1WEEA

Solution structure of phd domain in phd finger family protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
GSSGSSGMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in PHD finger family protein
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords PHD finger family protein
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weeA00
4YATA 1LDJB 3DPLR 3V43A 3LQJA 2M3HA 3QZVA 2CSYA 5TRBA 1WEOA 2M6MA 3MHHA 1LDKC 3L1XA 4O64A 2L80A 5EYAF 2HDPA 1FP0A 2YURA 3ZVYA 3O33A 3RPGB 1Z6UA 4FJCA 4W4UA 3HTKC 5FEYA 3LRQA 4WZ3B 2ZETC 5H1VA 3ZVZB 2UZGA 3MHSA 2VNFA 2FSAA 5LCWB 2C2LA 5FB0A 2G45A 2Y43A 1E4UA 3SOXA 3DQVR 4WZ2A 3KV6A 1V87A 3O37A 4A49A 5FB1A 5AITA 2G6QA 5AIUA 2RI7A 4AUQB 3N9MA 2L0BA 3O70A 2QIZA 4Q6FA 2H0DB 4YBMA 5KH3A 5B79A 2LRIC 4QF3A 3C6WA 2KE1A 2KREA 4LKAA 4LADB 1WEQA 2LV9A 2L75A 1HYJA 1N87A 5C11A 2VJEA 1CHCA 1F62A 2ECNA 5TBNA 3U5NA 2H0DA 5LKTA 3ZPV1 5FERA 2DX8A 3I2DA 2L43A 3PHDA 4YABA 2PNXA 3C5KA 4WZ0A 4A4CA 4IC3A 1XWHA 2MD7B 2K17A 2KR4A 4GNFA 4GNEA 2QJ0A 5H1UA 2YUCA 3U5OA 5KH7A 2CKLA 2ECVA 2LDRA 4LLBA 4S3OB 2YT5A 4YADA 1WEEA 2K4DA 4A0CD 5B8DA 3U5PA 2XEUA 3ZTGA 2F6NA 2JMIA 3KQIA 4I7BA 2M85A 4UP0A 2CKLB 1WENA 3KNVA 1VD4A 1WEMA 5G04B 2AN6A 2K1JA 4N3WA 4YAXA 1JOCA 3SHBA 2ECGA 2F6JA 3HCSA 2ECJA 3HCTA 4CCGX 4L7XA 2YHNA 4I7DA 2EODA 2YYRA 2RSDA 4AVXA 1K2FA 3T6RA 1X4JA 2OXQC 2MIQA 3HCUA 5I3LA 3ZPVE 2YU4A 2KGIA 4MVTA 3VK6A 4YBSA 5D1MB 1U6GB 2VJFA 4V3KC 1X4UA 2ECWA 4GB0A 2F42A 4S3OC 1X4IA 2VPDA 1WFKA 2M1RA 2FUUA 2KWJA 5LKZA 5G05B 5DKAA 4YBTA 2CT2A 4L58A 2MT5A 1WEWA 5H1TA 2VPGA 4ZDTA 3N9OA 4X3GA 4YC9A 5B76A 1MM2A 2K16A 1MM3A 3PUQA 1Z60A 1JM7A 2JRJA 4IC2A 5KH9A 2KGGA 2VJEB 4I7CA 1WEVA 3GV4A 2JMDA 2HYED 5JG6A 3LQHA 2MNZA 4AYCB 4R7EA 2YREA 3O34A 2Y1MA 2KFTA 2CSZA 2MA6A 4B7YC 1WIMA 2ECIA 1VYXA 3ZNIA 1Z2QA 5TDWA 1T1HA 2FUIA 4BBQA 2LN0A 2MUMA 5H9MA 5TABA 5G0FA 2MD8C 2ECTA 2JMJA 3N9LA 3RPGC 5D1KB 4N4FA 5DINA 2KU3A 4B86C 2E6SA 1WEPA 2E6RA 3N9QA 2LXPC 2QICA 3RTRB 2MA5A 1WILA 4F52B 3PURA 4CA1A 2KWNA 3L11A 3ASLA 4LK9A 2I50A 4UP5A 4PTBA 2LGVA 3LQIA 2NAAA 1BORA 1FBVA 3IHPA 4R2YA 4FIPA 4FK5A 1ZBDB 5C13A 2IDAA 2MNYA 4GNGA 4PPEA 4C9ZA 4WA6A 1IYMA 4GNDA 2VPBA 2YSJA 1WESA 3M62A 2LXHC 2PUYA 2LGLA 2VJFB 2EGPA 4R8PK 3O36A 3U5MA 2LGKA 3EB5A 3ZYQA 1RMDA 2C2VS 2LQ6A 4V3LC 4BHWA 1WE9A 2Y1NA 2KWKA 2VP7A 4P5OB 3FL2A 2KIZA 2YSMA 5LKUA 2YQMA 4AYCA 5LKXA 4FO9A 3NG2A 4A4BA 3O7AA 5B77A 3GL6A 1G25A 4AP4A 2YQLA 5B75A 2KWOA 3M63A 3EB6A 4NN2A 3SOWA 2XB1A 3SOUA 2VPEA 4XI1A 3T7LA 4ZQLA 2KYUA 5B78A 2BAYA 5J3XA 2G43A 2D8SA 2EA6A 4LJNA 1VFYA 2LGGA 3N9PA 1JM7B 4QF2A 1WEUA 4UI9B 1HYIA 4MSXA 4ZUXU 3KV5A 1DVPA 3L1ZB 3N9NA 3O35A 2YHOA 3M99A 2L5UA 4TKPB 2YW8A 1WGMA 5TDRA 5D1LB
chains in the Genus database with same CATH superfamily
4YATA 1LDJB 3DPLR 3V43A 3LQJA 3SUBA 2E61A 2M3HA 3QZVA 2CSYA 2YVRA 5TRBA 1WEOA 2M6MA 3MHHA 1LDKC 3L1XA 4QQ4A 2JUNA 4O64A 2L80A 5EYAF 2OWAA 2HDPA 3FJUB 2FFWA 1FP0A 2YURA 3ZVYA 3O33A 3RPGB 1Z6UA 4FJCA 4W4UA 3HTKC 5FEYA 3LRQA 4WZ3B 2ZETC 5H1VA 3ZVZB 2UZGA 4H9DA 3MHSA 2VNFA 2FSAA 2KKYA 3O47A 5LCWB 2C2LA 5FB0A 2G45A 2Y43A 1E4UA 3SOXA 3DQVR 4WZ2A 3KV6A 1V87A 3O37A 4A49A 2JM3A 5FB1A 5AITA 2G6QA 2XOYA 5AIUA 3LDYA 2RI7A 4AUQB 3N9MA 2L0BA 3O70A 2QIZA 4Q6FA 2LAUA 2MKEA 2H0DB 4YBMA 5KH3A 5B79A 2LRIC 4QF3A 3C6WA 2KE1A 2KREA 4LKAA 4LADB 1WEQA 2LV9A 2L75A 1HYJA 1N87A 5C11A 2VJEA 1CHCA 1F62A 2ECNA 5TBNA 3U5NA 2H0DA 5LKTA 3ZPV1 3KDEC 5FERA 2DX8A 3I2DA 2L43A 3PHDA 4YABA 2PNXA 3C5KA 4WZ0A 3FAOA 4A4CA 4IC3A 1XWHA 2MD7B 2K17A 2KR4A 5K3QA 4GNFA 4GNEA 2CRRA 2QJ0A 5H1UA 2YUCA 3U5OA 3Q1DA 5KH7A 2CKLA 2ECVA 2LDRA 4LLBA 4S3OB 2YT5A 4YADA 1WEEA 2K4DA 4A0CD 5B8DA 3U5PA 2XEUA 3ZTGA 2F6NA 1MBMA 2KKXA 2JMIA 3KQIA 4I7BA 2IQJA 2M85A 4UP0A 2CKLB 3FANA 1WENA 3T9KA 3FEHA 3KNVA 1VD4A 1WEMA 5G04B 2AN6A 2K1JA 4N3WA 4YAXA 1JOCA 3SHBA 2ECGA 2F6JA 3HCSA 2ECJA 3HCTA 4CCGX 4L7XA 2YHNA 4I7DA 3LVRE 2EODA 2P57A 2YYRA 2RSDA 5SVYA 4AVXA 1K2FA 4F1PA 3T6RA 1X4JA 2OXQC 2MIQA 2B0OE 3HCUA 5I3LA 3ZPVE 1DCQA 2YU4A 5SVXA 2KGIA 4MVTA 3VK6A 5D1MB 3LJUX 1U6GB 4YBSA 2VJFA 4V3KC 1X4UA 2ECWA 4GB0A 2F42A 4S3OC 1X4IA 2VPDA 1WFKA 3DDTA 2M1RA 2FD4A 2FUUA 2KWJA 5LKZA 5G05B 5DKAA 4YBTA 2DSMA 2CT2A 3FM8C 4L58A 2MT5A 2XP0A 1WEWA 5H1TA 2VPGA 4ZDTA 3N9OA 4X3GA 4YC9A 5B76A 4Z0OA 2CONA 1MM2A 2K16A 1MM3A 2EGMA 3PUQA 2XOZA 1Z60A 1JM7A 2JRJA 4IC2A 5KH9A 2KGGA 2RR4A 2VJEB 4I7CA 4OGCA 1WEVA 3GV4A 2JMDA 2HYED 3MDBC 2XOCA 5JG6A 3LQHA 2MNZA 4AYCB 3LVQE 2D8UA 4R7EA 2YREA 3O34A 5SVIA 2Y1MA 2KFTA 2CSZA 2MA6A 4B7YC 1WIMA 2ECIA 1VYXA 3ZNIA 1Z2QA 5TDWA 1T1HA 2FUIA 4BBQA 2LN0A 2MUMA 5H9MA 5TABA 3JUEA 5G0FA 2MD8C 2ECTA 2JMJA 3N9LA 3RPGC 4O62A 5D1KB 4N4FA 5DINA 2KU3A 4B86C 2E6SA 1WEPA 2E6RA 3N9QA 2LXPC 2QICA 3RTRB 3H7HA 2MA5A 1WILA 4F52B 3PURA 4CA1A 2KWNA 3L11A 2EXUA 3ASLA 4LK9A 2I50A 2M13A 4UP5A 4PTBA 2LGVA 3LQIA 2L7PA 2DJAA 2NAAA 1BORA 1FBVA 4Z0RA 3IHPA 4R2YA 4FIPA 4FK5A 1ZBDB 5C13A 2IDAA 2MNYA 4GNGA 4PPEA 4C9ZA 4WA6A 1IYMA 4GNDA 3M7KA 2VPBA 2YSJA 1WESA 3M62A 2LXHC 2PUYA 2LGLA 2VJFB 2EGPA 4R8PK 3O36A 3U5MA 3E2DA 2LGKA 3EB5A 3ZYQA 1RMDA 2C2VS 2LQ6A 4V3LC 4BHWA 1WE9A 2Y1NA 2KWKA 2VP7A 4P5OB 3FL2A 2KIZA 2YSMA 5LKUA 2CSVA 2YQMA 4AYCA 5LKXA 4FO9A 3NG2A 4A4BA 3O7AA 5B77A 3GL6A 1G25A 4AP4A 2YQLA 5B75A 2KWOA 3M63A 3EB6A 4NN2A 3SOWA 3DWDA 2XB1A 3SOUA 2VPEA 4XI1A 5SVIB 3T7LA 4ZQLA 2KYUA 5B78A 2BAYA 5J3XA 2G43A 2D8SA 2EA6A 4LJNA 3PLWA 1VFYA 2LGGA 3N9PA 1JM7B 4QF2A 1WEUA 4UI9B 1HYIA 4MSXA 4ZUXU 3KV5A 1DVPA 4OGEA 3L1ZB 3N9NA 3O35A 2YHOA 3M99A 2L5UA 2CRWA 4TKPB 2YW8A 1WGMA 5TDRA 5D1LB
chains in the Genus database with same CATH topology
4YATA 1LDJB 3DPLR 3V43A 3LQJA 2M3HA 3QZVA 2CSYA 5TRBA 1WEOA 2M6MA 3MHHA 1LDKC 3L1XA 4O64A 2L80A 5EYAF 2HDPA 1FP0A 2YURA 3ZVYA 3O33A 3RPGB 1Z6UA 4FJCA 4W4UA 3HTKC 5FEYA 3LRQA 4WZ3B 2ZETC 5H1VA 3ZVZB 2UZGA 3MHSA 2VNFA 2FSAA 5LCWB 2C2LA 5FB0A 2G45A 2Y43A 1E4UA 3SOXA 3DQVR 4WZ2A 3KV6A 1V87A 3O37A 4A49A 5FB1A 5AITA 2G6QA 5AIUA 2RI7A 4AUQB 3N9MA 2L0BA 3O70A 2QIZA 4Q6FA 2H0DB 4YBMA 5KH3A 5B79A 2LRIC 4QF3A 3C6WA 2KE1A 2KREA 4LKAA 4LADB 1WEQA 2LV9A 2L75A 1HYJA 1N87A 5C11A 2VJEA 1CHCA 1F62A 2ECNA 5TBNA 3U5NA 2H0DA 5LKTA 3ZPV1 5FERA 2DX8A 3I2DA 2L43A 3PHDA 4YABA 2PNXA 3C5KA 4WZ0A 4A4CA 4IC3A 1XWHA 2MD7B 2K17A 2KR4A 4GNFA 4GNEA 2QJ0A 5H1UA 2YUCA 3U5OA 5KH7A 2CKLA 2ECVA 2LDRA 4LLBA 4S3OB 2YT5A 4YADA 1WEEA 2K4DA 4A0CD 5B8DA 3U5PA 2XEUA 3ZTGA 2F6NA 2JMIA 3KQIA 4I7BA 2M85A 4UP0A 2CKLB 1WENA 3KNVA 1VD4A 1WEMA 5G04B 2AN6A 2K1JA 4N3WA 4YAXA 1JOCA 3SHBA 2ECGA 2F6JA 3HCSA 2ECJA 3HCTA 4CCGX 4L7XA 2YHNA 4I7DA 2EODA 2YYRA 2RSDA 4AVXA 1K2FA 3T6RA 1X4JA 2OXQC 2MIQA 3HCUA 5I3LA 3ZPVE 2YU4A 2KGIA 4MVTA 3VK6A 4YBSA 5D1MB 1U6GB 2VJFA 4V3KC 1X4UA 2ECWA 4GB0A 2F42A 4S3OC 1X4IA 2VPDA 1WFKA 2M1RA 2FUUA 2KWJA 5LKZA 5G05B 5DKAA 4YBTA 2CT2A 4L58A 2MT5A 1WEWA 5H1TA 2VPGA 4ZDTA 3N9OA 4X3GA 4YC9A 5B76A 1MM2A 2K16A 1MM3A 3PUQA 1Z60A 1JM7A 2JRJA 4IC2A 5KH9A 2KGGA 2VJEB 4I7CA 1WEVA 3GV4A 2JMDA 2HYED 5JG6A 3LQHA 2MNZA 4AYCB 4R7EA 2YREA 3O34A 2Y1MA 2KFTA 2CSZA 2MA6A 4B7YC 1WIMA 2ECIA 1VYXA 3ZNIA 1Z2QA 5TDWA 1T1HA 2FUIA 4BBQA 2LN0A 2MUMA 5H9MA 5TABA 5G0FA 2MD8C 2ECTA 2JMJA 3N9LA 3RPGC 5D1KB 4N4FA 5DINA 2KU3A 4B86C 2E6SA 1WEPA 2E6RA 3N9QA 2LXPC 2QICA 3RTRB 2MA5A 1WILA 4F52B 3PURA 4CA1A 2KWNA 3L11A 3ASLA 4LK9A 2I50A 4UP5A 4PTBA 2LGVA 3LQIA 2NAAA 1BORA 1FBVA 3IHPA 4R2YA 4FIPA 4FK5A 1ZBDB 5C13A 2IDAA 2MNYA 4GNGA 4PPEA 4C9ZA 4WA6A 1IYMA 4GNDA 2VPBA 2YSJA 1WESA 3M62A 2LXHC 2PUYA 2LGLA 2VJFB 2EGPA 4R8PK 3O36A 3U5MA 2LGKA 3EB5A 3ZYQA 1RMDA 2C2VS 2LQ6A 4V3LC 4BHWA 1WE9A 2Y1NA 2KWKA 2VP7A 4P5OB 3FL2A 2KIZA 2YSMA 5LKUA 2YQMA 4AYCA 5LKXA 4FO9A 3NG2A 4A4BA 3O7AA 5B77A 3GL6A 1G25A 4AP4A 2YQLA 5B75A 2KWOA 3M63A 3EB6A 4NN2A 3SOWA 2XB1A 3SOUA 2VPEA 4XI1A 3T7LA 4ZQLA 2KYUA 5B78A 2BAYA 5J3XA 2G43A 2D8SA 2EA6A 4LJNA 1VFYA 2LGGA 3N9PA 1JM7B 4QF2A 1WEUA 4UI9B 1HYIA 4MSXA 4ZUXU 3KV5A 1DVPA 3L1ZB 3N9NA 3O35A 2YHOA 3M99A 2L5UA 4TKPB 2YW8A 1WGMA 5TDRA 5D1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAT A;  1LDJ B;  3DPL R;  3V43 A;  3LQJ A;  2M3H A;  3QZV A;  2CSY A;  5TRB A;  1WEO A;  2M6M A;  3MHH A;  1LDK C;  3L1X A;  4O64 A;  2L80 A;  5EYA F;  2HDP A;  1FP0 A;  2YUR A;  3ZVY A;  3O33 A;  3RPG B;  1Z6U A;  4FJC A;  4W4U A;  3HTK C;  5FEY A;  3LRQ A;  4WZ3 B;  2ZET C;  5H1V A;  3ZVZ B;  2UZG A;  3MHS A;  2VNF A;  2FSA A;  5LCW B;  2C2L A;  5FB0 A;  2G45 A;  2Y43 A;  1E4U A;  3SOX A;  3DQV R;  4WZ2 A;  3KV6 A;  1V87 A;  3O37 A;  4A49 A;  5FB1 A;  5AIT A;  2G6Q A;  5AIU A;  2RI7 A;  4AUQ B;  3N9M A;  2L0B A;  3O70 A;  2QIZ A;  4Q6F A;  2H0D B;  4YBM A;  5KH3 A;  5B79 A;  2LRI C;  4QF3 A;  3C6W A;  2KE1 A;  2KRE A;  4LKA A;  4LAD B;  1WEQ A;  2LV9 A;  2L75 A;  1HYJ A;  1N87 A;  5C11 A;  2VJE A;  1CHC A;  1F62 A;  2ECN A;  5TBN A;  3U5N A;  2H0D A;  5LKT A;  3ZPV 1;  5FER A;  2DX8 A;  3I2D A;  2L43 A;  3PHD A;  4YAB A;  2PNX A;  3C5K A;  4WZ0 A;  4A4C A;  4IC3 A;  1XWH A;  2MD7 B;  2K17 A;  2KR4 A;  4GNF A;  4GNE A;  2QJ0 A;  5H1U A;  2YUC A;  3U5O A;  5KH7 A;  2CKL A;  2ECV A;  2LDR A;  4LLB A;  4S3O B;  2YT5 A;  4YAD A;  1WEE A;  2K4D A;  4A0C D;  5B8D A;  3U5P A;  2XEU A;  3ZTG A;  2F6N A;  2JMI A;  3KQI A;  4I7B A;  2M85 A;  4UP0 A;  2CKL B;  1WEN A;  3KNV A;  1VD4 A;  1WEM A;  5G04 B;  2AN6 A;  2K1J A;  4N3W A;  4YAX A;  1JOC A;  3SHB A;  2ECG A;  2F6J A;  3HCS A;  2ECJ A;  3HCT A;  4CCG X;  4L7X A;  2YHN A;  4I7D A;  2EOD A;  2YYR A;  2RSD A;  4AVX A;  1K2F A;  3T6R A;  1X4J A;  2OXQ C;  2MIQ A;  3HCU A;  5I3L A;  3ZPV E;  2YU4 A;  2KGI A;  4MVT A;  3VK6 A;  4YBS A;  5D1M B;  1U6G B;  2VJF A;  4V3K C;  1X4U A;  2ECW A;  4GB0 A;  2F42 A;  4S3O C;  1X4I A;  2VPD A;  1WFK A;  2M1R A;  2FUU A;  2KWJ A;  5LKZ A;  5G05 B;  5DKA A;  4YBT A;  2CT2 A;  4L58 A;  2MT5 A;  1WEW A;  5H1T A;  2VPG A;  4ZDT A;  3N9O A;  4X3G A;  4YC9 A;  5B76 A;  1MM2 A;  2K16 A;  1MM3 A;  3PUQ A;  1Z60 A;  1JM7 A;  2JRJ A;  4IC2 A;  5KH9 A;  2KGG A;  2VJE B;  4I7C A;  1WEV A;  3GV4 A;  2JMD A;  2HYE D;  5JG6 A;  3LQH A;  2MNZ A;  4AYC B;  4R7E A;  2YRE A;  3O34 A;  2Y1M A;  2KFT A;  2CSZ A;  2MA6 A;  4B7Y C;  1WIM A;  2ECI A;  1VYX A;  3ZNI A;  1Z2Q A;  5TDW A;  1T1H A;  2FUI A;  4BBQ A;  2LN0 A;  2MUM A;  5H9M A;  5TAB A;  5G0F A;  2MD8 C;  2ECT A;  2JMJ A;  3N9L A;  3RPG C;  5D1K B;  4N4F A;  5DIN A;  2KU3 A;  4B86 C;  2E6S A;  1WEP A;  2E6R A;  3N9Q A;  2LXP C;  2QIC A;  3RTR B;  2MA5 A;  1WIL A;  4F52 B;  3PUR A;  4CA1 A;  2KWN A;  3L11 A;  3ASL A;  4LK9 A;  2I50 A;  4UP5 A;  4PTB A;  2LGV A;  3LQI A;  2NAA A;  1BOR A;  1FBV A;  3IHP A;  4R2Y A;  4FIP A;  4FK5 A;  1ZBD B;  5C13 A;  2IDA A;  2MNY A;  4GNG A;  4PPE A;  4C9Z A;  4WA6 A;  1IYM A;  4GND A;  2VPB A;  2YSJ A;  1WES A;  3M62 A;  2LXH C;  2PUY A;  2LGL A;  2VJF B;  2EGP A;  4R8P K;  3O36 A;  3U5M A;  2LGK A;  3EB5 A;  3ZYQ A;  1RMD A;  2C2V S;  2LQ6 A;  4V3L C;  4BHW A;  1WE9 A;  2Y1N A;  2KWK A;  2VP7 A;  4P5O B;  3FL2 A;  2KIZ A;  2YSM A;  5LKU A;  2YQM A;  4AYC A;  5LKX A;  4FO9 A;  3NG2 A;  4A4B A;  3O7A A;  5B77 A;  3GL6 A;  1G25 A;  4AP4 A;  2YQL A;  5B75 A;  2KWO A;  3M63 A;  3EB6 A;  4NN2 A;  3SOW A;  2XB1 A;  3SOU A;  2VPE A;  4XI1 A;  3T7L A;  4ZQL A;  2KYU A;  5B78 A;  2BAY A;  5J3X A;  2G43 A;  2D8S A;  2EA6 A;  4LJN A;  1VFY A;  2LGG A;  3N9P A;  1JM7 B;  4QF2 A;  1WEU A;  4UI9 B;  1HYI A;  4MSX A;  4ZUX U;  3KV5 A;  1DVP A;  3L1Z B;  3N9N A;  3O35 A;  2YHO A;  3M99 A;  2L5U A;  4TKP B;  2YW8 A;  1WGM A;  5TDR A;  5D1L B; 
#chains in the Genus database with same CATH topology
 4YAT A;  1LDJ B;  3DPL R;  3V43 A;  3LQJ A;  3SUB A;  2E61 A;  2M3H A;  3QZV A;  2CSY A;  2YVR A;  5TRB A;  1WEO A;  2M6M A;  3MHH A;  1LDK C;  3L1X A;  4QQ4 A;  2JUN A;  4O64 A;  2L80 A;  5EYA F;  2OWA A;  2HDP A;  3FJU B;  2FFW A;  1FP0 A;  2YUR A;  3ZVY A;  3O33 A;  3RPG B;  1Z6U A;  4FJC A;  4W4U A;  3HTK C;  5FEY A;  3LRQ A;  4WZ3 B;  2ZET C;  5H1V A;  3ZVZ B;  2UZG A;  4H9D A;  3MHS A;  2VNF A;  2FSA A;  2KKY A;  3O47 A;  5LCW B;  2C2L A;  5FB0 A;  2G45 A;  2Y43 A;  1E4U A;  3SOX A;  3DQV R;  4WZ2 A;  3KV6 A;  1V87 A;  3O37 A;  4A49 A;  2JM3 A;  5FB1 A;  5AIT A;  2G6Q A;  2XOY A;  5AIU A;  3LDY A;  2RI7 A;  4AUQ B;  3N9M A;  2L0B A;  3O70 A;  2QIZ A;  4Q6F A;  2LAU A;  2MKE A;  2H0D B;  4YBM A;  5KH3 A;  5B79 A;  2LRI C;  4QF3 A;  3C6W A;  2KE1 A;  2KRE A;  4LKA A;  4LAD B;  1WEQ A;  2LV9 A;  2L75 A;  1HYJ A;  1N87 A;  5C11 A;  2VJE A;  1CHC A;  1F62 A;  2ECN A;  5TBN A;  3U5N A;  2H0D A;  5LKT A;  3ZPV 1;  3KDE C;  5FER A;  2DX8 A;  3I2D A;  2L43 A;  3PHD A;  4YAB A;  2PNX A;  3C5K A;  4WZ0 A;  3FAO A;  4A4C A;  4IC3 A;  1XWH A;  2MD7 B;  2K17 A;  2KR4 A;  5K3Q A;  4GNF A;  4GNE A;  2CRR A;  2QJ0 A;  5H1U A;  2YUC A;  3U5O A;  3Q1D A;  5KH7 A;  2CKL A;  2ECV A;  2LDR A;  4LLB A;  4S3O B;  2YT5 A;  4YAD A;  1WEE A;  2K4D A;  4A0C D;  5B8D A;  3U5P A;  2XEU A;  3ZTG A;  2F6N A;  1MBM A;  2KKX A;  2JMI A;  3KQI A;  4I7B A;  2IQJ A;  2M85 A;  4UP0 A;  2CKL B;  3FAN A;  1WEN A;  3T9K A;  3FEH A;  3KNV A;  1VD4 A;  1WEM A;  5G04 B;  2AN6 A;  2K1J A;  4N3W A;  4YAX A;  1JOC A;  3SHB A;  2ECG A;  2F6J A;  3HCS A;  2ECJ A;  3HCT A;  4CCG X;  4L7X A;  2YHN A;  4I7D A;  3LVR E;  2EOD A;  2P57 A;  2YYR A;  2RSD A;  5SVY A;  4AVX A;  1K2F A;  4F1P A;  3T6R A;  1X4J A;  2OXQ C;  2MIQ A;  2B0O E;  3HCU A;  5I3L A;  3ZPV E;  1DCQ A;  2YU4 A;  5SVX A;  2KGI A;  4MVT A;  3VK6 A;  5D1M B;  3LJU X;  1U6G B;  4YBS A;  2VJF A;  4V3K C;  1X4U A;  2ECW A;  4GB0 A;  2F42 A;  4S3O C;  1X4I A;  2VPD A;  1WFK A;  3DDT A;  2M1R A;  2FD4 A;  2FUU A;  2KWJ A;  5LKZ A;  5G05 B;  5DKA A;  4YBT A;  2DSM A;  2CT2 A;  3FM8 C;  4L58 A;  2MT5 A;  2XP0 A;  1WEW A;  5H1T A;  2VPG A;  4ZDT A;  3N9O A;  4X3G A;  4YC9 A;  5B76 A;  4Z0O A;  2CON A;  1MM2 A;  2K16 A;  1MM3 A;  2EGM A;  3PUQ A;  2XOZ A;  1Z60 A;  1JM7 A;  2JRJ A;  4IC2 A;  5KH9 A;  2KGG A;  2RR4 A;  2VJE B;  4I7C A;  4OGC A;  1WEV A;  3GV4 A;  2JMD A;  2HYE D;  3MDB C;  2XOC A;  5JG6 A;  3LQH A;  2MNZ A;  4AYC B;  3LVQ E;  2D8U A;  4R7E A;  2YRE A;  3O34 A;  5SVI A;  2Y1M A;  2KFT A;  2CSZ A;  2MA6 A;  4B7Y C;  1WIM A;  2ECI A;  1VYX A;  3ZNI A;  1Z2Q A;  5TDW A;  1T1H A;  2FUI A;  4BBQ A;  2LN0 A;  2MUM A;  5H9M A;  5TAB A;  3JUE A;  5G0F A;  2MD8 C;  2ECT A;  2JMJ A;  3N9L A;  3RPG C;  4O62 A;  5D1K B;  4N4F A;  5DIN A;  2KU3 A;  4B86 C;  2E6S A;  1WEP A;  2E6R A;  3N9Q A;  2LXP C;  2QIC A;  3RTR B;  3H7H A;  2MA5 A;  1WIL A;  4F52 B;  3PUR A;  4CA1 A;  2KWN A;  3L11 A;  2EXU A;  3ASL A;  4LK9 A;  2I50 A;  2M13 A;  4UP5 A;  4PTB A;  2LGV A;  3LQI A;  2L7P A;  2DJA A;  2NAA A;  1BOR A;  1FBV A;  4Z0R A;  3IHP A;  4R2Y A;  4FIP A;  4FK5 A;  1ZBD B;  5C13 A;  2IDA A;  2MNY A;  4GNG A;  4PPE A;  4C9Z A;  4WA6 A;  1IYM A;  4GND A;  3M7K A;  2VPB A;  2YSJ A;  1WES A;  3M62 A;  2LXH C;  2PUY A;  2LGL A;  2VJF B;  2EGP A;  4R8P K;  3O36 A;  3U5M A;  3E2D A;  2LGK A;  3EB5 A;  3ZYQ A;  1RMD A;  2C2V S;  2LQ6 A;  4V3L C;  4BHW A;  1WE9 A;  2Y1N A;  2KWK A;  2VP7 A;  4P5O B;  3FL2 A;  2KIZ A;  2YSM A;  5LKU A;  2CSV A;  2YQM A;  4AYC A;  5LKX A;  4FO9 A;  3NG2 A;  4A4B A;  3O7A A;  5B77 A;  3GL6 A;  1G25 A;  4AP4 A;  2YQL A;  5B75 A;  2KWO A;  3M63 A;  3EB6 A;  4NN2 A;  3SOW A;  3DWD A;  2XB1 A;  3SOU A;  2VPE A;  4XI1 A;  5SVI B;  3T7L A;  4ZQL A;  2KYU A;  5B78 A;  2BAY A;  5J3X A;  2G43 A;  2D8S A;  2EA6 A;  4LJN A;  3PLW A;  1VFY A;  2LGG A;  3N9P A;  1JM7 B;  4QF2 A;  1WEU A;  4UI9 B;  1HYI A;  4MSX A;  4ZUX U;  3KV5 A;  1DVP A;  4OGE A;  3L1Z B;  3N9N A;  3O35 A;  2YHO A;  3M99 A;  2L5U A;  2CRW A;  4TKP B;  2YW8 A;  1WGM A;  5TDR A;  5D1L B; 
#chains in the Genus database with same CATH homology
 4YAT A;  1LDJ B;  3DPL R;  3V43 A;  3LQJ A;  2M3H A;  3QZV A;  2CSY A;  5TRB A;  1WEO A;  2M6M A;  3MHH A;  1LDK C;  3L1X A;  4O64 A;  2L80 A;  5EYA F;  2HDP A;  1FP0 A;  2YUR A;  3ZVY A;  3O33 A;  3RPG B;  1Z6U A;  4FJC A;  4W4U A;  3HTK C;  5FEY A;  3LRQ A;  4WZ3 B;  2ZET C;  5H1V A;  3ZVZ B;  2UZG A;  3MHS A;  2VNF A;  2FSA A;  5LCW B;  2C2L A;  5FB0 A;  2G45 A;  2Y43 A;  1E4U A;  3SOX A;  3DQV R;  4WZ2 A;  3KV6 A;  1V87 A;  3O37 A;  4A49 A;  5FB1 A;  5AIT A;  2G6Q A;  5AIU A;  2RI7 A;  4AUQ B;  3N9M A;  2L0B A;  3O70 A;  2QIZ A;  4Q6F A;  2H0D B;  4YBM A;  5KH3 A;  5B79 A;  2LRI C;  4QF3 A;  3C6W A;  2KE1 A;  2KRE A;  4LKA A;  4LAD B;  1WEQ A;  2LV9 A;  2L75 A;  1HYJ A;  1N87 A;  5C11 A;  2VJE A;  1CHC A;  1F62 A;  2ECN A;  5TBN A;  3U5N A;  2H0D A;  5LKT A;  3ZPV 1;  5FER A;  2DX8 A;  3I2D A;  2L43 A;  3PHD A;  4YAB A;  2PNX A;  3C5K A;  4WZ0 A;  4A4C A;  4IC3 A;  1XWH A;  2MD7 B;  2K17 A;  2KR4 A;  4GNF A;  4GNE A;  2QJ0 A;  5H1U A;  2YUC A;  3U5O A;  5KH7 A;  2CKL A;  2ECV A;  2LDR A;  4LLB A;  4S3O B;  2YT5 A;  4YAD A;  1WEE A;  2K4D A;  4A0C D;  5B8D A;  3U5P A;  2XEU A;  3ZTG A;  2F6N A;  2JMI A;  3KQI A;  4I7B A;  2M85 A;  4UP0 A;  2CKL B;  1WEN A;  3KNV A;  1VD4 A;  1WEM A;  5G04 B;  2AN6 A;  2K1J A;  4N3W A;  4YAX A;  1JOC A;  3SHB A;  2ECG A;  2F6J A;  3HCS A;  2ECJ A;  3HCT A;  4CCG X;  4L7X A;  2YHN A;  4I7D A;  2EOD A;  2YYR A;  2RSD A;  4AVX A;  1K2F A;  3T6R A;  1X4J A;  2OXQ C;  2MIQ A;  3HCU A;  5I3L A;  3ZPV E;  2YU4 A;  2KGI A;  4MVT A;  3VK6 A;  4YBS A;  5D1M B;  1U6G B;  2VJF A;  4V3K C;  1X4U A;  2ECW A;  4GB0 A;  2F42 A;  4S3O C;  1X4I A;  2VPD A;  1WFK A;  2M1R A;  2FUU A;  2KWJ A;  5LKZ A;  5G05 B;  5DKA A;  4YBT A;  2CT2 A;  4L58 A;  2MT5 A;  1WEW A;  5H1T A;  2VPG A;  4ZDT A;  3N9O A;  4X3G A;  4YC9 A;  5B76 A;  1MM2 A;  2K16 A;  1MM3 A;  3PUQ A;  1Z60 A;  1JM7 A;  2JRJ A;  4IC2 A;  5KH9 A;  2KGG A;  2VJE B;  4I7C A;  1WEV A;  3GV4 A;  2JMD A;  2HYE D;  5JG6 A;  3LQH A;  2MNZ A;  4AYC B;  4R7E A;  2YRE A;  3O34 A;  2Y1M A;  2KFT A;  2CSZ A;  2MA6 A;  4B7Y C;  1WIM A;  2ECI A;  1VYX A;  3ZNI A;  1Z2Q A;  5TDW A;  1T1H A;  2FUI A;  4BBQ A;  2LN0 A;  2MUM A;  5H9M A;  5TAB A;  5G0F A;  2MD8 C;  2ECT A;  2JMJ A;  3N9L A;  3RPG C;  5D1K B;  4N4F A;  5DIN A;  2KU3 A;  4B86 C;  2E6S A;  1WEP A;  2E6R A;  3N9Q A;  2LXP C;  2QIC A;  3RTR B;  2MA5 A;  1WIL A;  4F52 B;  3PUR A;  4CA1 A;  2KWN A;  3L11 A;  3ASL A;  4LK9 A;  2I50 A;  4UP5 A;  4PTB A;  2LGV A;  3LQI A;  2NAA A;  1BOR A;  1FBV A;  3IHP A;  4R2Y A;  4FIP A;  4FK5 A;  1ZBD B;  5C13 A;  2IDA A;  2MNY A;  4GNG A;  4PPE A;  4C9Z A;  4WA6 A;  1IYM A;  4GND A;  2VPB A;  2YSJ A;  1WES A;  3M62 A;  2LXH C;  2PUY A;  2LGL A;  2VJF B;  2EGP A;  4R8P K;  3O36 A;  3U5M A;  2LGK A;  3EB5 A;  3ZYQ A;  1RMD A;  2C2V S;  2LQ6 A;  4V3L C;  4BHW A;  1WE9 A;  2Y1N A;  2KWK A;  2VP7 A;  4P5O B;  3FL2 A;  2KIZ A;  2YSM A;  5LKU A;  2YQM A;  4AYC A;  5LKX A;  4FO9 A;  3NG2 A;  4A4B A;  3O7A A;  5B77 A;  3GL6 A;  1G25 A;  4AP4 A;  2YQL A;  5B75 A;  2KWO A;  3M63 A;  3EB6 A;  4NN2 A;  3SOW A;  2XB1 A;  3SOU A;  2VPE A;  4XI1 A;  3T7L A;  4ZQL A;  2KYU A;  5B78 A;  2BAY A;  5J3X A;  2G43 A;  2D8S A;  2EA6 A;  4LJN A;  1VFY A;  2LGG A;  3N9P A;  1JM7 B;  4QF2 A;  1WEU A;  4UI9 B;  1HYI A;  4MSX A;  4ZUX U;  3KV5 A;  1DVP A;  3L1Z B;  3N9N A;  3O35 A;  2YHO A;  3M99 A;  2L5U A;  4TKP B;  2YW8 A;  1WGM A;  5TDR A;  5D1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...