3I2DA

Crystal structure of s. cerevisiae sumo e3 ligase siz1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
286
structure length
280
Chain Sequence
TNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDETSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase SIZ1
publication title Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 59
structure length 280
sequence length 286
ec nomenclature ec 6.-.-.-:
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i2dA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3i2dA02
2IDAA 2MNZA 1Z60A 4TKPB 5DKAA 1MM2A 4WZ3B 1VD4A 2YREA 4V3KC 3U5PA 5JG6A 4ZUXU 3L11A 2L0BA 1G25A 4LADB 2YT5A 2JMIA 2LDRA 2LQ6A 2YURA 2YYRA 5TBNA 4YBSA 4A4CA 1FBVA 5H1UA 1WENA 2ECIA 3I2DA 2H0DA 3MHSA 5FB0A 3M63A 4LK9A 2QICA 1WILA 2XEUA 4BBQA 4YC9A 2HDPA 2LRIC 2ZETC 3O7AA 4GNGA 5C11A 4YADA 4GB0A 5D1MB 5G0FA 4Q6FA 4YBMA 4GNDA 3SOWA 4AUQB 1FP0A 1LDJB 1K2FA 4LKAA 4PTBA 5AIUA 2Y1NA 2YU4A 3U5NA 3N9QA 4A4BA 4A49A 2EA6A 4CA1A 4AYCA 2ECJA 4CCGX 1HYJA 5TDWA 4ZQLA 4I7CA 1VFYA 1WEPA 5FEYA 3KV6A 2K1JA 2ECTA 2RI7A 5KH9A 4R8PK 3LQHA 1VYXA 1V87A 4P5OB 2KWOA 3SOXA 2VJEB 3U5MA 4WZ0A 3RPGB 3U5OA 3L1XA 5G05B 2YSJA 1WFKA 5KH7A 2VPDA 2M85A 2XB1A 1WEOA 3LQJA 2F6NA 2CSYA 5B8DA 2F42A 3HCTA 2YQLA 3PHDA 5J3XA 4F52B 4QF3A 2KWNA 3V43A 2JRJA 4IC2A 4MVTA 2VPEA 5LCWB 1X4UA 3O34A 1WGMA 5KH3A 2G43A 2NAAA 4O64A 2AN6A 3PURA 3SOUA 1DVPA 4W4UA 3DPLR 1N87A 3SHBA 5LKTA 2VJFA 2FUUA 2UZGA 2LN0A 2M6MA 4L7XA 1RMDA 5TABA 1E4UA 1XWHA 3ZTGA 3ZYQA 2QJ0A 4L58A 2LGVA 4UP5A 2OXQC 4R7EA 4IC3A 2QIZA 5DINA 3RPGC 2MUMA 3RTRB 4NN2A 2ECWA 1BORA 5B76A 2KYUA 4LLBA 3M99A 2G6QA 3GV4A 3LRQA 2LXPC 2VPGA 4WZ2A 2VJEA 2YQMA 4ZDTA 2L43A 5LKXA 1ZBDB 2M1RA 1CHCA 3MHHA 2LXHC 3PUQA 4A0CD 4GNFA 2VP7A 3N9NA 3O36A 5C13A 3HCSA 4B86C 3ZPV1 1JM7B 5D1LB 4V3LC 3EB5A 3IHPA 3ZVYA 2CSZA 3HTKC 4B7YC 2EODA 2K4DA 2KR4A 2L5UA 5LKUA 5FB1A 2LGLA 3O33A 3N9PA 5G04B 4FJCA 4I7DA 2KWJA 5LKZA 5TDRA 3KQIA 2K16A 3N9MA 2K17A 1WEQA 2F6JA 2KWKA 2RSDA 1Z2QA 3KNVA 2L75A 3L1ZB 2KIZA 1Z6UA 2KREA 2G45A 3ASLA 5D1KB 1WESA 1JOCA 4MSXA 1WEVA 1WE9A 3NG2A 1LDKC 2MIQA 4FK5A 4C9ZA 1HYIA 2D8SA 2MD8C 5TRBA 3O70A 2FUIA 1WEMA 2JMJA 2YHOA 3FL2A 5H1VA 4AYCB 4PPEA 3LQIA 4FO9A 3M62A 4N3WA 2KE1A 4S3OC 4UP0A 3ZVZB 4GNEA 2MT5A 4YABA 3C6WA 1IYMA 3ZNIA 2CKLB 4X3GA 1U6GB 2LGGA 3QZVA 2VNFA 4LJNA 1WIMA 2ECVA 4AVXA 2M3HA 4YATA 1JM7A 2MNYA 2YW8A 2KGGA 2EGPA 5H9MA 3HCUA 1X4JA 4I7BA 2LGKA 2C2LA 5B77A 2ECNA 4YAXA 2FSAA 4N4FA 2LV9A 1X4IA 4S3OB 3DQVR 5FERA 2YUCA 2MA5A 2L80A 2YSMA 4YBTA 2VJFB 2CT2A 2E6SA 2H0DB 5I3LA 3O37A 1WEUA 3T6RA 4UI9B 1T1HA 3C5KA 4XI1A 3VK6A 5B78A 2Y43A 2ECGA 4AP4A 2JMDA 2E6RA 4WA6A 3N9LA 3EB6A 4QF2A 3ZPVE 2CKLA 5EYAF 5H1TA 2PUYA 2VPBA 5B79A 2BAYA 2KFTA 2MA6A 2YHNA 4FIPA 2C2VS 2DX8A 3KV5A 2PNXA 1F62A 3T7LA 1WEWA 3N9OA 3GL6A 4R2YA 1WEEA 3O35A 2HYED 5AITA 1MM3A 2I50A 5B75A 2KU3A 2KGIA 2Y1MA 4BHWA 2MD7B
chains in the Genus database with same CATH superfamily
3LPGA 1QJU3 4O7XA 4KH9A 5J3UA 3SH5A 1QXRA 5C3QA 4F1PA 1MVQA 2MEV1 5DKAA 1N3OA 3B5LB 4Q4V3 3KF5A 1ENSA 4LA3A 2FCVA 1I3HA 3E2DA 4Q4X2 3Q9OA 1DYKA 4Z8BA 3ZO0B 2YREA 4Q29A 1JYCA 1SPPA 3V64A 4OUSA 2PAEA 3J8F3 2JXAA 5LEKA 5LB6A 5JG6A 1LHUA 5FY8A 3H8UA 3VZNA 1GU3A 1GZWB 1XNAA 3CJIC 3E5QA 4H7LA 4UFHA 1LAJA 4YZ5A 1JH5A 4LADB 1OOPB 5A7NA 3BALA 4KGGA 4WVZA 3LVQE 2XUEA 3H3UA 1C28A 3OBRA 2WO2A 2FDKA 3TYJA 1WBLA 4A4CA 1BBT1 1FBVA 1W2NA 4JTNA 3WG1A 5FJKA 4JHZA 1TME3 4R9AA 1QQP1 4CDXC 4OGCA 2PLV2 1MS8A 3ZLIA 3IKWA 5C3RA 4QHOA 4DMIA 1O8SA 2P2KA 1R1ZA 5FZ8A 2R0FA 1AR71 2E7AA 3CLPA 5BNPA 2C1FA 3W9AA 2R32A 2AEZA 3WF0A 4CCLA 3OTFA 2Q8OA 1REDA 3LAGA 4HK8A 4S2DA 1JYIA 5KHIA 4K7JA 1WA6X 3A0NA 3FC0A 1UL9A 3JU9A 2ZZJA 1HB2A 1PIV3 1NKGA 2HWD3 3MLKA 2Y6HA 5A1LA 3VDDA 5FZGA 3VBRC 4BISA 4UW6A 4HSJA 4GNGA 4L2NA 4HL0A 4D69A 2WFF1 1MS1A 5FAXA 1RB8G 4YADA 3LKJA 5D8AC 4XBQA 4B8EA 4Q0UA 2PAKA 5KXBA 3L9JT 5CFCC 3MFCA 3GM8A 3OEBA 1OF3A 5T5OA 3ZFGC 1W6PB 2PA7A 4AUQB 2E51A 4IDZA 2NMOA 1F62A 4JV4A 5IFTA 4ZY9A 5J48A 1CVNA 5JCTA 1WCUA 5LBCA 2R072 4QHBA 5T50A 4IW3A 2VBDA 3JCIA 3PVNA 4BPZA 4WVMB 5AIUA 1L7QA 1YXWA 3VKLA 1FI2A 1O59A 3FBYA 4Y22A 5A6ZA 1SFYA 4CUCA 3KQ4B 4PDWB 2HWB1 3RFRA 2EXJA 2EVXA 4A4BA 1JS9A 3TAYA 1UKRA 2YB7A 4PJYA 1S2KA 3KF3A 4CP2A 1WA4A 5EQUA 4AYCA 1AJKA 3MV01 4S2GA 1BK0A 1W9SA 2D6LX 3WQ0A 5F3EA 1HYJA 1V70A 1DCQA 2Y0OA 4R4XA 1O3SA 4Z82A 3W58A 4D7SA 3VKFC 2VZQA 1CD3G 5JIUA 1OSGA 4I7CA 1EV12 2W1QA 3WZ1A 5FBJA 3DPRB 2RS11 1FX5A 4YARA 4BQ3A 3MIHA 1N47A 4HG6B 4AVSA 1UY0A 2CWSA 1Y9QA 1DZQA 1DYOA 2XKOA 4Z2AA 2RR13 4E2QA 4DUWA 1A34A 2D6NA 3AP5A 1UYZA 2GC1A 2VZSA 4DUXA 2XG3A 2DV9A 5EHDA 3ZSEA 1RUE1 5BYNA 1W9FA 5DUWA 2P3JA 3OY8A 1AYN3 1JI6A 5HCAA 3ZN5A 4P5OB 2Y6JA 2JDYA 4LMFA 2DVFA 4QXKA 3GHNA 5FPLA 2MEV2 1W0NA 4BK4A 4P08A 5CAZA 5JOZA 3U5OA 2PFWA 4GMP3 1W8TA 2Q1MA 3KHBA 5I0RA 4CE8A 3BIEA 5FK8A 2OZ6A 1G9CA 1NZCA 1S0JA 3RZKA 2VPDA 1DQ0A 4BU2A 2WWJA 5LRSA 1Z7S3 3WQBA 2G4IA 4IEPA 4AF9A 3B02A 1VRH1 4W50A 5FZ7A 1W6QB 1N3QA 3SUBA 5K0UB 2AACA 3PUAA 4YG6A 4YYOA 3UJOA 1ZREA 3PUIA 1HRV3 3VHRA 3HCTA 1AX0A 5J3XA 2ARCA 4RS5C 3TN93 1MEC1 3WLUA 4F52B 1E5IA 4IV3A 2Z42A 5FFOC 4BLIA 1VBC1 3SEEA 2O1QA 3VDBA 4OGEA 3LF7A 1QQP2 3H50A 1YIPA 3KVBA 5IW0A 4Z07A 5CIRA 3RI8A 2KR2A 3BIWE 2BBAA 2XLGA 2ZGNA 4FAHA 2ZEXA 5LATA 3WDTA 4AVVA 2ZEZA 1LKNA 2PN5A 3ITQA 1AXZA 1IGOA 1DU3D 1R1A1 2O0OA 2ZX1A 3LB9A 4PDWC 4MVTA 1AR72 2EIGA 3OUIA 1CQ9A 3BGAA 3I59B 4P9XA 4DEQA 1X4UA 3J4UH 3HOBA 5A3TA 2IUWA 1RUC1 5A7SA 5FPUA 2OS2A 4AI3A 4FPGA 1WLWA 2MPFA 4E8CA 4ET7A 5K9YA 3IDCB 2XVKA 3PURA 5JUVA 2WNUB 3CKHA 2AN6A 2E9QA 1U0AA 2DCKA 3DECA 4IESA 4LBKA 4QMAA 4R52A 4JGZA 4AW7A 5M0TA 1OQ1A 1AR92 2W1WA 2VBBA 1CIYA 3R4UA 5B4NA 5FYUA 3PIJA 1GYKA 1NCQA 2WAOA 4MO3M 1AR61 1ALYA 1VE0A 2YYOA 5CFDA 2UZGA 4SBVA 2JX9A 4LBQB 4L7XA 5KXDA 1WCKA 3WV6A 2ZZQA 1BHGA 2VCCA 4PF1A 1H1AA 4XHXA 5EJ3A 1E4UA 2DBNA 3ZTGA 3B00A 4LO7A 2QJ0A 4XQDA 4BIOA 1MZFA 3PJQA 4UFJA 5FLIA 4Y1XA 3Q8FA 4QGMA 1JXNA 3L2YA 2IFRA 3GYDA 1CAVA 1VBB3 2HWB2 4IE7A 5EFUA 2ZHMA 4R7EA 4LXLA 5IAXA 5DINA 1LGNA 4XUNA 5C8CB 4F3JA 2CU5A 5FUIA 5ABJA 5A1AA 1V6MA 1YI9A 2VQTA 2EAAA 4YGBA 5F6LB 3C7EA 5CISA 1DLLA 3RMYA 3ZXLA 2CRRA 3ZN4A 2DJAA 4PI2A 4YW2A 3M99A 3QLQA 1X33A 1S0EA 3LRQA 2GALA 2RS53 2GDFA 5FYIA 5IK5A 4BLJA 3PVOA 1RITA 2ZGTA 3AYEA 2QJVA 1UZWA 3ZYFA 4E2SA 2OW4A 2EXUA 1A3KA 4UFKA 2LW8A 2ORXA 4ZU5A 5FZ3A 1YJKA 1ND3B 2RS12 4FT8A 3WDWA 2XHKA 2LTNA 1ULDA 2WL1A 4AI9A 1QJEA 1JOPA 1KXGA 1W2AX 2BP6A 2CYFA 1GNZA 3RNSA 3BI3A 3LJUX 3RZHA 2YC2A 3HMYA 3O1UA 2OA2A 4TLGA 1COV1 2XBO3 3OB8A 3V56A 4BIFA 5FMBA 1YLLA 1RUE2 1ZYBA 3HQRA 2QQLA 2IQJA 4A0CD 4LO5B 2ZXQA 1KGYA 4XUTA 3ZFFB 5FOJB 4EZ4A 2QKDA 1Z0HA 2GP3A 1MACA 3ZOIA 4BZ4A 4CDWB 2Y34A 1UD1A 4YVWC 3HCSA 2CV6A 4YVSA 4B86C 2LROA 5FPVA 4FTEA 4V3LC 2YPDA 1QJY1 1OUSA 1W2UA 1FMD3 4FPFA 3USSA 1IZ3A 4HLTA 4NRPA 4DOUA 4QPIB 3GNEA 2K4DA 3ZXJA 3KCYA 2L5UA 4ISQA 1VRH2 2LGLA 1G9FA 1V6NA 4MYEA 4ZPIA 5FV3A 1DVPA 1X9PA 1GKBA 2ZMKA 2XOMA 4H55A 4CEYA 1OVSA 1W0OA 3OGRA 2D40A 2VQ0A 1BEV1 1HQNA 1DIWA 1VBC2 2X10A 3O14A 1VMFA 3AP9A 4NROA 4ZXKA 5A3WA 5FPZA 3SHRA 5TDRA 2YFUA 1PMIA 4LKEA 2CRWA 1YQ6A 2NYYA 3CMGA 5GLWA 3ZSMA 2F6JA 2DUQA 1PHMA 5GZCA 5J09A 4I09A 1OF4A 1HW5A 3JB8A 2V73A 1R1A2 1LOAA 3L1ZB 3Q1DA 1OLQA 4KL1A 1NQJA 2DVGA 2KREA 3JD71 1LB2A 1UY3A 4W6WA 1RUF1 3W59A 1RUC2 2K0GA 5C8CC 2CTVA 4HT1T 1JOCA 3VKNA 4G3YC 3VBOA 1WMEA 2ILMA 3ROUA 1APNA 1WE9A 5EJ1B 4MSXA 4GWIA 1W8WA 2XH6A 4DXTA 3GF6A 1ZZ8A 4QB2A 4RHV1 2OQ6A 2CDPA 3J26N 4K8RB 5AC91 1W6NB 5JXHA 1HYIA 3NAPC 2ARAA 4CEWC 1CGPA 3O70A 1WW4A 1AR62 1VBA1 5GLTA 2DSMA 2FUIA 2YHOA 1QJU1 4EQVA 4CU6A 4FOYA 1VMJA 5FZCA 4LLFA 4D3WA 2GMMA 4NRQA 4Q4V1 4YW6A 4PPEA 5J37A 3LQIA 5FZFA 5K8SA 4N3WA 1H8TC 3J8F1 5GLUA 3POBA 4QDSA 3C2UA 4GULA 4BB3A 4CDUB 4FOVA 1HXS3 1MZ5A 1V6LA 2WYSA 2ZOEB 3AVRA 3FN9A 2J1AA 3N35A 4OI4A 2JE8A 3IIAA 5DUUA 5KHHA 3SC7X 1IQAA 3WDVA 4BDVB 2OUJA 4YLZA 5CB7A 1TMF3 1IPKA 3T4VA 4EN0A 4C0HA 5C70A 3C6WA 1ZBA3 5HCFA 3CZJA 5ISLA 1LGCA 1W04A 1A6CA 4LK7A 5BNOB 5F32A 3VD9A 3VBUC 1CN1A 1DF0A 3LSDA 4L97A 4X3GA 4W65A 1TME1 5CFDC 2ZX2A 4BK5A 4GB31 4OMCA 2LGGA 1JODA 2ENRA 5LA1A 3QZVA 2CAVA 4F8AA 1ENQA 2Y6GA 4P14A 1NYWA 2YUEA 3UKNA 5L9RA 3NJVA 3H8RA 3LEMA 1JYNA 1QJFA 1F4AA 4XJAA 4DPNA 1Y4WA 2CDOA 5FZOA 2XPJA 2M3HA 2JDPA 3CL1A 4YATA 1JM7A 2X5IC 2YW8A 1H1IA 2VCMA 1ZBE1 2AEYA 4L92A 4QPGA 5FLJA 1QXJA 1WWYA 2A3YA 2VUCA 4LR4A 3APBA 1PIV1 1LHOA 5FXWA 1COV2 2JJ6A 3VKOA 2QQJA 2B39A 4M3CB 1CONA 3IBMA 3J7MA 1XPWA 2B4KA 5GKAC 1BXHA 1I6XA 1PO11 4IXLA 2C2LA 1G7YA 4FPLA 2OUHA 2RM23 1F8VA 2WLQA 2CHHA 5L19A 5B77A 1QJY2 4HOOA 1DP0A 2G19A 4QX2A 2E61A 1CZSA 1UOGA 4NIHA 1XNCA 4QKFA 2JIGA 3EO6A 1W8NA 2OX0A 1SDWA 2HYXA 3M3QA 2UU8A 4HBNA 5J96B 3NJYA 3QH6A 5C9AC 4TZDA 1HIXA 2D97A 4MLOA 4FCAA 2FSAA 4YAXA 3ACGA 3N7KA 5F8PA 1YQ2A 3M70A 5FYCA 3LOIA 4WM7A 2J1SA 3DEMA 2C6SA 3LDKA 2EIDA 5JZGB 2LV9A 3IN9A 2E53A 1G9BA 4S3OB 2Q8CA 1FXZA 3JBG3 2EALA 3LSEA 4QX1A 1BEV2 1GOHA 2WSVA 3AZYA 4R9CA 4XACA 3AKQA 4LKSA 3OGGA 2ZA9A 5L73A 4YVSC 4F83A 3FJUB 1YIFA 3POYA 4MHUA 1NLRA 2D44A 1OLME 3AKPA 2VW1A 1NXMA 4N53A 2Q1FA 5ANNA 3WF1A 4AFDA 2E6SA 4FQ4A 2BUKA 1X8MA 3ZYJB 3AMPA 2UYAA 4LIUA 3M3IA 2H0BA 2JIJA 2W52A 3T6RA 2WNVB 3JD72 1FNZA 4ASKA 1RUF2 2WT1A 1QH7A 4UFLA 5I91A 3SCHA 1AYM3 4ATEA 1OURA 4AEDC 4DUVA 1HLCA 5CNAA 3WW4A 3V0AB 2Y43A 1AL23 2NZ9A 2RDRA 5FZKA 1WMFA 3DXUA 4RHV2 4BQ4A 4JGYB 4E2GA 5AC92 4DY5A 2YBKA 1X7NA 1FNYA 2BGOA 2JG8A 2QZ2A 1AYN1 2B7YA 2HEWF 3RZGA 4WA6A 1RGSA 1VBA2 1D2SA 1D4M1 5EXOA 4QAWA 1QJU2 2VXJA 3POGA 1FPN3 5E6HA 5JMOA 2JECA 4Q4V2 3TRSB 2ZX4A 1VAKA 4Q4Y1 4JQTA 3RYRA 4XEZA 3UL2A 3H1YA 3JB4C 2RS33 3VBHC 5H1TA 5K3QA 3LQCA 1HX6A 1K5MB 1QHDA 2XJTA 2XWBB 2HWE2 2NQYA 4NRMA 3IIIA 1Z7S1 5A3MA 3P3NA 2P3YA 2ZCWA 2NPIA 1W3XA 2WKKA 1OHFA 2DX8A 3HIFA 2R30A 1OH4A 3FLTA 3LDBA 4MXVA 1HRV1 4XUQA 4BA6A 3T7LA 2WQZC 4XIKA 4R2YA 1WEEA 5C71A 4XFAA 5IAVA 3DKWA 3O35A 2JD4A 2ZGQA 1TME2 2ZGOA 4GB32 4C1WA 1QJX1 2UURA 2WDBA 4MXWA 1HB3A 1GBGA 1VBA3 3FHQA 3HNMA 4QM8A 3POEA 5FTTC 3S6PA 3HQUA 3K4DA 3UJQA 3RJ2X 5B75A 4Y3OA 2H6CA 1LULA 1UYPA 3U37A 4BHWA 1Q56A 2XLFA 1PGW1 2Q5TA 2IDAA 5C8WA 1N1YA 3M3CA 1OLMA 4NHKA 3VGIA 1POQA 4IV1C 3GBFA 3O1PA 2MNZA 1ZBE2 4MUVA 1MM2A 3RYKA 3G6JB 3BKZA 5FWJA 3D6EA 2SBAA 5GLZA 1VD4A 1PIV2 4YZ2A 2WA3A 1SFNA 4HMZA 3AFKA 2WO3A 5A70A 4MZUA 4Y5Z0 4AI1A 1CAUB 3MW3A 5A80A 4V3KC 1QH6A 4ZUXU 2L0BA 4JC1A 3OPZA 1VPHA 2Q0AA 4K40A 2R061 1Z2QA 1IPSA 3KQRA 1PO12 4XFCA 4Y33A 3WP6A 5C4WC 4YM1A 4FP3A 5EWSA 3HVDA 3H9AA 1LEDA 1RUD1 2LM3A 5TSWA 1UZZA 1J3RA 1PO23 1PK6A 2GNDA 2WQ4A 3DKQA 3DUIA 5FLHA 4YBSA 1CAXA 1KJLA 4O65A 5JI9A 1GWMA 1KS4A 1F2NA 2VOTA 3N7JA 3O0VA 4LQRA 2ECIA 2UWCA 3H1MA 1FATA 4K6BA 4E8DA 4JGYC 2E31A 4QQ4A 2IXCA 1RL3A 3Q8AA 3V0BB 2WWUA 2H0DA 5FB0A 1T6BX 4QKDA 3CO2A 1BMV1 1OH3A 1O5UA 2BWCA 3B93A 2EAKA 3DGTA 2FDFA 3WNOA 1VBB1 4QX8A 1UXXX 2E6VA 4GZ9A 4W8JA 1DGRA 4BBQA 4E27A 4JKLA 3PJYA 2AREA 4GH4B 5LRRA 5F1RA 4XAEA 3OD0A 2WRAA 3O1SA 4LKDA 1IPJA 2LRIC 1LU1A 4XF1A 4AAPA 4ARXA 2ZETC 5JSRA 1F4HA 5J98B 3O7AA 1V6OA 3B9IA 3A4UA 1J58A 1IKPA 1B35A 2BVBA 4YRDA 1LHNA 4Q0PA 2RS51 3AKSA 5G0FA 2ET1A 4GKXA 4COWA 4Q6FA 2GMEA 4YBMA 2G9ZA 2PTMA 5F2WA 3MIGA 3KCCA 4PQQA 3SOWA 4Y1ZA 3TWIA 1OPMA 4XF4A 3RGBA 3RI9A 1MS3A 2WNOA 5FXVA 1G86A 1W05A 2RE9A 4N43B 5EYXA 3O1MA 3UT0A 3LE0A 3VBFA 4MG2A 4CCOA 2WSUA 2YPJA 2EIEA 1MBMA 2XBO1 2W68A 2VW2A 4FPEA 1AYN2 2Y1NA 3VV1A 1BVVA 1FOD3 1D4M2 2RJ2A 3ZN6A 3N36A 3ZSKA 5FP9A 4AXOA 2VAUA 3U5NA 1DZRA 3CJIB 4FSJA 3SXWA 5FYZA 1NUKA 3I49A 4Q4Y2 1V9U1 1GQPA 2C9AA 2YXSA 3NV2A 2EA6A 4PQ9A 1IS6A 4Y20A 4W4UA 1E5RA 2VTXA 1VLNA 2B9UA 1DHKB 3FM8C 4QXBA 3B9CA 1WBFA 3NL1A 2DVDA 1DGRN 3OSDA 5D2AA 3T1MA 5J7MA 1VAMA 1Q8QA 3MUZ1 5L9VA 5FKCA 1ONAA 4CDXB 1CESA 3ZXAC 5TDWA 4XFGA 4ZQLA 1I9RA 4XDQA 3OPTA 4HPKA 3WHUA 5HI0A 1UN1A 3FMGA 5ANQA 1UMZA 2OZJA 1A8DA 1GQHA 4XF3A 2FCTA 2YC4A 3D0SA 4LHSA 4A2UA 3AKTA 1G9AA 4AK3A 1URXA 4YW3A 2K1JA 2ECTA 4Q0QA 1QJX2 5FZAA 4CPBD 4JDNA 3TB0A 2DTWA 2RI7A 4Y1VA 4XVHA 4R8PK 3LQHA 4Z0RA 4CUBA 2HYKA 1GZWA 4JRLA 1FV3A 2SLIA 1UU6A 3IWZA 5DPNA 3VBRB 1V87A 4IETA 3FAOA 4QQHA 1PGW2 2VUAA 3SOXA 5IWFA 1OOPA 3UV9A 1RMU2 1AL0G 1G6NA 5FCCA 5D8AB 2VM9A 2JDNA 3IZOA 3LIGA 5G05B 4Q5OA 2BNMA 4B7EA 5A7QA 2YSJA 5CFCB 2BWAA 4MX3A 4D7YA 3U1XA 3B94A 4OI0A 2F4PA 4MV2A 2ZGSA 2YC0A 3ZFGB 2WC2A 4OLLA 1K12A 2QZ3A 4CXYA 4BHPA 3FHAA 2P57A 5HV4A 2R062 1Q8VA 3GZTB 4PIXA 1DZTA 4B7KA 2CSYA 2J7MA 1PZ7A 2JICA 2YDEA 5L9BA 4INDA 4JDMA 1RUD2 1EP0A 3KGLA 3ZPYA 4I2OA 3KS7A 2YQLA 1J83A 3PHDA 2YV8A 5ERLA 2W5FA 1SMVA 1DLCA 4FFHA 2KA3A 2W47A 4KU8A 4AHXA 4YNIA 5DUXA 5FZ1A 3BTYA 4QF3A 2B5HA 4GALA 2QFEA 4RFRB 2A75A 2D3PA 2PQQA 4NUBA 4DO0A 4XQWA 1W90A 3FJSA 2ZGUA 4QGLA 1W39A 3IDBB 2JRJA 4IC2A 2CSGA 3V65A 3F95A 3WX5A 2W9XA 1XYPA 4PIYA 2VPVA 3MW4A 3PU3A 1VBB2 5C7GA 2VPEA 1MZEA 3O34A 3CHXA 2JG9B 2E63A 1CAWB 3J7LA 1ZBA1 1QGLA 4P5HA 5FZIA 3TOJA 4WZFA 4O64A 5EV7A 1ODMA 2VH9A 3ORJA 4I02A 1SCRA 2HKXA 1I5PA 1US2A 3KWVA 3LA3A 4MADA 4FPOB 3SHBA 1BCXA 3K3OA 4JRAA 4PLMA 5DAVA 4WVMA 4MGTA 3AMHA 3O1VA 4XFIA 1LR5A 3MI8A 2RS52 1VR3A 4Y5TA 4A44A 4ZKTB 1VBD1 5F3CA 4AFMA 3FHIB 1RIRA 5C3OA 4NN0A 5I0TA 3FWEA 4XJUA 4K20A 1WLCA 4Q0SA 3U78A 4AEKA 1SEFA 3BPZA 4ES9A 4R9DA 3S5QA 1Q5OA 3MICA 5L7OC 2LN0A 4M01A 3WF4A 4BOWA 2M6MA 2XVLA 1H6XA 3WF3A 1RUG3 1SLIA 4UYBA 4CP9A 3K75B 5FY1A 3VHOA 3AMNA 1XWHA 2XBO2 3ZYQA 3BOPA 1H30A 1ND2A 5SVYA 1WW7A 3ENRA 4GD4A 4I0BA 4UP5A 4XW3A 4OHYA 2HH9A 1YFYA 1NLQA 4IEOA 1W8ZA 4IQPA 3FFQA 4QDQA 1W2OA 5A3OA 4UF0B 5F7UA 2I45A 1EPWA 1YWKA 2RM21 1N1TA 2BFUS 2QQOA 3D8CA 3E1F1 4IEXA 1V9U2 2R041 2ECWA 5FOBB 4BQ2A 2XB6C 3P1IA 1K45A 1S0GA 4OZXA 4XOGA 3MDPA 2RJKA 2I2SA 3AM2A 4CDQA 5B76A 4RS5B 1F5JA 3HJRA 4PIZA 3SKVA 4LPLA 4BM8A 2G1MA 3HWJA 4CPBA 2LXPC 2VPGA 2XMLA 2GNMA 1GANA 2MHFA 3DXTA 3MLJA 5FP7A 5IJRA 4FXGB 4V2WA 4OYUA 3VZLA 5KHGA 5SVIB 3AJYA 2C9KA 2DUPA 3JBG1 3ZDVA 4CCEA 4ZDTA 4XFHA 2FZ1A 2L43A 4XF9A 1MR5A 1ZBDB 1RVF3 4WM8C 2M1RA 4NOTA 3GALA 5LK5A 4FP2A 3CU7A 3I2OA 1CHCA 2P1BA 4CU8A 2HWC1 2Y60A 3PUQA 5FK7A 4LBMA 4C8DA 2VU9A 3PLWA 2O8QA 4LULA 3VBSC 1NCRC 2WUHA 1LGBA 1EUUA 3NSTA 5K0UA 4OI2A 5C13A 2JG9C 3VDAA 4YGCA 4Q4W3 2WS93 3CDZB 3BVCA 5D1LB 2FMDA 4I0WB 4JKMA 4Y4RA 2BJSA 4D0QA 5IVBA 3ZVYA 4XXPA 4WVVA 2CSZA 3W5MA 1UZYA 2XONA 4P9LA 3QD6A 1AL21 3U07A 4B7YC 1W6MB 2QDNA 5FB1A 3U0ZA 5A33B 1H4HA 3ETPA 4OULA 1OKOA 1WGPA 3B01A 1RTVA 5BNPB 1EAH1 4LE4A 3T2TA 2WNEA 5KHKA 2IVJA 3LVRE 4LK6A 4CCJA 3CEWA 3RPQA 4NWWA 3VHNA 4COZA 5FXXA 3UKTA 3TEYA 3KQIA 2DUOA 2K16A 2WNUA 3W5NA 1WEQA 1PGSA 3NNJA 3PMEA 2RS31 2RSDA 4DXRA 1GNHA 4LEJA 1FT9A 4AEMA 3ACLA 3C8XA 1BZWA 4AFBA 3GXUA 1S0BA 2JDKA 3KSCA 3U4SA 1MVEA 3K3NA 2HBTA 2KIZA 1XC6A 4FBFA 1Z6UA 2VL4A 1QEXA 4QXCA 2G45A 1LJ7A 2D7FA 4M3CF 4KG8A 4JHTA 2VZTA 4GXLA 2FQPA 4RR3C 1IS5A 1NE4A 1RJ7A 1XBFA 2IVIB 5FY9A 2ERFA 3M4FA 2M13A 4LO4B 1SG3A 2QBXA 1BBT2 2UWBA 1DGWX 5A7WB 1LDKC 1V0AA 2BZDA 4Y22B 3AYDA 3TNQA 4LE3A 1BYHA 3T2PA 1POV0 3GCXA 1K42A 1SZBA 3ZXFA 4EN7B 5I0DA 1WKYA 2JDAA 1VBD2 3KT1A 3WW2A 1O4YA 4IUGA 2D8SA 2JENA 4KBZA 3H3ZA 1S0CA 1WD4A 3MF9A 2JMJA 4GIQA 5JI7A 5SV8A 3FL2A 4AYCB 2DTYA 5FZLA 5FRAA 1OI6A 4YM3A 4YVWB 2EXIA 4FO9A 4TN7A 4Y24A 4AVBA 1UYXA 2ARXA 4ZHNA 2KE1A 3ZYBA 1KS5A 4UAPA 2PHLA 2PELA 2XQXA 3VZKA 2Y6KA 2ZACA 1UY1A 1WUVA 1CPNA 4X6QB 4X8PA 2JDZA 2WFF2 3W20A 3P3PA 1OQEA 1SQ4A 3HBZA 4LIVA 4XETA 5LY1A 4IEQA 2YROA 3CNAA 1GUIA 2RM22 1ND3A 3I3MA 3EB7A 2J1RA 2RG4A 3PVEA 2R042 1TQ5A 2XP0A 5JXIA 4UW4A 2R16A 3BN6A 2CKLB 1MS9A 1W99A 1GWLA 2ZX0A 3WP3A 1U6GB 2EIBA 1UYYA 1W8OA 1ULGA 2V5DA 2TUNA 3OY8B 4L11A 5FREA 5KXCA 2ZEYA 2RMU3 1HRI1 3FLPA 1XU2A 3R6SA 1MS5A 3KHCA 5BNPC 5FZDA 1O5LA 2FBEA 4Q0VA 4ARYA 5HBAA 3H7HA 1UOFA 1JU4A 4CDWA 1ASJ3 1JMUB 2WLPA 4BXFA 3A23A 1HN0A 1XXNA 2VG9A 3NJXA 5FYTA 3VDDC 1AZDA 1C8M3 4AL9A 3EXUA 4MGQA 3PMSA 4OI1A 2WINB 2PHTA 3IPVB 4LNVA 3I2FA 1DQ4A 1NA1A 1PZ8A 4Q8KA 2C26A 2EGPA 2HWC2 1ZX5A 4ES8A 1PVC3 1MQTA 3AL5A 4AGGA 5H9MA 4QPIA 5LKZA 4CZSA 3TBDA 1F15A 2P3KA 4YWAA 1XOYA 2B46X 2WA4A 2X53S 3K4ZA 1PMJX 1YYNA 4IL7A 2XOCA 2LAUA 3T2OA 2YHJA 2X8KA 3NAPB 4UOJA 4Y5SA 4CEWB 1VAVA 2BFUL 4EE2A 2JUNA 1L7RA 2IC1A 3AX4A 4CSWA 5CBLA 4B4RA 1AL22 2JDHA 3S0MA 2A6VA 4XYXA 5H9SA 1VP6A 3E6DA 1YFXA 1POV1 3BOWA 3MIBA 1EAH2 4NAOA 4I01A 4A41A 4MHRA 4IE6A 1H8TB 2XQRA 5LEJA 1X36A 1X4IA 1ZRIA 1FYUA 4BWOA 3HPNA 5DG1A 1B09A 4M3CE 1GP5A 2ZABA 2X09A 3NW4A 4AE2A 5FERA 3ZYRA 5GZGA 2YUCA 3PVBB 2MA5A 5IVCA 1AF9A 2PHWA 2RS32 5DZEA 3AZXA 4HZFA 4XJ9A 3VBUB 1D0HA 1XU1A 2JEMA 2QQUA 1TVGA 3PTYA 1W6NA 4PI0A 4QKNA 4XBNA 4X8NA 5T54A 5CFDB 1ENRA 2RVAA 3OGJA 3OYWB 4IEUA 3WEZA 4UI9B 4BQYA 3WNMA 1T1HA 4FOQA 2JD9A 5FPAA 1ZZ6A 1KJRA 3SH3A 3VN4A 1E57A 1Y7BA 5FBZA 2ZGMA 1QU0A 3VK6A 1X50A 1UY4A 1O3QA 3UGFA 2BU9A 5FYYA 1MEC2 1H8VA 3AXDA 3GCWA 2X5IB 4I30A 4CCNA 2CSVA 2RV9A 4Y26A 2IXIA 3HAGA 4UFMA 2DCZA 4Y1UA 4FOWA 3NV4A 1RINA 5F3IA 2WO7A 4TSVA 5F37A 2WBKA 3EB6A 3GZEA 3ZFEA 2GAUA 5FY0A 2D3SA 2R073 4QF2A 2WFPA 3WUCA 1JZ6A 5FP8A 3ZPVE 5BNOA 5EYAF 4XDOA 1Y9MA 4P9GA 1N3PA 4I3PA 2VNGA 3BB6A 4GAZA 5FQ0B 4NAMA 2PUYA 2VPBA 5B79A 2CAUA 2J22A 1ULPA 5BUVA 5D21A 2YHNA 1DQ2A 3RMXA 2QTWB 5F39A 4IV3C 3BTXA 2WT0A 4RSUA 5C9AB 4FIPA 5FY5A 2PNXA 5C5TA 4V1PA 2BPA2 3N9OA 5KWRA 2D43A 2ZEWA 4GQ7A 5FZEA 5FZ6A 3USUA 3MF6A 1HRI2 5LA2A 2CGNA 2F6BA 4MGYE 1JOBA 1HB4A 2QQWA 2VUDA 2ZKNA 5H9RA 4ISRA 5FDBA 4N7IA 3D4KA 2I50A 3I4IA 4DQAA 4YVSB 3I2KA 3T09A 4M3CA 2E26A 5JVVA 4DEVA 1LOFA 1SCSA 1Y3TA 4UI9L 2A5ZA 1NZIA 1W9TA 2KKYA 4HK9A 2ZJCA 2VJXA 3POFA 1Z60A 4MGSA 1CZTA 2PHUA 2W0XA 4NVPA 3WQ1A 4B29A 5KC5A 4O62A 4JGZC 3GHMA 1I5ZA 5A3UA 1JTZX 4LITA 2VMEA 1EY2A 3HT1A 1NCQC 3A0KA 4AEDB 5IHRA 2WZR3 3RZMA 3WP4A 2VVEA 4JCKA 1S4CA 2W3JA 1V6KA 2VUJA 4PCRA 1EUTA 1WZXA 5B4XA 4D7TA 1G25A 5BV6A 1PM4A 1QF3A 3GJBA 3DF0A 5FYMA 3PHMA 3POSA 4HVRA 5JZGA 4NHLA 1VBE3 4LTAA 1YQ5A 4W4ZA 2ZKLA 2JMIA 2LDRA 1LHWA 3MEPA 2YT5A 3WG4A 3SLIA 2YYRA 4BH9A 5TBNA 3SEPA 1GZTA 4BE3A 5BNNA 1WENA 1QKQA 3HN1A 1RUG1 2GC0A 5E1RA 1AXYA 1YUDA 2A71A 3FEHA 4GMP0 4Z0OA 2JB4A 4JAAA 2P37A 3D0JA 4RN5A 5APAA 3AKRA 1RYYA 3A7QA 4KG0A 3WD5A 5A3PA 4C90A 3QCWA 3I2DA 2HWD1 3VKMA 4NHMA 2GU9A 3IDEA 3OEAA 4BXSV 5C3PA 3VBHB 4RQPA 3MHSA 4LK9A 3KMHA 5ABJC 2BV4A 2WNVA 4FPHA 4JX0A 3Q8EA 4ORFA 3P5BA 1LENA 2XEUA 3ZKYA 3WNPA 1N1VA 3R4DB 5CG8A 4XTPA 1SBFA 5FP4A 5ACA3 2F17A 4BMEA 1SBDA 4G4FA 3V0AA 1TEIA 4RD7A 3EHKA 1XNKA 4LBJA 4K8FA 3CIHA 2Q30A 1IKQA 1LOGA 5DZGA 5D1MB 3AJZA 2VTFA 1H2NA 3ZSJA 4C91A 2HLEA 1UW8A 4IGOA 5IK8A 4CVUA 1SLBA 1JUIA 4GNDA 1X9TA 3PLQA 2WJSA 3H42B 5HCBA 5HXVA 4D6RA 3ZIWA 4AAXA 2H0VA 1RVF1 3DCQA 4XCBA 5JSPA 1FP0A 4XPVA 1K2FA 4LKAA 4PTBA 1NY71 1AR93 3I7DA 1OFNA 4IV1B 5HXMA 1X82A 1K5MA 2IZWA 4XAAA 4LORA 1DGLA 1UU4A 1X8EA 3GZUC 2B8MA 1ZRCA 5I93A 2RR4A 5FYBA 4J1WA 4DXSA 2YU4A 3K48A 2R1DA 4NHYA 5LA9A 5IK4A 3N9QA 4BJ0A 2IXHA 2GH8A 4EROA 2WS91 4ATFA 4FPKA 4META 1PMHX 5F5CA 1KDKA 5FJHA 5C4WB 2QQPA 1XQNA 4LBLA 2WZEA 2R1BA 1GZCA 4CA1A 4UXAA 3ILFA 5GLVA 2ADDA 2ECJA 4Z1VA 4HN1A 2HWB3 4FPYA 4OVEA 4CEYC 3BODA 4CCKA 4CCGX 3C7GA 1F35A 3HT2A 4OUMA 2WAAA 1T6GC 5FZOB 3ZPOA 2RDQA 2RR11 3I2GA 4Z92B 1J59A 3ZXKA 1L3JA 4W6XA 2Y26A 4IE4A 1WCSA 2D6PA 2FD8A 2VMDA 2VNRA 1WEPA 4DRVA 3MZHA 2IXLA 2D6OX 2H6BA 4QXHA 1AR83 1PX4A 2RJLA 3KV6A 2W91A 4AHWA 4NHXA 5A32B 3ZFEC 4QKBA 5A1FA 1W6OB 2YGLA 5KH9A 4EN8B 1R093 2QNKA 4GMP1 2WZPP 1CAUA 2VZUA 4KI5M 2A6ZA 3C7OA 4JDOA 5I8TA 3J8F2 1MPXA 1LU2A 2V4VA 3KD4A 3VBOC 3ETQA 2KWOA 2ZPXA 2VJEB 3U5MA 4X6RB 4WZ0A 5AFEA 3RPGB 2VE1A 5IVFA 1UAIA 3FANA 2ZAAA 1WFKA 1RHI3 2PQSA 5KH7A 4I3GA 1RUE3 1UOBA 2P6CA 1NXD1 3KV9A 2L7PA 3HQXA 3TN91 2JDUA 1XE0A 4PBOA 2I07B 3WINE 3V0BA 1WEOA 3LQJA 1ENXA 4XMAA 4OHZA 2C4XA 4FI9A 3PUHA 5JWPA 3F2ZA 3MIEA 5BPXA 2Y33A 3BTZA 1YC61 1ULOA 1BK1A 1QIQA 1H9WA 1GV9A 3SKJE 5E8AA 4AQ2A 1XSQA 4XBLA 5EPAA 1DQ5A 3WW3A 5DDJ3 1DCSA 4AYUA 1NX9A 4S2HA 1GP4A 2MIQA 1IHMA 3LOBA 5T5JA 2D3RA 1C8NA 3OPWA 1REFA 2HWD2 4XFBA 1JZ5A 2XLAA 1M06G 2P3IA 5F6KA 1AVBA 4AWDA 2O14A 4I0AA 2VZ1A 1JBCA 1FAYA 1VALA 1WGMA 1US3A 3MHZA 4NWVA 1BKZA 2HWF3 2G43A 1IG0A 2NAAA 5JOYA 1UZVA 3SH4A 3GDBA 3VD5A 4DRRA 2FDHA 1R083 4LKFA 1RUJ3 1OKQA 4N43A 5CG9A 3MDBC 3SOUA 4H3WA 3OGSA 3ACFA 4PF5A 1JZ4A 3DPLR 2W08A 2VZRA 1UF2C 3I54A 2RMU1 4CCCA 5BNNC 1MS4A 2VJFA 5E88A 4YZ3A 1RUC3 3LFMA 4QPGC 2FFWA 2F4LA 3Q8BA 1TNRA 1W06A 1ASJ1 5LBEA 1YHFA 4JZRA 4WV8A 3QACA 2JDMA 3WP5A 4ZZ5A 2FUUA 1JYXA 3CJIA 3J7HA 1NAEA 1OVPA 1XJAA 1RVF2 1OUXA 3HNYM 1OD5A 3R4SA 2ZBJA 1NY72 1H1MA 2YGMA 5CU1A 1RMDA 2B9VA 3SMHA 1ZRDA 1YQCA 2DDUA 4QD2A 4OCTA 2LGVA 2DU1A 1LRHA 5DXDA 3VZJA 3O12A 4CDXA 2D98A 3VL8A 1SBEA 4TYSA 2XUMA 4CP1A 2OXQC 5A6QA 1ZVFA 4AI0A 4IC3A 4YW1A 5JOXA 2QIZA 1CJPA 3RPGC 4IE0A 1SLLA 1G9DA 1GSLA 4NPMA 5IK7A 1ZZ7A 5FY7A 2FDIA 1BORA 2MNGA 1ZZBA 3M3OA 3ME2A 4NO4A 1I1EA 4WM7C 5FZBA 3LCPA 2P4EA 4QQOA 2KYUA 4AR2A 5C3SA 2B42B 4OFGA 4P9IA 4PT6A 5DQ0A 2G6QA 2VVDA 3WUDA 1Q3EA 4BQ5A 3GV4A 1PNFA 2RR12 3NO8A 5CA6A 4XC9A 3QOPA 3MYXA 2J1TA 5JLVA 3ILNA 1DQ6A 4QPYA 4N53C 5D8AA 4YG0A 5LKXA 3DYPA 2OXBA 2E32A 5DG2A 5CFCA 5A7PA 3AYCA 2R6QA 3WNLA 5DZFA 4NMIA 1VMHA 3I2JA 3ZSLA 3MHHA 4ASLA 3ZFGA 2LXHC 3NV1A 1EYBA 3AC0A 3WNXA 2FCUA 1FMD1 1RUNA 3WNKA 2BQPA 4AFAA 4GNFA 5F9TA 2VP7A 3N7MA 5LBBA 2LALA 3O36A 2VMCA 1Z7S2 1CAXB 2QUOA 1C1FA 4AOCA 3G7DA 4NJ4A 3VLBB 4FAGA 3ZPV1 2AC1A 3J7NA 1XNTA 1COV3 4GJZA 2ZGPA 1ULFA 4A6OA 4FTBA 1HRV2 4DZGA 3HTKC 3O5SA 2JG8C 3BU7A 1DQ1A 1DGWA 3ECQA 4QT6A 1O7FA 3TN92 4CU9A 5L7OB 2V09A 4G9SB 5SV5A 4ASMB 2EODA 2AZ5A 2DVAA 2YMZA 4IEYA 2KR4A 2G9GA 1LNSA 4Q1PA 5DUVA 3VD4A 1S1AA 3NV3A 3O33A 2MKEA 1YEWA 1QJY3 1TNFA 2OQ7A 4DIQA 1MZ6A 1H2KA 1SDDB 3WG3A 1YRZA 5G04B 2CONA 4XHBA 1UX6A 4FJCA 3FUQA 5DABA 2J42A 1WCQA 2WIIB 4OHVA 2WR9A 4I7DA 2P6HA 1CZVA 5KR7A 1J1TA 2GSYA 1JYVA 2Y8KA 2K17A 1S0FA 3WF2A 5F2SA 3THPA 3AL6A 1HV1A 1LESA 2ZMLA 2WYFA 3P6BA 3WXPA 1D2QA 2FZ2A 2VULA 4HXCA 5DAPA 1JYWA 2CL2A 4H9DA 4HVOA 3NNMA 4HKWA 2PXJA 2ZS6B 4YSFA 2CNAA 2VNVA 4QDRA 1WEVA 4C1XA 3NG2A 2IXJA 3I3QA 4M0HA 1CJDA 3I2HA 1DYPA 5EZWA 4A7ZA 4EZHA 2JE9A 4EV0A 4QGNA 4C9ZA 2RMU2 2VY0A 4WM8B 1YO8A 5KHJA 3JD73 5DAWA 1RUF3 2CGPA 3EBRA 2E7TA 1OC1A 2TBVA 4F7ZA 3VD3A 3OOXA 4TXWA 4XUPA 1KFUL 2R49A 2D8UA 5TRBA 2VMGA 1ASJ2 1BMV2 4MH0E 1C4RA 4LOTA 1HXS1 4Y20B 3H1WA 1RXGA 2OPKA 4UF0A 5FXZA 3BPSA 3QBQA 1NCRB 3VBSB 1CPMA 4YGEA 4D8MA 1TMF1 2UY9A 5AC93 2GMPA 1HQLA 3AMMA 1RUI3 3ZDSA 3M62A 3LDRA 1W6PA 2DYCA 1Z78A 3K51A 4V2VA 5K4LA 3S7IA 4E4HA 2WZR1 3IT8A 4XIOA 2AENA 1PK6C 3LEGA 4UP0A 1PM7A 4B4QA 2VOXA 3ZVZB 4PHZA 5G04L 1DDLA 5BNQA 4YGDA 2MT5A 3D3AA 1AX2A 3M3EA 3THDA 1OLRA 1VBE1 1HN1A 4LBNA 4AQSA 4QU2A 4HONA 2Z4FA 3FBMA 4JQRA 5LA0A 4PDWA 4FK5A 2XWJB 2E7QA 4LBQD 5G05L 2HWE3 1LEMA 2FDJA 4OQ9A 3ZXEA 3MUY1 4YW7A 3OGVA 1Q43A 3MLLA 4WVWA 1JHJA 1RJ8A 1XSRA 3BCWA 4PLNA 2VNFA 2Y0IA 1GR3A 1U5XA 4CUAA 4LJNA 4HKLA 1QY4A 2B45X 3J9SA 4KMQA 4AVXA 3WR0A 3MPPG 4EWAA 3MIDA 4BQ1A 3PTRB 2MNYA 4RGAA 4GB33 1JZ7A 2XVGA 2GC2A 1B35C 1KITA 1XNBA 2PYTA 2VTXJ 5ACA1 3DPRA 2KGGA 3LWCA 5FPBA 4NPRA 4RR3B 3U4XA 1FMD2 3ILRA 3D82A 5JSOA 1EPZA 1W6MA 1LHVA 2NN8A 1C57A 1JUHA 1GP6A 2TEPA 5A33A 3HCUA 1XYOA 1X4JA 2Z79A 4XABA 3RRDA 3INAA 3ZMNA 3ALQA 5IATA 4I7BA 1ZBE3 4B1MA 2LGKA 1KD7A 3RZZA 3VBFC 1GMMA 5FKBA 2PHDA 4MGZE 5C6CA 4C0BA 1KQRA 4AHYA 5CADA 2QE3A 3HR9A 1QOTA 1W8UA 2VMHA 2GC3A 3FX3A 3I8TA 4FQZA 5FUNA 5AFBA 2Y6FA 2A1XA 1SPPB 3JQXA 3TEXA 1F5FA 1AR91 4AI2A 3WNNA 1ST8A 1IS4A 1PO13 3B69A 1D0GA 3KLSA 4QWNA 3E5UA 1S2BA 1J3PA 3D5OA 1HJGA 1OA4A 3O7OA 5C5UA 5KXEA 4KWLA 4A7KA 1CR7A 3OBAA 2ET7A 4CCMA 1W6QA 5H9QA 4L8QA 2VMFA 1WD3A 1XE7A 3DYMA 3ZR5A 3ZM8A 2YSMA 3DDTA 4YBTA 2D6KA 5CKNA 2CT2A 1KRIA 2X05A 1AYM1 5A7WA 3E5XA 4FFIA 5B2GB 3ES4A 3M2MA 4UFIA 2QCSB 4URTA 4YM0A 4EWEA 1WEUA 3O37A 5I3LA 3HBKA 2BOJA 3H3LA 4LA2A 2IWGB 2P34A 3O1TA 5LBFA 1HQWA 4CP9B 5BY5A 2OVUA 4RFT0 4XILA 4XI1A 1CX1A 4NIGA 4Q8LA 3I59A 1ND2B 2PAMA 2XOYA 1AR81 3B3QE 4YVWA 3VDDB 3T3YA 3UGHA 3X29B 2EA7A 2VGDA 1FPN1 1W9WA 1TG7A 1OOPC 2ZX3A 2ECGA 1GICA 1R091 4QX0A 4AP4A 3A21A 3EMRA 2VMIA 5DAXA 2V72A 1WCDJ 1WLTA 4K3UA 2JMDA 4YFWA 1U5YA 4YW5A 2E6RA 4OQ8A 2QQIA 4M00A 1TZOA 1DFQA 1SACA 1YNAA 3N9LA 3RZJA 1HXS2 1JN2P 3ACHA 2GZWA 1V6IA 3WDYA 3AZZA 2BOIA 4CDQB 1V00A 2DFBA 4K1ZA 1O3RA 1TMF2 2TNFA 3WY6A 2CKLA 1RHI1 1ZBA2 2XXZA 3MIFA 4KGQA 2XJUA 4LBQA 2J1UA 3WSOA 5F5IA 1YI7A 5A6XA 5J1XA 3NNLA 1D4M3 2WZR2 3UKVA 3H8OA 2BAYA 2KFTA 1UIJA 1UPSA 3K46A 3VL9A 1O6UA 2MA6A 4DINB 2BVVA 2ATFA 2VOVA 2YBSA 5GZDA 3LD8A 5FYSA 3LEIA 2C2VS 2A3WA 1RUH3 4Q4Y3 1VBE2 4JVAA 2GH2A 4UWDA 4OHXA 3C3VA 4U2AA 5FO7B 2BBVA 4FFGA 1YJLA 1LOCA 3R0RA 1CWPA 3GL6A 5CZKA 1M4WA 4OZOA 3IPVA 5CKQA 2CY6A 2VBPA 5DDJ1 5C8CA 5H9PA 2DU0A 1ZRRA 3T0AA 1MM3A 5LWBA 2XJQA 4XMIA 4L0PA 4EWDA 1NQDA 2EXKA 2WWSA 1YQ8A 4NIIA 2KU3A 1Y9GA 2WN2A 5I0SA 2KGIA 3U14A 3OBZA 5FYHA 3NNGA 3UYJA 2MD7B 4TTGA 2GNBA 1PZ9A 4TKPB 1QJX3 1S0DA 2HWF1 4DB5A 4WZ3B 3NAPA 4S2FA 2Z2SB 1E5SA 4XXAA 2ORZA 2VC9A 1VJ2A 4CEWA 2DFCA 5ACA2 1R081 3HN3A 1RUJ1 2DCJA 3URFA 3UETA 2Y38A 1PO21 4MOAA 4JTOA 3N4MA 4LHKA 3U5PA 2D6MA 2HJIA 3VUOA 3L11A 4B4PA 1RMU3 3CZUA 1S55A 2OKXA 1IS3A 4R8HA 1H8TA 3NMBA 4SLIA 5F5QA 1GLHA 2LQ6A 3WW1A 3ZFFA 2YURA 2AR6A 3KB5A 1ND2C 3H7YA 2NMNA 3AP7A 3GGLA 1XRUA 2IXKA 2W1SA 1NG0A 2ID4A 3JBG2 2P5BA 2VZPA 3L2HA 3R05A 4HN0A 4LHNA 4R9BA 5FZMA 5A3LA 2RDSA 3H8XA 1NT0A 2R063 4IERA 2XL9A 3ON7A 3PUSA 2A6WA 1UU5A 3VBUA 1J1LA 1RUD3 4BCUA 4Z2WA 1JZ3A 3DPRC 3M63A 2Y6LA 3KM5A 5GM0A 3O1RA 1ZM1A 3OYWA 2Z69A 3U10A 3I3DA 4WBBA 5KBFA 2RHPA 1QOSA 4CTEA 1WILA 4CDQC 2QICA 3ATGA 4P9JA 1YCIA 4GWJA 4IV3B 5IVVA 4YC9A 3DV8A 5EIYB 3POIA 5A3NA 4Q4X3 5IVYA 1SLTA 3MFAA 4ZONA 2HDPA 2L9LA 3BYWA 3I3BA 3ZIXA 3KVAA 1AYM2 2HEYF 2X5IA 4YZ1A 3K77A 2UWAA 4Y1YA 5C11A 4AHZA 3RZLA 4GB0A 2VNOA 3AB0A 2W94A 5T52A 5CEHA 2HBUA 1REEA 2KM2A 2X29A 3HEIA 3VD7A 3RG0A 1SLAA 4QX5A 2ZHNA 1FOD1 2DURA 4M4PA 4AVTA 1AR82 3KCXA 3VZMA 5AVPA 2XJSA 1LDJB 2N7GA 4U36A 5GALA 1FPN2 2FMYA 5CKMA 4LOSA 5K0UC 4LT5A 1R092 1T2XA 1CX4A 2PLV3 3RVHA 3M7AA 4JGZB 3EYPA 5FQ0A 2B0OE 1K5JA 4AG4A 4IE5A 3RQ0A 4ZS2A 4RGGA 4ZU7A 4N8MA 1UKGA 1W2TA 5DMYA 1NCQB 3DYOA 2WO1A 3ZYGA 4EJRA 1SFPA 2OIIA 5C9AA 5JDBA 4CCDA 4BQWA 1RUOA 2IFWA 3W21A 2UYBA 4KWUA 3T4HB 5T5LA 2BRTA 1HKDA 3T0BA 1RHI2 3S5AA 4A49A 4XJ8A 1P8JA 5JIAA 2ZMNA 1E5HA 4CXWA 1OXCA 1AXKA 5LASA 5FWEA 2XHNA 3NQHA 3RS6A 4HSLA 5A6YA 1OMIA 4XZUG 4D6SA 4YFZA 2WABA 1GOFA 3MGUA 1CAVB 1NE6A 3MO4A 1ZZCA 3H0OA 2XR4A 4ONUA 1V9U3 2LS6A 2CWMA 4BYYA 4CDUA 3UNPA 3E97A 2WNUC 1VFYA 1NA1B 3WT3A 2AUYA 3FLRA 4M4RA 3T2QA 2RDNA 4QQ2A 2QQVA 3LZZA 5T55A 4ZZ8A 5FEYA 4E4DX 1MQTB 1UQXA 5ABJB 3C7FA 1H2LA 4COVA 2EF6A 4H7MA 5DDJ2 4Y4YA 2C5DA 4MGKE 3AMQA 5D1IA 2BNNA 5A7OA 1ULCA 4AVAA 1YFWA 4AEDA 2EICA 1DBNA 3Q8CA 2XKPA 1VYXA 4A3XA 4GJYA 2VQAA 3OG2A 4XUOA 5JOWA 3NKGA 3O0XA 4URAA 1HDKA 3FL7A 1ODNA 1XNDA 2K46A 4M0NA 3T0DA 4QX7A 3UESA 2HWF2 4FPCA 4LUKA 4QPWA 3L1XA 3EQEA 2JKXA 4XZPA 4K21A 5IFPA 4AQ6A 5K7PA 4DXZA 1R082 1RUJ2 4NPLA 1PO22 1HB1A 3ACIA 3JQWA 3OCPA 4AI8A 1QNWA 3LEKA 3LDYA 3TEZA 2M85A 2XB1A 2YFZA 1UWWA 4KWJA 3U11A 3OF1A 4P9YA 2F6NA 1LOEA 4HVQA 2GNTA 2LUWA 5KC6A 5B8DA 1AX1A 3VBHA 1KEXA 2F42A 2WN3A 1UOJA 3DN7A 2DBIA 4O9GA 1EV13 2A7AA 1N1SA 2EXHA 2A73B 5FZ4A 4E4SA 3KV4A 2I74A 3PIGA 3O0WA 4N9HA 1J84A 2VECA 3NRUA 3SCFA 1GWKA 1NOVA 2ZGKA 3KGZA 3AYAA 2KWNA 3S30A 1JU3A 4RL7A 5FZ0A 3THCA 2ZGLA 1RUI1 3WVJA 3V43A 2A6XA 4QB1A 3O1OA 5JAXA 4B1LA 1ND3C 1C1LA 1QXPA 3RWKX 5IT6A 4KNCA 3PNAA 4PLOA 5FO9B 2YU2A 1OQDA 4Q26A 5LCWB 3S57A 5L36A 4CEYB 4IEVA 4DNYA 5KH3A 2MEV3 5GZEA 2ETEA 2LRPA 4GWNA 5LK7B 3IAPA 3CBNA 3S7EA 3ZYIB 5HV0A 1O8PA 4FTSA 1UZ0A 3C7HA 2HWE1 2J1EA 5GZFA 1UO9A 5JR7B 3THTA 3ZFFC 3ZR6A 4IV1A 3A22A 5FUPA 4CDWC 4EN6B 1N87A 3MPBA 4P9WA 5LKTA 4A42A 5H1UA 3GZAA 3MBWA 3OUJA 4GWMA 3ZFEB 1H2MA 3ZYPA 4JKKA 2KWJA 3RDIA 3LA7A 5T5PA 1S0IA 2E33A 4TWTA 1NA1C 2AH2A 5JXGA 1W9YA 1R64A 3WOGA 1XE8A 4FPJA 1MS0A 5JMCA 1FOD2 3VBOB 1MQTC 1BBT3 1J3QA 1LCLA 4OMDA 4QPIC 1QMJA 4KWKA 5C4WA 2W1UA 2QDRA 1UCXA 3SITA 2FD4A 2KKXA 1QQP3 2AGSA 2KD7A 1Q8SA 2XDVA 2ZGRA 5TABA 5SVXA 1VBD3 1O4TA 2VR4A 4UW3A 4NIDA 1JOJA 3SCGA 3PDQA 3ZXDA 4L58A 1W3VA 4KU7A 5E16A 2Q8EA 1ZNPA 2W87A 3RSJA 1A78A 3FUOA 1JHNA 3KT4A 1AR73 4JGYA 4HETA 4P00B 5EJZB 3WHTA 4XDPA 3USUB 4AGRA 3ST7A 3ZYHA 2JWPA 2MUMA 3RTRB 4NR1A 4RGKA 4NN2A 1PGL1 1GQGA 1BQPA 1WMXA 2DWRA 3K2OA 2OT7A 1UX7A 2D5FA 4LO8A 5A32A 1W6OA 2A70A 2VQUA 4GA9A 1STMA 1ZA4A 2WFF3 4KQ7A 5F3GA 4LLBA 3T9KA 4WZCA 5FMOS 3OBTA 5LCWL 4CXXA 2O8OA 4WZ2A 2R043 4UW5A 1AUYA 1HV0A 1Q8PA 4NIAA 4A4AA 1JZ2A 2XL7A 3IMMA 4N90A 2VJEA 1F9KA 4CU7A 2YQMA 4XF0A 1W8HA 4ZXEA 4IEZA 2VXRA 4AZZA 3FFZA 4L99A 4AEJA 1UPIA 1QDOA 4Q4W1 2FHRA 1XYNA 1WLDA 2OYZA 3DL3A 5JR2A 4HKOA 1SHWB 4A6SA 1U12A 1YFUA 3N9NA 5FZHA 2VOWA 3LFIA 3M1HA 4TLFA 1UY2A 4FFFA 5GJ6A 4CP0A 5BNNB 1K3IA 5FMCA 4H2AA 5FZ9A 3ZXGA 5I8YA 1JM7B 1GFF2 4QPGB 2HWC3 3EB5A 1TE1B 3IHPA 2WQ8A 1IOAA 1W03A 4CDUC 4MGIE 4MSVA 4D6QA 1OA2A 2VZOA 4RQPB 2A6YA 1LECA 5IYYA 3DWDA 1WMDA 3JUEA 3OUHA 5LKUA 2D93A 2ZAHA 3ZX7A 3E6BA 3IAQA 3N9PA 5BNOC 4CRQA 3I3EA 1ZA7A 1O4ZA 2RS13 4R4ZA 4XCAA 5FR3A 1D7PM 5DAQA 4QB6A 1CIWA 2XGXA 2DVBA 2R0HA 3N9MA 5FPXA 1RUI2 1LODA 1JYTA 2BDRA 1EAH3 2QQKA 1O91A 1JW6A 1Y43B 2KWKA 1W0PA 2YY1A 3TEWA 1QDCA 3RJRA 5I0UA 1H6YA 3LGRA 2L75A 1S2EA 2Q4SA 4WM7B 2W46A 3RWNA 5AVAA 4CA9A 3ELNA 3PU8A 3ASLA 5D1KB 2G9FA 3EJKA 1H4GA 1RUH1 3CF6E 1BVP1 4BQXA 1WESA 2K9ZA 3QH7A 3WG2A 4QQLA 5FIXA 3POJA 4N53B 2XJVA 1LOFC 1W28A 1QNYA 1LOBA 4FVVA 4A45A 4GH4A 1RC6A 2NLRA 1RUG2 1WW6A 3UGGA 3VDCA 3M7KA 5F5AA 1VRH3 2JE7A 1HJFA 2EGMA 4LO6B 2DF7A 2YZ4A 2MD8C 1UXZA 4HFSA 3PL0A 2Q1ZB 4QX3A 1WEMA 4ZS3A 3ABZA 4DS0A 1MEC3 3AK0A 5FO8B 2DCTA 2V5YA 4XTMA 5J36A 4GKYA 5H1VA 1C3HA 1VBC3 1ZZ9A 4Q2FA 1H9PA 2AYHA 2ADEA 3KNVA 5E89A 3LA2A 5I8SA 4E9KA 1ZRFA 2PHXA 3AXEA 5EYYA 3IDAA 3T1LA 2P17A 4XQ4A 4EN9B 2C0ZA 3RYPA 5JZGC 3BUCA 4N9IA 1O3TA 3TNPB 3I97A 2K2SA 4K9SA 4LUMA 4S3OC 2HEVF 1L7LA 1R1A3 2JG8B 3ZVXA 1OFSA 1RMU1 2BNOA 2JB8A 2PHRA 2W92A 4ZU4A 4EYUA 4GNEA 2VCBA 4YW4A 2VVFA 4ITCA 5CVRA 4YABA 4LHLA 1H0BA 1IYMA 1PGL2 3ZNIA 3MV11 4IGQA 2R7EB 1XB9A 1ULEA 5JPNB 1C8M1 4RQPC 4D94A 2WZ8A 1GOGA 2YBPA 2YVRA 4UT5A 2YG0A 3IM0A 2XJPA 2WNVC 3WCRA 4AGVA 4A7YA 3IB3A 1LTEA 2PMWB 1PVC1 2JKBA 2VD7A 1AR63 1G8WA 5LY2A 3LPFA 1WIMA 4Q1RA 2CGOA 3I2IA 4IGPA 2ECVA 2BGCA 4PBPA 1HRI3 2C24A 4XE9A 2KXLA 2WS92 3AZVA 3NJZA 2DCYA 4HANA 4Q4W2 2VO5A 4Q4X1 4DY3A 3VHPA 1A8MA 4MXWB 5BXXA 4OHWA 5CYYA 5T3NA 3ZMOA 3LIHA 3ASIA 4K1YA 2W39A 2A3XA 4P02B 5L7OA 1RXFA 5LW9A 2D5HA 3GBWA 2OWAA 2UY8A 1UMIA 2BW8A 2FDGA 1UNBA 1GZ9A 2J1VA 3AVSA 4IEWA 3CJXA 4QU1A 3NNFA 2BEOA 4AFCA 4CUGA 5HCHA 3AP6A 1F31A 4A3ZA 2PHFA 4UBGA 4XURA 1DG6A 3VBRA 1QJZA 1UMHA 4FXKB 1OPOA 3T08A 5IVEA 1VRBA 1K5MC 4LBOA 2ECNA 3H7JA 3K4AA 4XFFA 1BLZA 4B3NA 3ES1A 5LZ6A 1IQDC 5FYVA 2QQNA 2W2IA 3MW2A 4J25A 3ZKUA 1KFXL 3WDXA 3SQOA 3M8LA 2PLV1 3SISA 5FMOL 2Z5WA 3GBGA 4N4FA 3HNBM 4DFSA 4YZ4A 1KDMA 5SVIA 3FZ3A 3BU0A 4AVCA 2BERA 4RYDA 4LJHA 3BTAA 1ACCA 1PNGA 1GNYA 2W95A 3DQVR 1PK6B 3OJBA 4LLOA 1W8FA 1QWRA 2Y64A 3CQOA 2ARBA 2VOKA 4O9EA 4Q27A 4E4ZA 2L80A 3O47A 1POV3 4KBBA 3JZVA 2VJFB 5HPOA 2ZHLA 1QOOA 3NVCA 4QM9A 4WM8A 4COYA 3HD8B 3JUUA 3VB9A 2H0DB 1OA3A 4AQTA 1D4VB 2ES3A 1PX3A 3POWA 2XOZA 2VZ3A 1RUH2 4W6YA 3C5KA 4RA0A 3JXSA 4YG3A 2ZTNA 4N7UA 1U5ZA 1NCRA 3VBSA 4CYDA 2BTVC 1VIWB 5EP9A 2JG9A 4O61A 5B78A 1CAWA 3WDUA 5FMDA 2R071 4L9BA 3UK9A 1Q8OA 1B35B 5IVJA 3U75A 2GN7A 1IG3A 4OUEA 3T30A 2XJRA 3NWKA 2GP5A 3KDEC 2NM1A 2VCAA 2WT2A 3GJAA 1BJQA 4J1XA 4COUA 1WW5A 4XJWA 1BEV3 5DN2A 3IMNA 4H14A 1V6JA 2V4AA 3VZOA 3SNMA 3VBFB 2Q8DA 3KZ4C 4P5YA 5JPMB 3E6CC 4QHZA 4YPJA 5C33A 3FE5A 4NE9A 1AHSA 1C5IA 2VZVA 3KT7A 2BGPA 4J6GA 1OBNA 2BYVE 3AP4A 3WQ7A 4YM2A 1VB4A 4GH4C 4QQPA 3ZN6B 1OT5A 3NKTA 3B7MA 3KV5A 2NP0A 1EV11 1WEWA 3N7LA 4XJZA 3OD4A 2YU1A 1NLSA 2OPWA 1C8M2 1UIKA 1C5HA 3WCSA 2HYED 1VB2A 5AITA 3AZWA 2GN3A 4RHV3 4RR3A 1PVXA 2QVSB 2JM3A 1OD3A 2VW0A 3N3HA 4UBHA 1SLCA 2ZHKA 5FP3A 1JZ8A 3AFGA 4RS5A 4BMBA 1PVC2 4HPKB 1FV2A 5FY4A 2QQMA 5IUQA 5JXJA 1U5IA 2Y1MA 4N43C 1AJOA
chains in the Genus database with same CATH topology
1QJU3 4KH9A 5J3UA 3SH5A 1QXRA 1MVQA 2MEV1 5DKAA 1N3OA 3B5LB 4Q4V3 1ENSA 4LA3A 1I3HA 4Q4X2 3Q9OA 1DYKA 4Z8BA 3ZO0B 2YREA 4Q29A 1JYCA 3V64A 4OUSA 2PAEA 3J8F3 2JXAA 5LEKA 5JG6A 1LHUA 3H8UA 3VZNA 1GZWB 3E5QA 3CJIC 4H7LA 4YZ5A 1JH5A 4LADB 1OOPB 3BALA 4KGGA 4WVZA 3H3UA 1C28A 3OBRA 3TYJA 1WBLA 4A4CA 1BBT1 1FBVA 4JTNA 3WG1A 1TME3 4R9AA 1QQP1 4CDXC 2PLV2 1MS8A 3IKWA 4DMIA 2P2KA 1R1ZA 2R0FA 1AR71 2E7AA 3CLPA 5BNPA 2C1FA 3W9AA 2R32A 3OTFA 2Q8OA 1REDA 3LAGA 4HK8A 4S2DA 1JYIA 5KHIA 4K7JA 3A0NA 3FC0A 1UL9A 3JU9A 2ZZJA 1PIV3 2HWD3 3MLKA 3VDDA 3VBRC 4UW6A 4HSJA 4GNGA 4L2NA 4HL0A 4D69A 2WFF1 1MS1A 5FAXA 1RB8G 4YADA 3LKJA 5D8AC 4XBQA 4B8EA 4Q0UA 2PAKA 5KXBA 3L9JT 5CFCC 3MFCA 5T5OA 3ZFGC 1W6PB 2PA7A 4AUQB 2E51A 2NMOA 4JV4A 5J48A 1CVNA 5JCTA 2R072 4QHBA 5T50A 3JCIA 3PVNA 4BPZA 4WVMB 5AIUA 1YXWA 3VKLA 1FI2A 3FBYA 4Y22A 1SFYA 4PDWB 2HWB1 2EXJA 2EVXA 4A4BA 3TAYA 1UKRA 4PJYA 1S2KA 4CP2A 1WA4A 4AYCA 1AJKA 4S2GA 3WQ0A 2D6LX 1HYJA 1V70A 2Y0OA 4R4XA 1O3SA 4Z82A 3W58A 4D7SA 3VKFC 5JIUA 1CD3G 1OSGA 4I7CA 1EV12 3WZ1A 3DPRB 2RS11 1FX5A 4YARA 3MIHA 1N47A 4AVSA 2CWSA 1Y9QA 1DZQA 2XKOA 2RR13 4E2QA 2D6NA 3AP5A 2GC1A 2XG3A 2DV9A 3ZSEA 5BYNA 1RUE1 5DUWA 2P3JA 3OY8A 1AYN3 5HCAA 3ZN5A 4P5OB 2DVFA 4QXKA 3GHNA 2MEV2 5CAZA 3U5OA 5JOZA 2PFWA 4GMP3 2Q1MA 5I0RA 1G9CA 2OZ6A 1NZCA 1S0JA 2VPDA 1DQ0A 5LRSA 1Z7S3 2G4IA 4IEPA 4AF9A 3B02A 1VRH1 1W6QB 1N3QA 5K0UB 4YG6A 4YYOA 3UJOA 1ZREA 3VHRA 1HRV3 3HCTA 1AX0A 5J3XA 4RS5C 3TN93 1MEC1 3WLUA 4F52B 4IV3A 2Z42A 5FFOC 4BLIA 1VBC1 2O1QA 1QQP2 3H50A 1YIPA 3RI8A 4Z07A 5CIRA 3BIWE 2XLGA 2ZGNA 4FAHA 3WDTA 4AVVA 1LKNA 2PN5A 1AXZA 1IGOA 1DU3D 1R1A1 2O0OA 2ZX1A 3LB9A 4PDWC 4MVTA 1AR72 2EIGA 1X4UA 1CQ9A 4P9XA 3I59B 3J4UH 1RUC1 4AI3A 4FPGA 1WLWA 2MPFA 5K9YA 3IDCB 2XVKA 2AN6A 3PURA 2WNUB 2E9QA 1U0AA 2DCKA 4IESA 4LBKA 4QMAA 4R52A 4JGZA 4AW7A 1OQ1A 1AR92 3R4UA 1GYKA 1NCQA 1AR61 1ALYA 2UZGA 2YYOA 5CFDA 4SBVA 2JX9A 4LBQB 4L7XA 5KXDA 1WCKA 3WV6A 2ZZQA 1H1AA 4XHXA 5EJ3A 1E4UA 3ZTGA 3B00A 4LO7A 2QJ0A 4XQDA 4BIOA 1MZFA 3PJQA 5FLIA 4Y1XA 4QGMA 1JXNA 3L2YA 2IFRA 3GYDA 1CAVA 1VBB3 2HWB2 5EFUA 2ZHMA 4R7EA 5DINA 1LGNA 5C8CB 4F3JA 5ABJA 1V6MA 1YI9A 2EAAA 4YGBA 5F6LB 1DLLA 3RMYA 3ZXLA 3ZN4A 4YW2A 3M99A 3QLQA 1X33A 1S0EA 3LRQA 2GALA 2RS53 2GDFA 5IK5A 4BLJA 3PVOA 1RITA 2ZGTA 3AYEA 2QJVA 4E2SA 2OW4A 1A3KA 4ZU5A 5K7PA 1YJKA 1ND3B 2RS12 4FT8A 2XHKA 2LTNA 1ULDA 2WL1A 1KXGA 2CYFA 3RNSA 1GNZA 3HMYA 2OA2A 1COV1 2XBO3 3V56A 4BIFA 1YLLA 1RUE2 1ZYBA 4A0CD 4LO5B 5FOJB 3ZFFB 2QKDA 1Z0HA 4CDWB 1MACA 4BZ4A 1UD1A 4YVWC 3HCSA 2CV6A 4YVSA 4B86C 4FTEA 4V3LC 1QJY1 1W2UA 1FMD3 4FPFA 3USSA 1IZ3A 4HLTA 4DOUA 4QPIB 3GNEA 2K4DA 3ZXJA 3KCYA 2L5UA 4ISQA 1VRH2 2LGLA 1G9FA 1V6NA 4MYEA 2ZMKA 1GKBA 4H55A 4CEYA 1W0OA 2D40A 2VQ0A 1BEV1 1DIWA 1HQNA 1VBC2 2KWJA 3O14A 5LKZA 3AP9A 4ZXKA 3SHRA 5TDRA 5FPZA 1PMIA 2NYYA 5GLWA 3ZSMA 2F6JA 2DUQA 1PHMA 5GZCA 5J09A 4I09A 1HW5A 3JB8A 2V73A 1R1A2 1LOAA 3L1ZB 1OLQA 4KL1A 1NQJA 2DVGA 2KREA 3JD71 1LB2A 4W6WA 1RUF1 3W59A 1RUC2 2K0GA 5C8CC 2CTVA 4HT1T 1JOCA 3VKNA 4G3YC 3VBOA 1WMEA 2ILMA 3ROUA 1APNA 1WE9A 2XH6A 3GF6A 1ZZ8A 4RHV1 3J26N 5AC91 1W6NB 1HYIA 3NAPC 4CEWC 1CGPA 3O70A 1WW4A 1AR62 1VBA1 5GLTA 2FUIA 2YHOA 1QJU1 4FOYA 4LLFA 4D3WA 2GMMA 4Q4V1 4PPEA 3LQIA 5K8SA 4N3WA 1H8TC 3J8F1 5GLUA 4CDUB 3C2UA 4GULA 4FOVA 1HXS3 1MZ5A 1V6LA 2ZOEB 4OI4A 5KHHA 3N35A 5KHKA 3WDVA 3IIAA 5DUUA 1IQAA 2OUJA 4YLZA 5CB7A 1TMF3 1IPKA 4EN0A 4C0HA 3C6WA 1ZBA3 5HCFA 1LGCA 5BNOB 1A6CA 3VBUC 1CN1A 1DF0A 3LSDA 4L97A 4X3GA 4W65A 1TME1 5CFDC 2ZX2A 4GB31 2LGGA 2ENRA 3QZVA 2CAVA 4F8AA 1ENQA 4P14A 1NYWA 2YUEA 3UKNA 4XJAA 4DPNA 2XPJA 2M3HA 4YATA 3CL1A 1JM7A 2X5IC 2YW8A 1H1IA 4L92A 1ZBE1 4QPGA 5FLJA 1QXJA 2A3YA 4LR4A 3APBA 1PIV1 1LHOA 1COV2 2JJ6A 3VKOA 2B39A 4M3CB 1CONA 3IBMA 5GKAC 1BXHA 1I6XA 1PO11 4IXLA 2C2LA 1G7YA 4FPLA 2OUHA 2RM23 1F8VA 2WLQA 5L19A 5B77A 1QJY2 1XNCA 3EO6A 1SDWA 3M3QA 4HBNA 2UU8A 5J96B 3QH6A 5C9AC 4TZDA 1HIXA 2D97A 4MLOA 4FCAA 2FSAA 4YAXA 3N7KA 3M70A 3LOIA 4WM7A 5JZGB 2LV9A 3IN9A 2E53A 1G9BA 4S3OB 1FXZA 3JBG3 2EALA 3LSEA 1BEV2 3AZYA 2WSVA 4R9CA 3AKQA 3OGGA 2ZA9A 5L73A 4YVSC 4F83A 1YIFA 3POYA 4N53A 1NLRA 2D44A 3AKPA 4AFDA 2VW1A 1NXMA 2E6SA 4FQ4A 2BUKA 1X8MA 3ZYJB 3AMPA 2UYAA 3M3IA 2H0BA 2W52A 3T6RA 2WNVB 3JD72 1FNZA 1RUF2 2WT1A 1QH7A 5I91A 3SCHA 1AYM3 4ATEA 4AEDC 1HLCA 5CNAA 3WW4A 3V0AB 2Y43A 1AL23 2NZ9A 1WMFA 4RHV2 4JGYB 4E2GA 5AC92 4DY5A 1X7NA 1FNYA 2JG8A 2QZ2A 1AYN1 2B7YA 2HEWF 4WA6A 1RGSA 1VBA2 1D2SA 1D4M1 5EXOA 1QJU2 1FPN3 2JECA 4Q4V2 3TRSB 2ZX4A 1VAKA 4Q4Y1 3RYRA 4XEZA 3UL2A 3H1YA 3JB4C 2RS33 3VBHC 5H1TA 1HX6A 1K5MB 2XWBB 1QHDA 2XJTA 2HWE2 2NQYA 1Z7S1 5A3MA 3P3NA 2ZCWA 2NPIA 2WKKA 1OHFA 2DX8A 3HIFA 2R30A 3FLTA 4MXVA 1HRV1 4BA6A 3T7LA 2WQZC 4XIKA 4R2YA 1WEEA 4XFAA 3DKWA 3O35A 2JD4A 2ZGQA 1TME2 2ZGOA 4GB32 4C1WA 2UURA 1QJX1 4MXWA 1GBGA 1VBA3 4QM8A 5FTTC 3S6PA 3UJQA 3RJ2X 5B75A 2H6CA 1LULA 4BHWA 1Q56A 2XLFA 1PGW1 2Q5TA 2IDAA 5C8WA 1N1YA 3M3CA 4NHKA 3VGIA 2MNZA 4IV1C 3GBFA 1ZBE2 4MUVA 1MM2A 3RYKA 3G6JB 3D6EA 2SBAA 5GLZA 1VD4A 1PIV2 4YZ2A 2WA3A 1SFNA 4HMZA 3AFKA 4MZUA 4Y5Z0 4AI1A 1CAUB 3MW3A 4V3KC 1QH6A 4ZUXU 2L0BA 4JC1A 3OPZA 2Q0AA 4K40A 2R061 3KQRA 1PO12 4XFCA 3WP6A 5C4WC 4YM1A 4FP3A 5EWSA 3H9AA 1LEDA 1RUD1 2LM3A 5TSWA 1UZZA 1J3RA 1PO23 1PK6A 2GNDA 2WQ4A 3DUIA 5FLHA 4YBSA 1CAXA 1KJLA 5JI9A 1KS4A 1F2NA 3N7JA 3O0VA 2ECIA 2UWCA 3H1MA 1FATA 4K6BA 4JGYC 2IXCA 1RL3A 3V0BB 2H0DA 5FB0A 1BMV1 3CO2A 2BWCA 1O5UA 3DGTA 3B93A 2EAKA 1VBB1 2E6VA 1DGRA 4BBQA 4E27A 3PJYA 2AREA 4GH4B 5LRRA 5F1RA 3OD0A 1IPJA 2LRIC 1LU1A 4XF1A 2ZETC 5JSRA 5J98B 3O7AA 1V6OA 3B9IA 3A4UA 1J58A 1IKPA 1B35A 2BVBA 4YRDA 1LHNA 4Q0PA 2RS51 3AKSA 5G0FA 2ET1A 4GKXA 4COWA 4Q6FA 2GMEA 4YBMA 2PTMA 3MIGA 3KCCA 3SOWA 4Y1ZA 3TWIA 1OPMA 4XF4A 3RI9A 1MS3A 1G86A 2RE9A 4N43B 5EYXA 3VBFA 2WSUA 2YPJA 2XBO1 2W68A 2VW2A 4FPEA 1AYN2 2Y1NA 3VV1A 1BVVA 1FOD3 1D4M2 3ZN6A 3N36A 3ZSKA 4AXOA 3U5NA 1DZRA 3CJIB 4FSJA 3SXWA 4Q4Y2 1V9U1 2C9AA 2YXSA 3NV2A 2EA6A 4PQ9A 1IS6A 4Y20A 1VLNA 2B9UA 1DHKB 3B9CA 1WBFA 3NL1A 2DVDA 1DGRN 3T1MA 5J7MA 1VAMA 1Q8QA 1ONAA 4CDXB 1CESA 3ZXAC 5TDWA 4XFGA 4ZQLA 1I9RA 4XDQA 4HPKA 3WHUA 5HI0A 1UN1A 3FMGA 1UMZA 2OZJA 1A8DA 1GQHA 4XF3A 3D0SA 3AKTA 1G9AA 4AK3A 1URXA 4YW3A 2K1JA 2ECTA 4Q0QA 1QJX2 2RI7A 4JDNA 3TB0A 2DTWA 4R8PK 4Y1VA 3LQHA 2HYKA 1GZWA 4JRLA 1FV3A 2SLIA 1UU6A 3IWZA 3VBRB 1V87A 4IETA 4QQHA 1PGW2 2VUAA 3SOXA 1OOPA 3UV9A 1RMU2 1AL0G 1G6NA 5FCCA 5D8AB 5G05B 2BNMA 4B7EA 2YSJA 5CFCB 2BWAA 4MX3A 4D7YA 3B94A 4OI0A 2F4PA 4MV2A 2ZGSA 2YC0A 3ZFGB 2WC2A 4OLLA 2QZ3A 4BHPA 2R062 1Q8VA 3GZTB 4PIXA 1DZTA 4B7KA 2CSYA 1PZ7A 2JICA 2YDEA 4INDA 4JDMA 1RUD2 1EP0A 3KGLA 3ZPYA 4I2OA 3KS7A 2YQLA 3PHDA 2YV8A 1SMVA 2KA3A 4KU8A 4AHXA 4YNIA 5DUXA 4QF3A 2B5HA 4GALA 2QFEA 2A75A 2D3PA 2PQQA 4XQWA 3FJSA 4QGLA 2ZGUA 2JRJA 1W39A 3IDBB 4IC2A 3V65A 3WX5A 1XYPA 4PIYA 2VPVA 3MW4A 1VBB2 2VPEA 1MZEA 3O34A 2JG9B 2E63A 1CAWB 1ZBA1 1QGLA 4P5HA 3TOJA 4WZFA 4O64A 5EV7A 2VH9A 4I02A 1SCRA 2HKXA 3LA3A 3SHBA 4FPOB 1BCXA 4JRAA 4PLMA 4WVMA 3AMHA 4XFIA 1LR5A 3MI8A 2RS52 1VR3A 4ZKTB 1VBD1 4AFMA 3FHIB 1RIRA 4NN0A 5I0TA 3FWEA 4XJUA 4K20A 1WLCA 4Q0SA 4AEKA 1SEFA 3BPZA 4ES9A 4R9DA 2LN0A 1Q5OA 3MICA 5L7OC 2M6MA 4M01A 4BOWA 2XVLA 1RUG3 1SLIA 3VHOA 3AMNA 1XWHA 2XBO2 3ZYQA 3BOPA 1H30A 1ND2A 1WW7A 3ENRA 4I0BA 4UP5A 4XW3A 4OHYA 1YFYA 4IEOA 4IQPA 3FFQA 2I45A 1EPWA 1YWKA 2RM21 1N1TA 2BFUS 3D8CA 4IEXA 1V9U2 2R041 2ECWA 5FOBB 2XB6C 1S0GA 4OZXA 4XOGA 3MDPA 2RJKA 2I2SA 3AM2A 4CDQA 5B76A 4RS5B 1F5JA 4PIZA 4BM8A 3HWJA 2LXPC 2VPGA 2GNMA 1GANA 2MHFA 3MLJA 4FXGB 3VZLA 5KHGA 3AJYA 2DUPA 3JBG1 4ZDTA 4XFHA 2FZ1A 2L43A 4XF9A 1MR5A 1ZBDB 1RVF3 4WM8C 2M1RA 4NOTA 3GALA 5LK5A 4FP2A 3CU7A 1CHCA 2HWC1 3PUQA 4LBMA 2VU9A 2O8QA 4LULA 3VBSC 1NCRC 1LGBA 3NSTA 5K0UA 5C13A 4OI2A 2JG9C 4YGCA 4Q4W3 2WS93 5D1LB 2FMDA 4I0WB 3ZVYA 4XXPA 4WVVA 2CSZA 1UZYA 4P9LA 3QD6A 1AL21 3U07A 4B7YC 1W6MB 2QDNA 5FB1A 3U0ZA 5A33B 1H4HA 5BNPB 4OULA 1WGPA 3B01A 1RTVA 1EAH1 4LE4A 3T2TA 2WNEA 3CEWA 3RPQA 4NWWA 3VHNA 4COZA 3UKTA 3KQIA 2DUOA 2K16A 2WNUA 1WEQA 1PGSA 3PMEA 2RS31 2RSDA 1GNHA 4LEJA 1FT9A 4AEMA 3ACLA 4AFBA 1BZWA 1Z2QA 3KNVA 1S0BA 3KSCA 1MVEA 2KIZA 4FBFA 1Z6UA 2G45A 1LJ7A 2D7FA 4M3CF 4KG8A 4MSXA 4GXLA 4RR3C 2FQPA 3VHPA 1IS5A 1NE4A 1RJ7A 2ERFA 3M4FA 4LO4B 1BBT2 2UWBA 1DGWX 1LDKC 2MIQA 3TNQA 4FK5A 4Y22B 3AYDA 4LE3A 1BYHA 1POV0 3ZXFA 4EN7B 1VBD2 3KT1A 3WW2A 1O4YA 2D8SA 2JENA 3H3ZA 1S0CA 1WD4A 3MF9A 2JMJA 4GIQA 5JI7A 5SV8A 3FL2A 4AYCB 2DTYA 5FRAA 1OI6A 4YM3A 4YVWB 2EXIA 4FO9A 4Y24A 4AVBA 2KE1A 2ARXA 1KS5A 2PHLA 2PELA 3VZKA 2ZACA 1WUVA 1CPNA 4X6QB 4X8PA 2JDZA 2WFF2 3P3PA 1OQEA 1SQ4A 3HBZA 4XETA 4IEQA 2YROA 3CNAA 2RM22 1ND3A 3PVEA 2R042 1TQ5A 4UW4A 2R16A 2CKLB 1MS9A 2ZX0A 3WP3A 1U6GB 5KXCA 3OY8B 4L11A 1ULGA 5FREA 2TUNA 2RMU3 1HRI1 3FLPA 1XU2A 3R6SA 1MS5A 5BNPC