA 3FFQA 1ULFA 1KS5A 4BOWA 4BZ4A 1YRZA 4OI2A 3M3QA 5B4XA 2D5FA 3HNBM 1OOPC 2EALA 2WZ8A 4WVZA 2EXUA 1DCSA 4QPYA 3VKNA 5A3MA 3HQXA 3SOWA 1HB1A 1ZZ6A 4YZ1A 1JM7A 1H9WA 2QQWA 4XETA 2QZ2A 4Y1VA 5KR7A 1BBT2 1UKRA 3ACHA 3KHBA 3POWA 2XPJA 5I8YA 4WVMB 1NE4A 4UW3A 1WEUA 2RVAA 2D43A 1R1A1 1XXNA 5CVRA 3ZVXA 4XPVA 2WLQA 4O65A 2I50A 3DGTA 2VW1A 2WNEA 3B94A 3OCPA 4E4ZA 1ZZ9A 2ECIA 5H1TA 2W3JA 1EYBA 1VBB3 1WMFA 2RM23 3HVDA 3J7MA 4N4FA 5BNOC 1Q8PA 5ABJB 4JGYB 4GQ7A 3UV9A 1XE7A 4CPBA 4XUPA 1KDMA 2BPA2 2W08A 1UXZA 1B35C 1QGLA 2VNGA 1VBE1 1G9FA 2WNUA 3E5XA 4M0HA 5FZDA 2C2LA 4GB32 3A7QA 2X5IA 3BTYA 2E9QA 1RVF1 4H55A 4RA0A 1OH3A 1RVF2 1PO21 2P6CA 4HK9A 3A0NA 3UJQA 1S0CA 1QKQA 1W90A 2AN6A 1BK0A 2FUUA 1YQ5A 3AYDA 3Q1DA 2VR4A 2QQIA 4QGNA 2JX9A 1DQ4A 3VZJA 5GLZA 3POJA 2DSMA 3VZNA 2YB7A 3DPRC 4ET7A 5SVYA 3JD73 1CAXB 5JSPA 2OXQC 4CCNA 2BFUL 1LR5A 3D8CA 4IE4A 1EAH1 1GUIA 1V9U2 4LE4A 4YAXA 2ZPXA 2R072 4M3CE 1UWWA 2Y64A 5DZGA 4I7BA 4MADA 3HAGA 1JH5A 2C26A 2FCVA 3RYKA 4GNDA 3E6BA 4I02A 4K20A 4AQSA 1L3JA 3NKTA 4NN0A 5D8AB 3EYPA 4BIOA 2VTFA 1AYN2 3LRQA 1HXS2 2WWSA 2ZMKA 1V6IA 2XHNA 5C3SA 5L7OA 4Q4V2 4XCAA 4FIPA 3WVJA 4PI2A 4YW3A 3OUHA 3PMEA 2XDVA 2FD8A 2XLAA 3JBG2 4HONA 5L9RA 1RUJ1 1LOAA 1QNWA 5JPMB 1FT9A 2GH2A 2WRAA 1YJKA 3HEIA 5F5CA 1UOBA 4GH4C 2YURA 1AR62 2OZ6A 1OA4A 4AI3A 1MVQA 4F8AA 1LHUA 2B46X 4LLFA 4CEWB 2JJ6A 4GNGA 1G6NA 2QQNA 4P5OB 5HPOA 1RUD2 1RXGA 4M3CF 1NXD1 1PNGA 2WS93 4S3OC 2IVIB 2RJKA 1XYNA 1Y4WA 4A2UA 1W3XA 2OT7A 1UPIA 4FTEA 1PX4A 1UW8A 3T4HB 2IVJA 4TKPB 2XUEA 3T7LA 2DU0A 4XI1A 3MZHA 2ECGA 3V0AA 4KGQA 4RS5A 1UZWA 4QDSA 5KHHA 2ZX4A 5J7MA 5FKBA 1A6CA 3SCFA 4BWOA 1GU3A 2F4LA 2DVFA 4GWIA 1CVNA 3VDDB 1F5FA 2F17A 5FWEA 3ZXGA 2GN7A 2KKYA 1IS3A 4NO4A 5F5AA 1DLLA 2ZGQA 5BPXA 5C11A 1HIXA 1X9TA 2WINB 3PJYA 2G45A 5A3TA 1YQ2A 4Q0UA 5A1FA 5KH3A 4KWUA 1DHKB 4P5YA 3ZIXA 4CEYC 2BAYA 3FJUB 1IPJA 4LO5B 3DQVR 4AHXA 1NUKA 4B1MA 4D6QA 4BISA 1WENA 1UX6A 1W0PA 4HMZA 4LORA 2KFTA 2Y1NA 3VBSA 3ZN6B 5FO8B 2NM1A 4E8DA 2WLPA 2JG8C 2MA6A 3ITQA 2ZABA 4BCUA 4ES8A 4R4XA 5F3EA 2BYVE 3O35A 1C28A 3VZMA 1JYIA 2HBUA 2B8MA 5G05L 2W87A 5KWRA 1X8EA 2WZR3 5CFDB 3H50A 2JIJA 1R64A 4S2GA 4DNYA 2FMYA 4UFJA 2R16A 2JMJA 5LBBA 4AZZA 4E4SA 1ZZ7A 3OGVA 3HTKC 2VPDA 5F6KA 2GZWA 3OTFA 1JOCA 2VG9A 2ZKLA 4LLOA 1PVC2 4M01A 3RG0A 5K7PA 2P17A 4GMP0 2QQJA 4L99A 4QU2A 4BPZA 4XIOA 3UKTA 2VBBA 4L9BA 5GM0A 4R9AA 4NWVA 4Y22A 3HBKA 3OBAA 1OC1A 3LDBA 4BK4A 4LXLA 1APNA 2KM2A 4IV3A 1RUC3 1VRBA 5IK8A 5AFBA 1ZBA3 1VAMA 1ULDA 1PM7A 1FMD2 1ENQA 2QTWB 1S4CA 3I2OA 4JKLA 2YW8A 4P9IA 4HVOA 3ETQA 1KFXL 3PVEA 4TWTA 2HWB3 1CQ9A 1GZTA 4FPLA 3TN93 4XIKA 2FDJA 3B9CA 1BVP1 4NIIA 5LKXA 1VBA1 3FLPA 3VBUC 5LA9A 1LOEA 1QQP1 2YBPA 5BNNA 5B79A 1T6BX 1NX9A 5FRAA 5C33A 3SKVA 2JKBA 3B7MA 2MEV1 4FO9A 4A7KA 2OA2A 2R043 4UWDA 1RUE2 4Y5TA 1LDKC 1JBCA 1EPZA 1R1ZA 2K2SA 2XBO3 3Q9OA 5FOJB 1MZ5A 5FYUA 5LEKA 3GGLA 2PLV1 2JEMA 4AE2A 1CN1A 5F2WA 5FBZA 3VBRB 4AVXA 3RNSA 5LATA 4IE7A 1VFYA 2GMEA 3I2FA 4NHMA 5FYMA 3ZFFB 4LBQD 4GMP1 1O3RA 3A0KA 3KV6A 2VY0A 3N9PA 1RMDA 2BGPA 2L80A 2RSDA 3MGUA 4L2NA 1B09A 1OOPA 3MIEA 4XDPA 2VM9A 4UOJA 4XTMA 3APBA 5FWJA 4Z1VA 5LRSA 4DO0A 1W03A 1W6QB 3GJAA 4CVUA 3CJIA 1RJ7A 1WMXA 1UQXA 3FC0A 5FY9A 2BGCA 4ZY9A 5IYYA 3MO4A 1CPMA 4Q0SA 5H1VA 2PAEA 1W2OA 1LB2A 4IC2A 4H3WA 3AJZA 5FREA 3VD4A 1S0GA 3GHMA 1O4TA 4CXXA 1G8WA 2WWJA 2OQ6A 3IPVB 4JGZC 2MD8C 3BKZA 3ZXAC 5JR7B 1DU3D 4YARA 1POV3 4PLNA 4Y4YA 3RZMA 4LNVA 1ENSA 3V0BA 1RHI1 1FP0A 5AIUA 5DUUA 1LOGA 3HCTA 3VKOA 3ZR5A 4LK7A 1ASJ2 3VZLA 2ZGOA 2EVXA 2PTMA 2P34A 1HX6A 3CBNA 3OSDA 3T08A 3A21A 2XH6A 3RZJA 3NAPA 4O61A 2VZ3A 3DYOA 1MS3A 5DDJ1 4QDQA 5DDJ2 3THCA 1VB2A 4NE9A 4QPIB 3ZXLA 2D8UA 3O34A 4YC9A 2D98A 1O3QA 3DPRA 1MEC2 5FBJA 5J37A 3CZUA 4ZS3A 3LVQE 4J1XA 2H6BA 2E31A 3GV4A 1PO11 4CPBD 2UWCA 3GBFA 2RS33 1PO12 3P3NA 4N53A 4NOTA 5JR2A 4RL7A 1LHWA 1NY71 2A71A 2QE3A 4XEZA 4AG4A 4CCMA 1J59A 1BZWA 2VMCA 2WFPA 2CGPA 1XSQA 4MG2A 4I3GA 4Q8LA 4AW7A 3C7HA 4IXLA 1IQAA 1W9TA 4LO8A 4KG0A 4CSWA 4X8NA 5A1AA 3AM2A 1LGNA 1RUG1 3CMGA 3WEZA 2EAAA 4FXKB 4KU8A 4QB6A 2HWE3 3S7EA 5FPBA 2ADDA 4YGDA 5HCAA 2JMDA 4A0CD 3WXPA 2BP6A 4N7UA 4ZONA 4XXPA 4DPNA 5GKAC 1ZRIA 3DYMA 4GWMA 2ILMA 5CADA 3VDCA 2CV6A 2C5DA 2BV4A 1V6NA 3CL1A 4I01A 1JOBA 1GYKA 4PIXA 2ARXA 2FQPA 3NQHA 4LK6A 3IDEA 3UKVA 1LAJA 1PGSA 3EXUA 2YPDA 4Z8BA 2OXBA 5BNPB 5FIXA 1AR71 1YFYA 5LB6A 1JUIA 5FP4A 3OBTA 5FPAA 1AR72 1UMZA 4FPYA 1R081 4PPEA 1N3PA 1X8MA 1MVEA 2VXRA 3ZXKA 1O3SA 3FANA 1AX0A 3D4KA 3J4UH 5DZEA 5JVVA 1SG3A 3VDAA 1PMJX 3LSEA 3VD7A 4LEJA 1MS9A 1RUI3 3H8OA 3LFMA 1HYIA 1LGCA 1K45A 3J7NA 3E1F1 1HQNA 1C3HA 4CEYA 2A1XA 4LKDA 5B75A 4IE6A 2O8QA 3NKGA 3HNYM 1QJY2 4YBMA 4O7XA 3QBQA 5GZFA 2O0OA 2ORZA 4DB5A 5C5TA 2XVKA 4BA6A 4D94A 1W0NA 2CYFA 4HBNA 4KMQA 4EROA 4RHV2 4EZHA 5C9AA 4YW4A 1S2KA 2JG8A 1RGSA 5T52A 1AR93 2Y26A 3O37A 2E63A 1SCSA 3DKQA 3DXTA 2A5ZA 3NJYA 3BOWA 2VUJA 3CF6E 4XBLA 2YFZA 4FQ4A 3UETA 4JHTA 3KVAA 1PK6A 3K51A 4JCKA 3ACGA 1VBC1 4GJZA 1WWYA 3GBWA 3VBFB 1UX7A 2IFRA 4GB0A 3ZPV1 3B00A 4FP3A 4LUMA 1WCQA 1CIYA 1H8VA 1BVVA 1E5SA 4LT5A 1WEEA 2WWUA 5LKTA 2XL9A 1HDKA 1GZWB 2CTVA 2WFF1 3E6DA 4W65A 4E8CA 3N9OA 3PDQA 4IQPA 4QX0A 4PDWC 3VK6A 3UL2A 4AEDB 4F7ZA 3GZEA 2SBAA 2HYKA 5FZOA 1FOD1 1HRV2 3H1YA 1SLCA 3LGRA 5GLUA 4UI9L 3CZJA 3SH5A 1Z7S2 5DAWA 3ZDVA 2BVVA 2Z79A 1JOPA 3T0DA 1CWPA 3LIHA 4FFFA 3K77A 3ZYBA 1PZ7A 2Y43A 4XFIA 4JKMA 3GM8A 2MT5A 3H8RA 1FNYA 4FPFA 4P9XA 2GAUA 1KDKA 2GSYA 2R49A 3GYDA 4YVWA 1DGWX 3DKWA 5KXDA 3M2MA 3Q8EA 4IEXA 3I2GA 2PAKA 1GQHA 1ZZ8A 1K5MA 2Y38A 3WCSA 2YVRA 1X7NA 2ZETC 5K0UB 4TYSA 2CT2A 1H2LA 2ZX1A 2W5FA 2G43A 1X36A 2BNMA 3PURA 4IETA 2R0FA 3PTRB 3E97A 4N9HA 2KGIA 3M62A 3OGJA 5K4LA 5FP3A 1Z0HA 2HEVF 1DYPA 2AEYA 2KR2A 3WDVA 3IDCB 2E26A 3KLSA 1GZCA 4ZXEA 2B42B 1DGWA 1PHMA 1WD4A 3CJXA 4UF0A 5C4WC 4L58A 3PJQA 5JSRA 2Z5WA
chains in the Genus database with same CATH topology
4YM0A 4LA3A 1FI2A 4UBGA 2D6KA 1AJKA 4RQPB 5FLIA 3J8F1 3VBOB 1WLWA 3AFKA 1C57A 1FXZA 4N43A 1H8TC 1ND2C 1WLTA 3AP7A 4FBFA 5CFCB 3V56A 4P5HA 5BUVA 4P9LA 5FQ0A 4CDXB 4XFCA 1N1VA 3LSDA 3ZSMA 1MQTA 4XOGA 5D1KB 2XWBB 2XGXA 3HT1A 3VHOA 5JMCA 4Q26A 4OUSA 1NCQB 2WC2A 1SACA 3RI9A 5JZGC 1BYHA 5KHJA 4UW4A 1C5IA 3SH3A 1RUH2 1HRI1 3O0VA 1WGMA 3N3HA 5CG9A 1BK1A 3C6WA 2A6WA 2VNRA 4JGZA 2YY1A 1COV2 1LJ7A 4C90A 1WE9A 1D4M2 4DINB 2YQMA 1ZZBA 5E88A 3HR9A 5I0TA 2TEPA 4BYYA 4LO4B 1PNFA 1C8M1 1DQ0A 2RI7A 3LWCA 4YADA 3GHNA 4AVBA 1XU2A 3E5UA 4A4BA 3W58A 2HWF2 4HKWA 1S2BA 3FBMA 1IHMA 3SNMA 3FJSA 5ABJC 4JGYC 1WEVA 2RS13 4FOWA 3AP6A 2CSZA 2YUCA 2R062 4R52A 2XJUA 2K4DA 5T5OA 1KS4A 1DZTA 3URFA 4K40A 3M3EA 4BE3A 1TEIA 2ZMNA 5EXOA 2VOKA 1RMU1 1W6OA 4EN0A 2VVDA 5T5PA 3D6EA 1QF3A 1S0FA 2ZX2A 3DUIA 3WOGA 5JOZA 1D0GA 2ZX3A 2NLRA 2M6MA 4LO7A 3WNXA 3N9MA 3ZFEB 1QOSA 4R8HA 4U36A 1TMF3 1FPN3 3H3UA 3MICA 4BIFA 1IOAA 1O7FA 4RGAA 2VPBA 4W6WA 1RIRA 3ZO0B 3KNVA 1IKPA 3AJYA 5AC92 1YWKA 1TME2 3M1HA 5D8AC 2VGDA 4CDWB 4UBHA 3BIWE 1BEV2 2VJFA 3EQEA 3J9SA 1AL21 1V70A 1AL22 2O1QA 1T6GC 3PVOA 3THPA 1VBD1 3WUCA 1U12A 2YC0A 4CEWC 4Q4W1 3M8LA 1ENRA 4DY5A 3OBRA 1QJU1 3R4DB 2PHWA 1QJU2 3GNEA 4XMAA 4PIZA 5GLVA 1WCSA 4N90A 1XYPA 4META 5E89A 2RS52 1ZBE2 2E6SA 3VDDC 1NXMA 2PYTA 1H4HA 1R091 1Q8SA 1R092 1F62A 4A4CA 2FZ2A 4XFHA 3ILNA 3BPZA 3POSA 3PHMA 4KH9A 4F83A 2PN5A 5FLHA 1ZBDB 4NPRA 4NHKA 3MLKA 3HD8B 3NVCA 4S2DA 2DVGA 3S6PA 3HCUA 4QPGC 2VMHA 4QGLA 4XFAA 2MPFA 2A73B 4ISQA 3ENRA 1O4YA 4Y20B 1H1AA 4H14A 1W6NA 1ND3A 2K0GA 4RR3B 4XQDA 1REFA 2IDAA 5ACA2 1GQGA 3SOUA 4KWLA 4MYEA 1W6MA 3VLBB 4WM7A 1W6PB 1C4RA 1C8NA 2JXAA 3O7AA 1Z2QA 1HYJA 2GC3A 4WVVA 1EV11 3ZYRA 3USSA 1OPOA 4HKLA 5A33A 4IEVA 1YNAA 3NG2A 5B2GB 5EV7A 1IKQA 5HI0A 4DXZA 1ZRFA 2PA7A 1LU1A 5HXVA 1ONAA 1UPSA 4C9ZA 4Q1PA 2Q30A 4YVSA 4OZXA 3VKMA 4HSLA 2B45X 4LULA 1F2NA 1VRH1 3OD0A 2H0BA 5C4WA 1WLDA 1OQDA 4FAGA 4YM2A 2YGMA 3KCYA 2XVLA 3CLPA 2QKDA 1NCRB 2RM22 4COVA 3I7DA 4FQZA 2G9FA 5IK4A 5C8CB 2CY6A 1ND2A 2WA4A 2LGVA 3DF0A 3N35A 2LV9A 5I0UA 5K9YA 4LBOA 1XE8A 1NA1A 4IEPA 3N7KA 2ECJA 5J98B 1LKNA 4ATFA 3OY8A 3WP4A 1AYM1 1KD7A 2VU9A 3OJBA 4LBQB 5A32B 3RSJA 4O9EA 2VNOA 5LEJA 3JD72 4B4QA 1KXGA 3QACA 3M70A 3BOPA 3ZFFC 3TBDA 3TNPB 5J36A 2GU9A 5HCFA 4HK8A 4IV1A 5H9RA 2ZMLA 3VHRA 4FSJA 1BBT1 2HWC3 2H0DB 4I0WB 3T2TA 5JSOA 1URXA 4QQPA 4YW2A 3EO6A 4MVTA 1AX2A 2C9AA 2ECIA 4I7DA 1QH7A 2CNAA 4B7KA 4EROA 3WHUA 1GANA 3WD5A 2LGGA 2PHRA 5G05B 1WEWA 3N4MA 4R9CA 3WLUA 4Q4Y3 3VL9A 4GXLA 2HEWF 3OGGA 5ABJA 1PZ8A 4JGYA 3IMNA 5AITA 2YSJA 2IXCA 3PTYA 3ZPYA 4CRQA 2ERFA 1RB8G 1JM7B 2KA3A 2WS92 4LBJA 3ZXFA 4GB31 5GZCA 4HVQA 4KL1A 2NAAA 1BKZA 2GNBA 3LQIA 4L7XA 4O64A 1GBGA 3ZYQA 4XHBA 3JQWA 1AXKA 4HLTA 3VBHA 1UN1A 1QY4A 5TDWA 4HPKB 2XJSA 1EPWA 4D7YA 4W4UA 4QPIC 1V9U1 2HWD3 3C5KA 1CAXA 2R071 2DF7A 4UP0A 2WNUB 1XYOA 1U0AA 3NL1A 4FPOB 1AYN1 1HXS1 1UIJA 4Q0VA 4GNFA 2ATFA 2I07B 4Q4V1 2FMDA 1D2SA 2A6ZA 3RRDA 3JBG1 1RUNA 2M3HA 5IK7A 1DBNA 1RITA 3AZYA 3C3VA 3JCIA 2D40A 3IWZA 5EJ3A 1AR61 4MGZE 4JQRA 1SBEA 1V6KA 1Q5OA 4HN1A 1JOJA 1RUD1 4CEWA 2IZWA 2WZR2 2XLFA 4DZGA 4MGYE 1QXJA 3AMMA 4XJWA 3RPGB 4Y1YA 4Z82A 2KGGA 5H9PA 2DURA 1N1YA 5T50A 4MLOA 3MI8A 2JD4A 2ET7A 2EXIA 1R1A3 3MLLA 3L2YA 2BW8A 2W68A 2ZCWA 4B3NA 5BNPC 2VPEA 3MF9A 1NLRA 4AK3A 3S0MA 2E7TA 2B5HA 3VDDA 5CA6A 4BQ1A 3AXEA 1YYNA 4FP2A 1PIV1 3H1WA 2D6MA 1PIV2 1MZEA 4FXGB 4O9GA 1QU0A 1VBE3 4C0BA 2CKLB 3WG3A 3ZNIA 4XILA 1RUC2 4AEJA 4LO6B 2PHDA 3B9IA 1ZBA2 3T1MA 1PO23 1PMIA 3V65A 3WV6A 2JENA 4QPGB 2LXPC 2QJVA 2WJSA 2HWB2 2DCYA 1I3HA 5DUWA 1KJRA 3TN92 4BHPA 3WW4A 4MSVA 1LODA 3KSCA 5H9QA 1IGOA 1PZ9A 2Y0OA 2ZGSA 1EAH3 2VMGA 1M06G 3M3IA 3MW3A 4XJUA 4YLZA 1ULGA 4QM8A 2R042 4L97A 1G86A 2GMPA 2QQPA 1WBLA 2XBO2 4X6QB 3VBFC 1XRUA 5CFDA 1CJDA 4IC3A 4QQLA 2ZGNA 1AXYA 2AZ5A 5JWPA 5KHIA 4Z07A 4EJRA 1PVC1 1RUJ3 4AEDC 2OZJA 2UY8A 3WDXA 4SBVA 1Y7BA 3AMPA 4JC1A 1CIWA 3HBZA 2EGPA 2PELA 4EN6B 2YZ4A 3ATGA 2JECA 4YABA 3WUDA 4Y26A 3R6SA 2C2VS 4FCAA 4LBKA 1FMD1 4UXAA 5DUVA 1S0BA 3OF1A 3I4IA 3ILRA 4ZKTB 5FB1A 1VD4A 3H0OA 3N36A 4XJZA 5K0UC 1NOVA 1AX1A 3U5NA 3NW4A 2MIQA 4E2QA 4BM8A 5AVAA 3RYRA 4XMIA 1S0DA 1AR81 1J1TA 1XNDA 2V5YA 1AR82 3ES1A 1BCXA 5DINA 2NYYA 1MZ6A 4MXWB 4IV3B 1RUE1 4RD7A 3MFAA 5DUXA 3I8TA 5AVPA 1DDLA 4OI1A 5DG2A 3OPZA 2ZS6B 3KQRA 4G3YC 1J3QA 3KT7A 1FATA 4RQPC 3VBOC 2DUPA 2NP0A 2XB6C 4MXVA 3VBRA 1F9KA 3ZSKA 4K9SA 4PJYA 3HMYA 3PVBB 2D93A 3ZFFA 5CFCC 4Q4X1 1F31A 4TZDA 5JOYA 4Q4X2 2A6XA 5BNNB 4CDXC 4FTSA 1I5ZA 2YHJA 2VPVA 3VKFC 3KT4A 4ZU5A 3WQ0A 2RS32 4V3KC 3RQ0A 2OYZA 1UU5A 1UCXA 5JPNB 1W6QA 5LKUA 3USUA 1NCQC 3AX4A 2B9UA 3AZZA 3ZDSA 3HT2A 2K16A 4IEOA 1DQ6A 4AHWA 5BYNA 1LOCA 2TBVA 2Q1MA 1ULEA 4D7SA 2HWE2 3D0SA 1FBVA 2BBVA 4X6RB 2AGSA 5BNOA 2BEOA 2KWKA 2DFCA 5FERA 2DUQA 4UP5A 1AVBA 4ZXKA 1GR3A 3ZIWA 2LUWA 1X50A 3CEWA 2A3YA 3CJIB 1ASJ1 1CJPA 1B35A 2A6YA 2LXHC 4B29A 3ASLA 3AMNA 3FHIB 4MX3A 4NN2A 2DV9A 4XFFA 4LBNA 3SHBA 1Q8OA 5T55A 2DYCA 2C0ZA 1I9RA 4FPCA 4LKAA 5HCBA 3U5MA 1BXHA 2F6NA 1Z6UA 2FSAA 1MEC1 5DKAA 1WA4A 2HKXA 4QPIA 2WA3A 2ZGPA 5FO9B 1F5JA 1XWHA 4HKOA 1VBA3 1YI7A 1RUI2 4BLJA 1QQP3 3VKLA 2ECTA 4E4DX 5L19A 3OYWB 4KG8A 1NQDA 2MEV3 3NAPB 4W6XA 5JIUA 2RR13 2OIIA 1CAWA 1JHNA 3VUOA 1FYUA 3T1LA 1WCDJ 2PLV3 3ZFEC 3NV3A 4Q0PA 5CAZA 2BWCA 1AR92 1KQRA 4XZPA 1PGW2 3AP5A 2L5UA 2SLIA 4GH4A 4GMP3 1H0BA 3B02A 3QH6A 2VW0A 5EYYA 1WIMA 2GNDA 4OHWA 4WZCA 1OA3A 2K9ZA 4N53B 3WG1A 4FT8A 4I09A 3MIFA 1I1EA 4CDWC 1ENXA 2IXHA 1SLLA 2GH8A 5CU1A 4YGEA 1SLBA 1OQEA 3T6RA 3O0XA 4M3CB 4MV2A 4BHWA 2R1DA 2AUYA 2XL7A 1BORA 5BNPA 1SCRA 5C13A 3AP4A 1Q3EA 5JI9A 2JG9B 4KU7A 2FZ1A 3LQHA 4FPJA 4C0HA 3BALA 4Q27A 5EZWA 2WT1A 1RHI3 1W0OA 1CESA 3C2UA 2GC1A 2EF6A 4LHKA 3IKWA 1LU2A 2D7FA 4PCRA 1QJY1 2R6QA 1S0JA 4QQ2A 4LBMA 4NR1A 4LK9A 1AJOA 2ZBJA 1G9AA 5JIAA 4RHV1 4NHLA 1FNZA 4OHYA 3QCWA 4OUMA 3UKNA 3ZYPA 1XNCA 3VZKA 3WT3A 1WEQA 1S1AA 5AFEA 2PHLA 2DFBA 4OHZA 3WR0A 4YBSA 3H8UA 2ZAAA 1CD3G 3GZAA 5LK7B 3MDPA 4IL7A 2F4PA 1UD1A 4YFZA 4QD2A 1G9DA 5C9AB 2YSMA 1DGRA 1MACA 2VOVA 3TOJA 3WP5A 1GZWA 5BXXA 5CB7A 1IS4A 1RUG3 1HRV1 4RR3C 2HJIA 1Z7S1 4A49A 4PQ9A 4PBPA 1PK6B 2WNVB 4XDQA 2PFWA 5EYXA 3A4UA 3W9AA 1ZZCA 1J3PA 1SDWA 4FJCA 2RE9A 3ST7A 1LHVA 2PUYA 4WVWA 3M3OA 4S2HA 1G9BA 4IERA 4N9IA 3B93A 4AFDA 1C1FA 3ZXEA 1E57A 1R083 3IT8A 5K0UA 4OVEA 3VBUA 2WQ4A 1M4WA 2YMZA 1MZFA 3ZYGA 2ZHKA 4E27A 4YVWB 1V6OA 1NCRC 2XG3A 1K5MB 4D3WA 3ZVZB 2RS12 4GKYA 3FL2A 4YG0A 5C8CC 4GALA 4Y24A 2DCTA 4JV4A 3O7OA 4QX5A 1XQNA 3HCSA 4CDXA 4XQWA 4YRDA 3ZVYA 3U0ZA 4AGRA 4CA1A 1YLLA 1NCQA 1YXWA 2L75A 1FV3A 3V43A 1RUH1 1VBC3 5FTTC 2WZPP 2JICA 4IEUA 5FO7B 3WCRA 4LA2A 4N43B 2DVAA 1TMF2 1DZQA 3D5OA 1FPN2 1COV1 1MS5A 3GF6A 5I8SA 4E2GA 2VW2A 1D4M1 2WFF3 3ZXJA 4G9SB 4KWJA 3JB4C 2NPIA 1MQTB 4OLLA 4CDQB 5LK5A 5I91A 5T54A 5JG6A 2EXKA 5J96B 1FOD3 1Q43A 3FZ3A 3ZSEA 1LOBA 4CYDA 1GLHA 4EN7B 1CAVB 3BU7A 2IWGB 4COYA 2HWF1 3IDBB 4QHBA 1ZVFA 3VGIA 2BVBA 4Q0QA 3X29B 1IYMA 3H1MA 1U5YA 2R061 4XFBA 4FOVA 4YM1A 2ZAHA 3M63A 3ZMNA 2KE1A 4PIYA 3MW4A 3PNAA 5J09A 2UWBA 4EN9B 1OMIA 4DFSA 5I93A 2CSYA 5B76A 1RTVA 2Q0AA 2LN0A 2XKOA 4GULA 2D8SA 5I0RA 3N9QA 2WSVA 2X8KA 1DQ1A 1H2KA 3DN7A 4MH0E 1A8MA 1PGL2 1DQ5A 1JN2P 3FUOA 4FTBA 2ZOEB 4N3WA 4XF1A 3R0RA 4ASMB 3NO8A 1KJLA 4LBLA 4LHLA 3M99A 3O70A 4WZ3B 1ZNPA 4M0NA 5FPZA 2Q1ZB 3J8F3 5FPXA 3ZFEA 4CDUB 5FEYA 3LKJA 4FPHA 4EWAA 3D0JA 4CP1A 4IEWA 2WNUC 4J1WA 4RSUA 5I0SA 1X4JA 2D6LX 4U2AA 3LB9A 2X5IC 1WBFA 4YZ4A 1WW5A 1NZCA 1W6OB 5AC91 5D1LB 3VZOA 1C5HA 1TME1 2GALA 4AEMA 4AFBA 1JUHA 1BEV1 1D0HA 4H7MA 3SITA 4CDWA 2YHOA 2ZHNA 1XNKA 3RTRB 4GNEA 3IBMA 4N7IA 4QQOA 5E16A 1WGPA 2P2KA 1MR5A 1V6MA 1IS6A 4PLMA 1HRI3 2GNMA 2YQLA 2EIGA 4WA6A 4YGBA 1Z78A 3KGLA 1GV9A 3KQIA 1MS8A 2VJEA 3RZZA 3UJOA 1H2MA 1LRHA 2RMU1 2HDPA 5DZFA 1G7YA 2RMU2 1H9PA 1WLCA 5F6LB 2ZZQA 1OHFA 3RPGC 2WIIB 5D1MB 2BUKA 2BNOA 1JXNA 1WMDA 4AVVA 3VN4A 2EA6A 2VJFB 1QH6A 3MFCA 1O5UA 3ECQA 2D3RA 1C8M3 2EXHA 2RS51 1QWRA 1ZBE1 3MHHA 4Q2FA 4R7EA 2VQ0A 4LR4A 1LCLA 5KH9A 4I7CA 4JTOA 1ULCA 3WQ7A 1ZRDA 4HFSA 2ZACA 1LENA 2OW4A 3MIHA 4B4PA 1LEDA 1QJX3 1AHSA 5JAXA 5E8AA 1QXRA 2A75A 5B77A 5EFUA 1RMU3 3FLRA 4QXKA 4AQ2A 4DOUA 5KHGA 3N7MA 2TNFA 5T3NA 2HYED 2Y1MA 1AUYA 1G25A 3WHTA 1ALYA 3WQ1A 1CAUA 4FK5A 4P9WA 3EHKA 3O14A 4BH9A 3ALQA 2LALA 3AZXA 1N1SA 3I54A 4IEYA 3AZVA 4PDWA 4OI0A 1OI6A 1SQ4A 2JDZA 2JE7A 1LECA 5ACA1 2XB1A 2DUOA 4DRVA 2W52A 3AB0A 4JTNA 1W6PA 2ZTNA 3ACLA 2HEYF 4COUA 3WP6A 3VBSC 2R32A 3KV5A 3MIBA 4Q6FA 3AYAA 4I0AA 1AL23 1UZZA 1U5ZA 3I59A 2ECNA 1V6JA 1RINA 1W6NB 4WM8B 1VR3A 1QOOA 1S0EA 1VBD3 1SMVA 2Q5TA 2HWC1 2YUEA 2HWC2 3I2DA 5SV5A 2P3IA 1W6MB 3WDYA 4Q4W3 4WM7B 3VL8A 1WEPA 2EAKA 4K6BA 4XYXA 1O4ZA 3KM5A 5TDRA 1VJ2A 3LA2A 2XUMA 3R4SA 4Q4Y2 5A33B 1VBB1 2RM21 3LOBA 1VBB2 2GC0A 2AR6A 4P9YA 3AKTA 4ISRA 4QMAA 2LGLA