1WEEA

Solution structure of phd domain in phd finger family protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
GSSGSSGMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in PHD finger family protein
rcsb
molecule keywords PHD finger family protein
molecule tags Dna binding protein
source organism Arabidopsis thaliana
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weeA00
4XI1A 2LXHC 5B77A 3M62A 4GNDA 4L58A 1VD4A 2XB1A 2QIZA 1JM7B 3N9PA 1X4UA 2PUYA 2RI7A 5B79A 1BORA 2MA6A 4N4FA 4PTBA 4I7BA 2F6NA 2EGPA 5FB0A 3GV4A 4A49A 3ZPVE 4A4CA 1U6GB 2YSMA 3O70A 4FIPA 4V3LC 3HCUA 1RMDA 3LRQA 3PURA 3HCTA 3MHHA 3NG2A 2LGKA 1Z60A 1X4IA 2G43A 4P5OB 2LV9A 2ECGA 3ASLA 3N9MA 4S3OB 5LKUA 2EODA 2VPDA 4PPEA 4FK5A 1WEEA 1WFKA 2Y1NA 1WE9A 1WGMA 2HDPA 5KH7A 3O36A 5B8DA 4YBTA 4YC9A 1WEVA 3DPLR 1WEPA 4WZ2A 4TKPB 4AP4A 3O35A 1WEWA 2FUIA 5DKAA 2YUCA 2MA5A 2FSAA 2ZETC 4B86C 2QJ0A 5LCWB 4IC2A 2YREA 2HYED 3SOXA 3T7LA 3C6WA 4A4BA 3QZVA 1F62A 2YURA 2JMDA 1JOCA 2G45A 3C5KA 5JG6A 5LKXA 4S3OC 3LQIA 4A0CD 3U5PA 1WEOA 2ECNA 3FL2A 1JM7A 4AVXA 2FUUA 4GNFA 2JMJA 2VJFA 3O34A 2CSZA 2KYUA 1ZBDB 2M1RA 2KFTA 2YHNA 1FP0A 3KV6A 1WENA 2M6MA 2VJFB 4ZUXU 2MT5A 5FB1A 1WILA 2ECWA 4MSXA 4UP0A 1N87A 2AN6A 4YBSA 5EYAF 5C13A 1Z2QA 4B7YC 1K2FA 1G25A 2KWOA 5LKTA 3RTRB 3MHSA 1CHCA 3U5NA 5B78A 3N9NA 1HYIA 3IHPA 2KGIA 5B76A 2DX8A 2MNYA 2D8SA 2YQMA 2PNXA 2CSYA 3LQHA 3SOUA 5J3XA 2VPGA 4AYCB 3RPGB 5B75A 1E4UA 3ZPV1 4ZDTA 5KH3A 2IDAA 4R8PK 2LGVA 5C11A 3EB6A 4N3WA 1VFYA 3ZVZB 3SHBA 5D1MB 4QF2A 3L1XA 2E6SA 4WA6A 2MD8C 4WZ3B 2JMIA 2CT2A 2LN0A 3O7AA 2G6QA 2I50A 4I7DA 2F6JA 2K16A 2RSDA 3LQJA 2KGGA 2Y43A 4FO9A 2YHOA 2K1JA 2VPBA 5H1VA 3ZYQA 1IYMA 3SOWA 3ZTGA 2LDRA 3GL6A 5D1LB 2KWKA 3KQIA 4Q6FA 5FERA 3PHDA 2VP7A 1T1HA 2L0BA 5TDRA 4YABA 4UI9B 5TDWA 2M3HA 2LGLA 5AIUA 4YATA 4UP5A 2XEUA 2KE1A 3ZNIA 3DQVR 2KR4A 3O37A 1Z6UA 4GNGA 2ECVA 3KNVA 2VJEA 3U5OA 2KWNA 4O64A 4CCGX 4MVTA 2MD7B 5AITA 4LADB 2LGGA 4NN2A 2C2LA 2KIZA 2C2VS 2ECIA 5DINA 5H1UA 4IC3A 1MM2A 2E6RA 5G0FA 2KREA 2MIQA 4R7EA 2EA6A 3HCSA 2VJEB 5G04B 2JRJA 3HTKC 2KU3A 2YU4A 2YW8A 4L7XA 1WEQA 4YAXA 4AYCA 3I2DA 2QICA 5H1TA 4QF3A 4GB0A 4C9ZA 2ECTA 3VK6A 5KH9A 4LJNA 4W4UA 1WEMA 5H9MA 2ECJA 3V43A 2BAYA 2K4DA 4BHWA 2UZGA 5TBNA 3M99A 2VPEA 2M85A 4R2YA 4YBMA 2MUMA 2L5UA 2L80A 3N9OA 2H0DA 5TABA 2NAAA 2F42A 3N9LA 3O33A 4GNEA 4BBQA 3L1ZB 2OXQC 4FJCA 1WEUA 3L11A 2L43A 4X3GA 4AUQB 4V3KC 3U5MA 2H0DB 1FBVA 2VNFA 5D1KB 1HYJA 1WESA 4WZ0A 1XWHA 1LDKC 5LKZA 2LRIC 5G05B 3T6RA 1MM3A 2YSJA 4LLBA 2L75A 2CKLA 4I7CA 4CA1A 2MNZA 1V87A 4YADA 2YQLA 5TRBA 3RPGC 4LK9A 4ZQLA 3PUQA 4LKAA 1X4JA 2K17A 2KWJA 2Y1MA 5I3LA 3ZVYA 3M63A 2YT5A 1DVPA 1LDJB 5FEYA 2CKLB 1WIMA 1VYXA 3N9QA 2YYRA 3KV5A 4F52B 2LQ6A 3EB5A 2LXPC
chains in the Genus database with same CATH superfamily
2EGMA 2KKXA 2LXHC 4XI1A 5B77A 3M62A 4GNDA 4L58A 1VD4A 2XB1A 3FANA 2CRRA 2QIZA 1JM7B 3N9PA 1X4UA 2PUYA 2RI7A 5B79A 1BORA 2M13A 2JUNA 2MA6A 4N4FA 4PTBA 4I7BA 2F6NA 2EGPA 5FB0A 3GV4A 4A49A 3ZPVE 4A4CA 1U6GB 2YSMA 5SVXA 3O70A 4FIPA 4V3LC 3HCUA 2XOCA 1RMDA 3DDTA 3LRQA 3PLWA 3PURA 4H9DA 3MDBC 3HCTA 3MHHA 3NG2A 2LGKA 1Z60A 1X4IA 2G43A 4P5OB 2LV9A 2ECGA 3ASLA 3N9MA 4S3OB 4OGEA 4QQ4A 3LJUX 5LKUA 2EODA 2VPDA 4PPEA 4FK5A 1WEEA 1WFKA 1DCQA 2JM3A 2Y1NA 1WE9A 1WGMA 2HDPA 5KH7A 3O36A 5B8DA 4YBTA 4O62A 4YC9A 1WEVA 3DPLR 1WEPA 4WZ2A 4TKPB 4AP4A 2LAUA 3O35A 3FAOA 1WEWA 2FUIA 5DKAA 2YUCA 2MA5A 4OGCA 2FSAA 2DJAA 2ZETC 4B86C 2QJ0A 5LCWB 4IC2A 2YREA 2HYED 3SOXA 3T7LA 3C6WA 4A4BA 4Z0RA 3QZVA 1F62A 2YURA 2JMDA 1JOCA 2G45A 3C5KA 2P57A 5JG6A 5LKXA 4S3OC 2B0OE 5K3QA 3LQIA 4A0CD 3U5PA 2YVRA 1WEOA 2ECNA 3FL2A 1JM7A 4AVXA 2FUUA 3M7KA 4GNFA 2JMJA 2VJFA 3O34A 2CSZA 2KYUA 1ZBDB 2M1RA 2KFTA 2YHNA 1FP0A 3KV6A 2IQJA 1WENA 2M6MA 2VJFB 4ZUXU 2XOYA 2MT5A 5FB1A 3FM8C 1WILA 2ECWA 4MSXA 4UP0A 1N87A 2L7PA 2AN6A 4YBSA 2XP0A 5EYAF 5C13A 1Z2QA 4B7YC 1K2FA 1G25A 2KWOA 5LKTA 3RTRB 2RR4A 3MHSA 1CHCA 2KKYA 3U5NA 3FEHA 3SUBA 2CRWA 3H7HA 2XOZA 5B78A 4Z0OA 3N9NA 1HYIA 3IHPA 2KGIA 5B76A 2DX8A 2MNYA 2D8SA 2YQMA 2MKEA 2PNXA 2CSYA 3LQHA 3SOUA 5J3XA 2VPGA 4AYCB 3RPGB 5B75A 1E4UA 3ZPV1 4ZDTA 3T9KA 2CSVA 5KH3A 2IDAA 4R8PK 2LGVA 5C11A 2OWAA 3EB6A 4N3WA 1VFYA 2DSMA 3O47A 3ZVZB 3SHBA 5D1MB 4QF2A 3L1XA 2E6SA 3JUEA 4WA6A 2MD8C 4WZ3B 1MBMA 2JMIA 2CT2A 2LN0A 2FD4A 3O7AA 2G6QA 2I50A 4I7DA 2F6JA 2K16A 2RSDA 3LQJA 2KGGA 2Y43A 4FO9A 2YHOA 2K1JA 2VPBA 5H1VA 3ZYQA 1IYMA 3SOWA 3ZTGA 2LDRA 3GL6A 5D1LB 2KWKA 3KQIA 4Q6FA 5FERA 3PHDA 2VP7A 1T1HA 2L0BA 5TDRA 4YABA 3DWDA 4UI9B 5TDWA 3LDYA 2M3HA 2LGLA 5AIUA 4YATA 4UP5A 2E61A 2KE1A 2XEUA 3DQVR 3ZNIA 2KR4A 3O37A 1Z6UA 4GNGA 2ECVA 3KNVA 2VJEA 3U5OA 2KWNA 4O64A 4CCGX 4MVTA 2MD7B 5AITA 4LADB 2LGGA 4NN2A 2C2LA 2EXUA 2KIZA 2C2VS 2ECIA 5DINA 5H1UA 4IC3A 1MM2A 2E6RA 5G0FA 2KREA 2MIQA 4R7EA 2EA6A 3HCSA 2VJEB 5G04B 5SVIA 2JRJA 3HTKC 2KU3A 2YU4A 2YW8A 4L7XA 4F1PA 1WEQA 4YAXA 4AYCA 3I2DA 2QICA 5H1TA 4QF3A 5SVIB 4GB0A 4C9ZA 2ECTA 3VK6A 5KH9A 4LJNA 4W4UA 1WEMA 5H9MA 2ECJA 3V43A 2BAYA 2K4DA 4BHWA 2UZGA 5TBNA 3M99A 2D8UA 2VPEA 2M85A 4R2YA 4YBMA 3Q1DA 2MUMA 2CONA 2L5UA 2L80A 3N9OA 2H0DA 5TABA 2NAAA 5SVYA 2F42A 3N9LA 3O33A 4GNEA 4BBQA 3L1ZB 2OXQC 4FJCA 1WEUA 3L11A 2L43A 4X3GA 4AUQB 4V3KC 3U5MA 2H0DB 1FBVA 2VNFA 5D1KB 1HYJA 1WESA 4WZ0A 3E2DA 1XWHA 1LDKC 5LKZA 2LRIC 5G05B 3T6RA 1MM3A 2YSJA 4LLBA 2L75A 2CKLA 4I7CA 4CA1A 2MNZA 1V87A 4YADA 2YQLA 5TRBA 3RPGC 4LK9A 4ZQLA 3PUQA 4LKAA 1X4JA 2K17A 2KWJA 2Y1MA 5I3LA 3ZVYA 3M63A 2YT5A 1DVPA 1LDJB 5FEYA 2CKLB 1WIMA 2FFWA 1VYXA 3N9QA 2YYRA 3LVQE 3KV5A 3KDEC 3LVRE 4F52B 2LQ6A 3FJUB 3EB5A 2LXPC
chains in the Genus database with same CATH topology
4XI1A 2LXHC 5B77A 3M62A 4GNDA 4L58A 1VD4A 2XB1A 2QIZA 1JM7B 3N9PA 1X4UA 2PUYA 2RI7A 5B79A 1BORA 2MA6A 4N4FA 4PTBA 4I7BA 2F6NA 2EGPA 5FB0A 3GV4A 4A49A 3ZPVE 4A4CA 1U6GB 2YSMA 3O70A 4FIPA 4V3LC 3HCUA 1RMDA 3LRQA 3PURA 3HCTA 3MHHA 3NG2A 2LGKA 1Z60A 1X4IA 2G43A 4P5OB 2LV9A 2ECGA 3ASLA 3N9MA 4S3OB 5LKUA 2EODA 2VPDA 4PPEA 4FK5A 1WEEA 1WFKA 2Y1NA 1WE9A 1WGMA 2HDPA 5KH7A 3O36A 5B8DA 4YBTA 4YC9A 1WEVA 3DPLR 1WEPA 4WZ2A 4TKPB 4AP4A 3O35A 1WEWA 2FUIA 5DKAA 2YUCA 2MA5A 2FSAA 2ZETC 4B86C 2QJ0A 5LCWB 4IC2A 2YREA 2HYED 3SOXA 3T7LA 3C6WA 4A4BA 3QZVA 1F62A 2YURA 2JMDA 1JOCA 2G45A 3C5KA 5JG6A 5LKXA 4S3OC 3LQIA 4A0CD 3U5PA 1WEOA 2ECNA 3FL2A 1JM7A 4AVXA 2FUUA 4GNFA 2JMJA 2VJFA 3O34A 2CSZA 2KYUA 1ZBDB 2M1RA 2KFTA 2YHNA 1FP0A 3KV6A 1WENA 2M6MA 2VJFB 4ZUXU 2MT5A 5FB1A 1WILA 2ECWA 4MSXA 4UP0A 1N87A 2AN6A 4YBSA 5EYAF 5C13A 1Z2QA 4B7YC 1K2FA 1G25A 2KWOA 5LKTA 3RTRB 3MHSA 1CHCA 3U5NA 5B78A 3N9NA 1HYIA 3IHPA 2KGIA 5B76A 2DX8A 2MNYA 2D8SA 2YQMA 2PNXA 2CSYA 3LQHA 3SOUA 5J3XA 2VPGA 4AYCB 3RPGB 5B75A 1E4UA 3ZPV1 4ZDTA 5KH3A 2IDAA 4R8PK 2LGVA 5C11A 3EB6A 4N3WA 1VFYA 3ZVZB 3SHBA 5D1MB 4QF2A 3L1XA 2E6SA 4WA6A 2MD8C 4WZ3B 2JMIA 2CT2A 2LN0A 3O7AA 2G6QA 2I50A 4I7DA 2F6JA 2K16A 2RSDA 3LQJA 2KGGA 2Y43A 4FO9A 2YHOA 2K1JA 2VPBA 5H1VA 3ZYQA 1IYMA 3SOWA 3ZTGA 2LDRA 3GL6A 5D1LB 2KWKA 3KQIA 4Q6FA 5FERA 3PHDA 2VP7A 1T1HA 2L0BA 5TDRA 4YABA 4UI9B 5TDWA 2M3HA 2LGLA 5AIUA 4YATA 4UP5A 2XEUA 2KE1A 3ZNIA 3DQVR 2KR4A 3O37A 1Z6UA 4GNGA 2ECVA 3KNVA 2VJEA 3U5OA 2KWNA 4O64A 4CCGX 4MVTA 2MD7B 5AITA 4LADB 2LGGA 4NN2A 2C2LA 2KIZA 2C2VS 2ECIA 5DINA 5H1UA 4IC3A 1MM2A 2E6RA 5G0FA 2KREA 2MIQA 4R7EA 2EA6A 3HCSA 2VJEB 5G04B 2JRJA 3HTKC 2KU3A 2YU4A 2YW8A 4L7XA 1WEQA 4YAXA 4AYCA 3I2DA 2QICA 5H1TA 4QF3A 4GB0A 4C9ZA 2ECTA 3VK6A 5KH9A 4LJNA 4W4UA 1WEMA 5H9MA 2ECJA 3V43A 2BAYA 2K4DA 4BHWA 2UZGA 5TBNA 3M99A 2VPEA 2M85A 4R2YA 4YBMA 2MUMA 2L5UA 2L80A 3N9OA 2H0DA 5TABA 2NAAA 2F42A 3N9LA 3O33A 4GNEA 4BBQA 3L1ZB 2OXQC 4FJCA 1WEUA 3L11A 2L43A 4X3GA 4AUQB 4V3KC 3U5MA 2H0DB 1FBVA 2VNFA 5D1KB 1HYJA 1WESA 4WZ0A 1XWHA 1LDKC 5LKZA 2LRIC 5G05B 3T6RA 1MM3A 2YSJA 4LLBA 2L75A 2CKLA 4I7CA 4CA1A 2MNZA 1V87A 4YADA 2YQLA 5TRBA 3RPGC 4LK9A 4ZQLA 3PUQA 4LKAA 1X4JA 2K17A 2KWJA 2Y1MA 5I3LA 3ZVYA 3M63A 2YT5A 1DVPA 1LDJB 5FEYA 2CKLB 1WIMA 1VYXA 3N9QA 2YYRA 3KV5A 4F52B 2LQ6A 3EB5A 2LXPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI1 A;  2LXH C;  5B77 A;  3M62 A;  4GND A;  4L58 A;  1VD4 A;  2XB1 A;  2QIZ A;  1JM7 B;  3N9P A;  1X4U A;  2PUY A;  2RI7 A;  5B79 A;  1BOR A;  2MA6 A;  4N4F A;  4PTB A;  4I7B A;  2F6N A;  2EGP A;  5FB0 A;  3GV4 A;  4A49 A;  3ZPV E;  4A4C A;  1U6G B;  2YSM A;  3O70 A;  4FIP A;  4V3L C;  3HCU A;  1RMD A;  3LRQ A;  3PUR A;  3HCT A;  3MHH A;  3NG2 A;  2LGK A;  1Z60 A;  1X4I A;  2G43 A;  4P5O B;  2LV9 A;  2ECG A;  3ASL A;  3N9M A;  4S3O B;  5LKU A;  2EOD A;  2VPD A;  4PPE A;  4FK5 A;  1WEE A;  1WFK A;  2Y1N A;  1WE9 A;  1WGM A;  2HDP A;  5KH7 A;  3O36 A;  5B8D A;  4YBT A;  4YC9 A;  1WEV A;  3DPL R;  1WEP A;  4WZ2 A;  4TKP B;  4AP4 A;  3O35 A;  1WEW A;  2FUI A;  5DKA A;  2YUC A;  2MA5 A;  2FSA A;  2ZET C;  4B86 C;  2QJ0 A;  5LCW B;  4IC2 A;  2YRE A;  2HYE D;  3SOX A;  3T7L A;  3C6W A;  4A4B A;  3QZV A;  1F62 A;  2YUR A;  2JMD A;  1JOC A;  2G45 A;  3C5K A;  5JG6 A;  5LKX A;  4S3O C;  3LQI A;  4A0C D;  3U5P A;  1WEO A;  2ECN A;  3FL2 A;  1JM7 A;  4AVX A;  2FUU A;  4GNF A;  2JMJ A;  2VJF A;  3O34 A;  2CSZ A;  2KYU A;  1ZBD B;  2M1R A;  2KFT A;  2YHN A;  1FP0 A;  3KV6 A;  1WEN A;  2M6M A;  2VJF B;  4ZUX U;  2MT5 A;  5FB1 A;  1WIL A;  2ECW A;  4MSX A;  4UP0 A;  1N87 A;  2AN6 A;  4YBS A;  5EYA F;  5C13 A;  1Z2Q A;  4B7Y C;  1K2F A;  1G25 A;  2KWO A;  5LKT A;  3RTR B;  3MHS A;  1CHC A;  3U5N A;  5B78 A;  3N9N A;  1HYI A;  3IHP A;  2KGI A;  5B76 A;  2DX8 A;  2MNY A;  2D8S A;  2YQM A;  2PNX A;  2CSY A;  3LQH A;  3SOU A;  5J3X A;  2VPG A;  4AYC B;  3RPG B;  5B75 A;  1E4U A;  3ZPV 1;  4ZDT A;  5KH3 A;  2IDA A;  4R8P K;  2LGV A;  5C11 A;  3EB6 A;  4N3W A;  1VFY A;  3ZVZ B;  3SHB A;  5D1M B;  4QF2 A;  3L1X A;  2E6S A;  4WA6 A;  2MD8 C;  4WZ3 B;  2JMI A;  2CT2 A;  2LN0 A;  3O7A A;  2G6Q A;  2I50 A;  4I7D A;  2F6J A;  2K16 A;  2RSD A;  3LQJ A;  2KGG A;  2Y43 A;  4FO9 A;  2YHO A;  2K1J A;  2VPB A;  5H1V A;  3ZYQ A;  1IYM A;  3SOW A;  3ZTG A;  2LDR A;  3GL6 A;  5D1L B;  2KWK A;  3KQI A;  4Q6F A;  5FER A;  3PHD A;  2VP7 A;  1T1H A;  2L0B A;  5TDR A;  4YAB A;  4UI9 B;  5TDW A;  2M3H A;  2LGL A;  5AIU A;  4YAT A;  4UP5 A;  2XEU A;  2KE1 A;  3ZNI A;  3DQV R;  2KR4 A;  3O37 A;  1Z6U A;  4GNG A;  2ECV A;  3KNV A;  2VJE A;  3U5O A;  2KWN A;  4O64 A;  4CCG X;  4MVT A;  2MD7 B;  5AIT A;  4LAD B;  2LGG A;  4NN2 A;  2C2L A;  2KIZ A;  2C2V S;  2ECI A;  5DIN A;  5H1U A;  4IC3 A;  1MM2 A;  2E6R A;  5G0F A;  2KRE A;  2MIQ A;  4R7E A;  2EA6 A;  3HCS A;  2VJE B;  5G04 B;  2JRJ A;  3HTK C;  2KU3 A;  2YU4 A;  2YW8 A;  4L7X A;  1WEQ A;  4YAX A;  4AYC A;  3I2D A;  2QIC A;  5H1T A;  4QF3 A;  4GB0 A;  4C9Z A;  2ECT A;  3VK6 A;  5KH9 A;  4LJN A;  4W4U A;  1WEM A;  5H9M A;  2ECJ A;  3V43 A;  2BAY A;  2K4D A;  4BHW A;  2UZG A;  5TBN A;  3M99 A;  2VPE A;  2M85 A;  4R2Y A;  4YBM A;  2MUM A;  2L5U A;  2L80 A;  3N9O A;  2H0D A;  5TAB A;  2NAA A;  2F42 A;  3N9L A;  3O33 A;  4GNE A;  4BBQ A;  3L1Z B;  2OXQ C;  4FJC A;  1WEU A;  3L11 A;  2L43 A;  4X3G A;  4AUQ B;  4V3K C;  3U5M A;  2H0D B;  1FBV A;  2VNF A;  5D1K B;  1HYJ A;  1WES A;  4WZ0 A;  1XWH A;  1LDK C;  5LKZ A;  2LRI C;  5G05 B;  3T6R A;  1MM3 A;  2YSJ A;  4LLB A;  2L75 A;  2CKL A;  4I7C A;  4CA1 A;  2MNZ A;  1V87 A;  4YAD A;  2YQL A;  5TRB A;  3RPG C;  4LK9 A;  4ZQL A;  3PUQ A;  4LKA A;  1X4J A;  2K17 A;  2KWJ A;  2Y1M A;  5I3L A;  3ZVY A;  3M63 A;  2YT5 A;  1DVP A;  1LDJ B;  5FEY A;  2CKL B;  1WIM A;  1VYX A;  3N9Q A;  2YYR A;  3KV5 A;  4F52 B;  2LQ6 A;  3EB5 A;  2LXP C; 
#chains in the Genus database with same CATH topology
 2EGM A;  2KKX A;  2LXH C;  4XI1 A;  5B77 A;  3M62 A;  4GND A;  4L58 A;  1VD4 A;  2XB1 A;  3FAN A;  2CRR A;  2QIZ A;  1JM7 B;  3N9P A;  1X4U A;  2PUY A;  2RI7 A;  5B79 A;  1BOR A;  2M13 A;  2JUN A;  2MA6 A;  4N4F A;  4PTB A;  4I7B A;  2F6N A;  2EGP A;  5FB0 A;  3GV4 A;  4A49 A;  3ZPV E;  4A4C A;  1U6G B;  2YSM A;  5SVX A;  3O70 A;  4FIP A;  4V3L C;  3HCU A;  2XOC A;  1RMD A;  3DDT A;  3LRQ A;  3PLW A;  3PUR A;  4H9D A;  3MDB C;  3HCT A;  3MHH A;  3NG2 A;  2LGK A;  1Z60 A;  1X4I A;  2G43 A;  4P5O B;  2LV9 A;  2ECG A;  3ASL A;  3N9M A;  4S3O B;  4OGE A;  4QQ4 A;  3LJU X;  5LKU A;  2EOD A;  2VPD A;  4PPE A;  4FK5 A;  1WEE A;  1WFK A;  1DCQ A;  2JM3 A;  2Y1N A;  1WE9 A;  1WGM A;  2HDP A;  5KH7 A;  3O36 A;  5B8D A;  4YBT A;  4O62 A;  4YC9 A;  1WEV A;  3DPL R;  1WEP A;  4WZ2 A;  4TKP B;  4AP4 A;  2LAU A;  3O35 A;  3FAO A;  1WEW A;  2FUI A;  5DKA A;  2YUC A;  2MA5 A;  4OGC A;  2FSA A;  2DJA A;  2ZET C;  4B86 C;  2QJ0 A;  5LCW B;  4IC2 A;  2YRE A;  2HYE D;  3SOX A;  3T7L A;  3C6W A;  4A4B A;  4Z0R A;  3QZV A;  1F62 A;  2YUR A;  2JMD A;  1JOC A;  2G45 A;  3C5K A;  2P57 A;  5JG6 A;  5LKX A;  4S3O C;  2B0O E;  5K3Q A;  3LQI A;  4A0C D;  3U5P A;  2YVR A;  1WEO A;  2ECN A;  3FL2 A;  1JM7 A;  4AVX A;  2FUU A;  3M7K A;  4GNF A;  2JMJ A;  2VJF A;  3O34 A;  2CSZ A;  2KYU A;  1ZBD B;  2M1R A;  2KFT A;  2YHN A;  1FP0 A;  3KV6 A;  2IQJ A;  1WEN A;  2M6M A;  2VJF B;  4ZUX U;  2XOY A;  2MT5 A;  5FB1 A;  3FM8 C;  1WIL A;  2ECW A;  4MSX A;  4UP0 A;  1N87 A;  2L7P A;  2AN6 A;  4YBS A;  2XP0 A;  5EYA F;  5C13 A;  1Z2Q A;  4B7Y C;  1K2F A;  1G25 A;  2KWO A;  5LKT A;  3RTR B;  2RR4 A;  3MHS A;  1CHC A;  2KKY A;  3U5N A;  3FEH A;  3SUB A;  2CRW A;  3H7H A;  2XOZ A;  5B78 A;  4Z0O A;  3N9N A;  1HYI A;  3IHP A;  2KGI A;  5B76 A;  2DX8 A;  2MNY A;  2D8S A;  2YQM A;  2MKE A;  2PNX A;  2CSY A;  3LQH A;  3SOU A;  5J3X A;  2VPG A;  4AYC B;  3RPG B;  5B75 A;  1E4U A;  3ZPV 1;  4ZDT A;  3T9K A;  2CSV A;  5KH3 A;  2IDA A;  4R8P K;  2LGV A;  5C11 A;  2OWA A;  3EB6 A;  4N3W A;  1VFY A;  2DSM A;  3O47 A;  3ZVZ B;  3SHB A;  5D1M B;  4QF2 A;  3L1X A;  2E6S A;  3JUE A;  4WA6 A;  2MD8 C;  4WZ3 B;  1MBM A;  2JMI A;  2CT2 A;  2LN0 A;  2FD4 A;  3O7A A;  2G6Q A;  2I50 A;  4I7D A;  2F6J A;  2K16 A;  2RSD A;  3LQJ A;  2KGG A;  2Y43 A;  4FO9 A;  2YHO A;  2K1J A;  2VPB A;  5H1V A;  3ZYQ A;  1IYM A;  3SOW A;  3ZTG A;  2LDR A;  3GL6 A;  5D1L B;  2KWK A;  3KQI A;  4Q6F A;  5FER A;  3PHD A;  2VP7 A;  1T1H A;  2L0B A;  5TDR A;  4YAB A;  3DWD A;  4UI9 B;  5TDW A;  3LDY A;  2M3H A;  2LGL A;  5AIU A;  4YAT A;  4UP5 A;  2E61 A;  2KE1 A;  2XEU A;  3DQV R;  3ZNI A;  2KR4 A;  3O37 A;  1Z6U A;  4GNG A;  2ECV A;  3KNV A;  2VJE A;  3U5O A;  2KWN A;  4O64 A;  4CCG X;  4MVT A;  2MD7 B;  5AIT A;  4LAD B;  2LGG A;  4NN2 A;  2C2L A;  2EXU A;  2KIZ A;  2C2V S;  2ECI A;  5DIN A;  5H1U A;  4IC3 A;  1MM2 A;  2E6R A;  5G0F A;  2KRE A;  2MIQ A;  4R7E A;  2EA6 A;  3HCS A;  2VJE B;  5G04 B;  5SVI A;  2JRJ A;  3HTK C;  2KU3 A;  2YU4 A;  2YW8 A;  4L7X A;  4F1P A;  1WEQ A;  4YAX A;  4AYC A;  3I2D A;  2QIC A;  5H1T A;  4QF3 A;  5SVI B;  4GB0 A;  4C9Z A;  2ECT A;  3VK6 A;  5KH9 A;  4LJN A;  4W4U A;  1WEM A;  5H9M A;  2ECJ A;  3V43 A;  2BAY A;  2K4D A;  4BHW A;  2UZG A;  5TBN A;  3M99 A;  2D8U A;  2VPE A;  2M85 A;  4R2Y A;  4YBM A;  3Q1D A;  2MUM A;  2CON A;  2L5U A;  2L80 A;  3N9O A;  2H0D A;  5TAB A;  2NAA A;  5SVY A;  2F42 A;  3N9L A;  3O33 A;  4GNE A;  4BBQ A;  3L1Z B;  2OXQ C;  4FJC A;  1WEU A;  3L11 A;  2L43 A;  4X3G A;  4AUQ B;  4V3K C;  3U5M A;  2H0D B;  1FBV A;  2VNF A;  5D1K B;  1HYJ A;  1WES A;  4WZ0 A;  3E2D A;  1XWH A;  1LDK C;  5LKZ A;  2LRI C;  5G05 B;  3T6R A;  1MM3 A;  2YSJ A;  4LLB A;  2L75 A;  2CKL A;  4I7C A;  4CA1 A;  2MNZ A;  1V87 A;  4YAD A;  2YQL A;  5TRB A;  3RPG C;  4LK9 A;  4ZQL A;  3PUQ A;  4LKA A;  1X4J A;  2K17 A;  2KWJ A;  2Y1M A;  5I3L A;  3ZVY A;  3M63 A;  2YT5 A;  1DVP A;  1LDJ B;  5FEY A;  2CKL B;  1WIM A;  2FFW A;  1VYX A;  3N9Q A;  2YYR A;  3LVQ E;  3KV5 A;  3KDE C;  3LVR E;  4F52 B;  2LQ6 A;  3FJU B;  3EB5 A;  2LXP C; 
#chains in the Genus database with same CATH homology
 4XI1 A;  2LXH C;  5B77 A;  3M62 A;  4GND A;  4L58 A;  1VD4 A;  2XB1 A;  2QIZ A;  1JM7 B;  3N9P A;  1X4U A;  2PUY A;  2RI7 A;  5B79 A;  1BOR A;  2MA6 A;  4N4F A;  4PTB A;  4I7B A;  2F6N A;  2EGP A;  5FB0 A;  3GV4 A;  4A49 A;  3ZPV E;  4A4C A;  1U6G B;  2YSM A;  3O70 A;  4FIP A;  4V3L C;  3HCU A;  1RMD A;  3LRQ A;  3PUR A;  3HCT A;  3MHH A;  3NG2 A;  2LGK A;  1Z60 A;  1X4I A;  2G43 A;  4P5O B;  2LV9 A;  2ECG A;  3ASL A;  3N9M A;  4S3O B;  5LKU A;  2EOD A;  2VPD A;  4PPE A;  4FK5 A;  1WEE A;  1WFK A;  2Y1N A;  1WE9 A;  1WGM A;  2HDP A;  5KH7 A;  3O36 A;  5B8D A;  4YBT A;  4YC9 A;  1WEV A;  3DPL R;  1WEP A;  4WZ2 A;  4TKP B;  4AP4 A;  3O35 A;  1WEW A;  2FUI A;  5DKA A;  2YUC A;  2MA5 A;  2FSA A;  2ZET C;  4B86 C;  2QJ0 A;  5LCW B;  4IC2 A;  2YRE A;  2HYE D;  3SOX A;  3T7L A;  3C6W A;  4A4B A;  3QZV A;  1F62 A;  2YUR A;  2JMD A;  1JOC A;  2G45 A;  3C5K A;  5JG6 A;  5LKX A;  4S3O C;  3LQI A;  4A0C D;  3U5P A;  1WEO A;  2ECN A;  3FL2 A;  1JM7 A;  4AVX A;  2FUU A;  4GNF A;  2JMJ A;  2VJF A;  3O34 A;  2CSZ A;  2KYU A;  1ZBD B;  2M1R A;  2KFT A;  2YHN A;  1FP0 A;  3KV6 A;  1WEN A;  2M6M A;  2VJF B;  4ZUX U;  2MT5 A;  5FB1 A;  1WIL A;  2ECW A;  4MSX A;  4UP0 A;  1N87 A;  2AN6 A;  4YBS A;  5EYA F;  5C13 A;  1Z2Q A;  4B7Y C;  1K2F A;  1G25 A;  2KWO A;  5LKT A;  3RTR B;  3MHS A;  1CHC A;  3U5N A;  5B78 A;  3N9N A;  1HYI A;  3IHP A;  2KGI A;  5B76 A;  2DX8 A;  2MNY A;  2D8S A;  2YQM A;  2PNX A;  2CSY A;  3LQH A;  3SOU A;  5J3X A;  2VPG A;  4AYC B;  3RPG B;  5B75 A;  1E4U A;  3ZPV 1;  4ZDT A;  5KH3 A;  2IDA A;  4R8P K;  2LGV A;  5C11 A;  3EB6 A;  4N3W A;  1VFY A;  3ZVZ B;  3SHB A;  5D1M B;  4QF2 A;  3L1X A;  2E6S A;  4WA6 A;  2MD8 C;  4WZ3 B;  2JMI A;  2CT2 A;  2LN0 A;  3O7A A;  2G6Q A;  2I50 A;  4I7D A;  2F6J A;  2K16 A;  2RSD A;  3LQJ A;  2KGG A;  2Y43 A;  4FO9 A;  2YHO A;  2K1J A;  2VPB A;  5H1V A;  3ZYQ A;  1IYM A;  3SOW A;  3ZTG A;  2LDR A;  3GL6 A;  5D1L B;  2KWK A;  3KQI A;  4Q6F A;  5FER A;  3PHD A;  2VP7 A;  1T1H A;  2L0B A;  5TDR A;  4YAB A;  4UI9 B;  5TDW A;  2M3H A;  2LGL A;  5AIU A;  4YAT A;  4UP5 A;  2XEU A;  2KE1 A;  3ZNI A;  3DQV R;  2KR4 A;  3O37 A;  1Z6U A;  4GNG A;  2ECV A;  3KNV A;  2VJE A;  3U5O A;  2KWN A;  4O64 A;  4CCG X;  4MVT A;  2MD7 B;  5AIT A;  4LAD B;  2LGG A;  4NN2 A;  2C2L A;  2KIZ A;  2C2V S;  2ECI A;  5DIN A;  5H1U A;  4IC3 A;  1MM2 A;  2E6R A;  5G0F A;  2KRE A;  2MIQ A;  4R7E A;  2EA6 A;  3HCS A;  2VJE B;  5G04 B;  2JRJ A;  3HTK C;  2KU3 A;  2YU4 A;  2YW8 A;  4L7X A;  1WEQ A;  4YAX A;  4AYC A;  3I2D A;  2QIC A;  5H1T A;  4QF3 A;  4GB0 A;  4C9Z A;  2ECT A;  3VK6 A;  5KH9 A;  4LJN A;  4W4U A;  1WEM A;  5H9M A;  2ECJ A;  3V43 A;  2BAY A;  2K4D A;  4BHW A;  2UZG A;  5TBN A;  3M99 A;  2VPE A;  2M85 A;  4R2Y A;  4YBM A;  2MUM A;  2L5U A;  2L80 A;  3N9O A;  2H0D A;  5TAB A;  2NAA A;  2F42 A;  3N9L A;  3O33 A;  4GNE A;  4BBQ A;  3L1Z B;  2OXQ C;  4FJC A;  1WEU A;  3L11 A;  2L43 A;  4X3G A;  4AUQ B;  4V3K C;  3U5M A;  2H0D B;  1FBV A;  2VNF A;  5D1K B;  1HYJ A;  1WES A;  4WZ0 A;  1XWH A;  1LDK C;  5LKZ A;  2LRI C;  5G05 B;  3T6R A;  1MM3 A;  2YSJ A;  4LLB A;  2L75 A;  2CKL A;  4I7C A;  4CA1 A;  2MNZ A;  1V87 A;  4YAD A;  2YQL A;  5TRB A;  3RPG C;  4LK9 A;  4ZQL A;  3PUQ A;  4LKA A;  1X4J A;  2K17 A;  2KWJ A;  2Y1M A;  5I3L A;  3ZVY A;  3M63 A;  2YT5 A;  1DVP A;  1LDJ B;  5FEY A;  2CKL B;  1WIM A;  1VYX A;  3N9Q A;  2YYR A;  3KV5 A;  4F52 B;  2LQ6 A;  3EB5 A;  2LXP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...