4O64A

Zinc fingers of kdm2b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
RRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Lysine-specific demethylase 2B
publication title DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16866 PHD_4 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4o64A01
2KREA 2YSJA 3QZVA 2IDAA 3SHBA 1WEQA 2ECWA 3LQJA 1LDJB 2KWJA 5D1LB 3SOXA 2M85A 2KWKA 1WESA 3MHHA 5TBNA 2I50A 5TRBA 4PPEA 3U5MA 1X4UA 3HCTA 4F52B 4YC9A 5H9MA 5FERA 2LGGA 2MA6A 4GNGA 2YW8A 1WE9A 4ZDTA 2G43A 4BBQA 4MSXA 5DKAA 4N4FA 4LLBA 2M1RA 5FB1A 2VP7A 1G25A 2KE1A 5J3XA 3RTRB 2LV9A 2E6SA 2G6QA 2YSMA 3ZPV1 3U5NA 4YATA 4S3OB 1WGMA 5G05B 4GB0A 5TDWA 3O70A 3T7LA 2RI7A 3LRQA 1WENA 3N9LA 4X3GA 2LGLA 2Y1NA 4V3KC 4V3LC 2PUYA 4TKPB 2KR4A 2KU3A 5D1MB 5DINA 4UP5A 2FSAA 2PNXA 3C6WA 4LJNA 1IYMA 1E4UA 3RPGC 2VPGA 3M99A 1Z2QA 5FB0A 2VJEB 4GNDA 5EYAF 1Z6UA 3PUQA 3ZTGA 2NAAA 1V87A 2ECGA 2F6NA 2JRJA 2LXHC 2OXQC 2M3HA 1VYXA 1N87A 2MIQA 2MD8C 4L58A 4LADB 1JOCA 2LXPC 4YAXA 2CSZA 1WIMA 3N9MA 5LKUA 4A49A 1JM7B 5H1UA 2LQ6A 1X4IA 2MNZA 3KNVA 2D8SA 4YADA 3L1ZB 2YHOA 3V43A 4AP4A 4MVTA 2AN6A 2H0DB 2RSDA 2MA5A 2UZGA 3VK6A 2VJFB 1FBVA 3O7AA 4WZ0A 5LKXA 2LDRA 4YBSA 5B78A 4N3WA 3ZYQA 1XWHA 4NN2A 2QICA 4C9ZA 5TABA 4WA6A 2EA6A 4ZQLA 5H1VA 5KH3A 4QF2A 2ZETC 4PTBA 2CKLB 4L7XA 4B86C 2MD7B 4FK5A 4BHWA 1MM2A 2L0BA 3PURA 3ZNIA 2LRIC 1FP0A 2HDPA 2DX8A 2XEUA 3SOWA 3O35A 3ZPVE 5JG6A 3LQIA 3PHDA 2VPEA 1WEUA 5AIUA 2MUMA 2K4DA 4WZ3B 4AUQB 5C11A 5B79A 5B75A 1T1HA 2ECNA 3KQIA 2MT5A 1WEEA 2KIZA 2KWOA 5G04B 2XB1A 2FUIA 2ECTA 5TDRA 5H1TA 1DVPA 2VJEA 2YREA 2BAYA 3KV5A 4R8PK 3O37A 3C5KA 3N9PA 1WEVA 4I7BA 1WEPA 5FEYA 2KWNA 4I7CA 4AYCA 3HTKC 3M63A 4FJCA 4A4BA 3T6RA 2KYUA 4FO9A 2JMIA 4I7DA 2FUUA 2F42A 1Z60A 2LGVA 2E6RA 3NG2A 3EB5A 4LKAA 5B76A 2Y43A 2QJ0A 1K2FA 1BORA 3HCSA 4UI9B 4IC2A 1F62A 3L11A 5LKTA 2LN0A 3KV6A 2H0DA 2QIZA 4A0CD 2G45A 2VJFA 5G0FA 2Y1MA 1LDKC 3RPGB 3LQHA 4S3OC 4FIPA 1U6GB 2YURA 2VPBA 3DQVR 1CHCA 3U5PA 1MM3A 3MHSA 4YBMA 2CKLA 4P5OB 4IC3A 2F6JA 4CA1A 3O34A 3GV4A 2YQMA 4WZ2A 3M62A 5KH7A 5LKZA 3N9NA 2ECVA 2JMJA 3N9QA 3EB6A 5I3LA 5B8DA 2VPDA 1WEOA 4R7EA 2CSYA 1VD4A 3ZVZB 4QF3A 3FL2A 2HYED 3HCUA 2VNFA 3I2DA 4LK9A 1ZBDB 1HYIA 2YQLA 4GNFA 2L75A 2KGIA 5B77A 1WEWA 2MNYA 4R2YA 2M6MA 1VFYA 1WFKA 1WEMA 5LCWB 2CT2A 4W4UA 1RMDA 3O36A 4A4CA 2C2VS 5C13A 3IHPA 3DPLR 5D1KB 2KGGA 1X4JA 2L43A 4CCGX 4O64A 4B7YC 4YABA 1HYJA 2C2LA 2L80A 2YUCA 1JM7A 3ASLA 3ZVYA 3N9OA 3SOUA 2YHNA 2K1JA 2L5UA 4AYCB 4AVXA 2K16A 1WILA 3O33A 4GNEA 2ECJA 2YU4A 4UP0A 3U5OA 3L1XA 2EGPA 2YYRA 5KH9A 2K17A 3GL6A 2ECIA 4XI1A 2YT5A 5AITA 2KFTA 2LGKA 2EODA 4YBTA 2JMDA 4Q6FA 4ZUXU
chains in the Genus database with same CATH superfamily
2KREA 2YSJA 2YVRA 3QZVA 2IDAA 2P57A 2DJAA 3SHBA 1WEQA 2ECWA 3LQJA 1LDJB 2KWJA 5D1LB 3SOXA 2CONA 2M85A 2KWKA 1WESA 3MHHA 5TBNA 2I50A 5TRBA 4PPEA 3U5MA 1X4UA 3HCTA 4F52B 4YC9A 1MBMA 5H9MA 5FERA 2LGGA 2MA6A 3E2DA 4GNGA 2YW8A 1WE9A 3LDYA 4ZDTA 2G43A 2FD4A 4BBQA 4MSXA 5DKAA 4N4FA 4LLBA 2M1RA 5FB1A 2VP7A 1G25A 2KE1A 2EGMA 5J3XA 3RTRB 2LV9A 2E6SA 2G6QA 4F1PA 2YSMA 3ZPV1 3DDTA 3U5NA 4YATA 4S3OB 1WGMA 5G05B 4GB0A 5TDWA 3O70A 3T7LA 2RI7A 3LRQA 2LAUA 1WENA 3N9LA 4X3GA 2JM3A 2LGLA 2Y1NA 4V3KC 4V3LC 2PUYA 2RR4A 3T9KA 4Z0RA 4TKPB 3Q1DA 2KR4A 2KU3A 5D1MB 5DINA 4UP5A 2FSAA 2PNXA 3C6WA 3FANA 4LJNA 3KDEC 1IYMA 1E4UA 3RPGC 3JUEA 2VPGA 3M99A 1Z2QA 5FB0A 2VJEB 3H7HA 4GNDA 5EYAF 1Z6UA 3PUQA 3ZTGA 2NAAA 1V87A 2ECGA 2F6NA 2JRJA 2LXHC 2OXQC 2M3HA 1VYXA 1N87A 2MIQA 2MD8C 4L58A 4LADB 2D8UA 1JOCA 2LXPC 4YAXA 2CSZA 1WIMA 3N9MA 5LKUA 4A49A 1JM7B 5H1UA 2LQ6A 1X4IA 2MNZA 3KNVA 2D8SA 4YADA 3L1ZB 2YHOA 3V43A 4AP4A 4MVTA 2AN6A 2H0DB 2RSDA 2MA5A 2UZGA 3VK6A 2VJFB 1FBVA 3O7AA 4WZ0A 5LKXA 2LDRA 4YBSA 5B78A 4N3WA 3ZYQA 1XWHA 4NN2A 2QICA 3DWDA 4C9ZA 5TABA 4WA6A 2CRWA 2EA6A 4ZQLA 5H1VA 5KH3A 4QF2A 2ZETC 4PTBA 2CKLB 4L7XA 2KKYA 2FFWA 4B86C 2MD7B 4FK5A 4BHWA 1MM2A 2L0BA 3PURA 3ZNIA 3MDBC 2MKEA 2LRIC 1FP0A 2HDPA 2KKXA 2IQJA 2DX8A 2XEUA 3SOWA 3O35A 3ZPVE 5JG6A 5K3QA 2B0OE 3LQIA 5SVIA 3PHDA 4Z0OA 2VPEA 1WEUA 5AIUA 2MUMA 2K4DA 4WZ3B 4AUQB 5C11A 5SVYA 3SUBA 5B79A 5B75A 1T1HA 2ECNA 3KQIA 2MT5A 1WEEA 2KIZA 2KWOA 4QQ4A 5G04B 2XB1A 2FUIA 2ECTA 5TDRA 2CSVA 5H1TA 2DSMA 1DVPA 2VJEA 2YREA 2BAYA 4OGCA 3KV5A 4R8PK 3LVQE 3O37A 3C5KA 3N9PA 1WEVA 4I7BA 1WEPA 5FEYA 2KWNA 4I7CA 4AYCA 3HTKC 3M63A 4FJCA 4A4BA 3O47A 3T6RA 2KYUA 4FO9A 2JMIA 4I7DA 2FUUA 2F42A 3FAOA 1Z60A 2LGVA 2E6RA 3NG2A 3EB5A 4LKAA 5B76A 2Y43A 4OGEA 2QJ0A 1K2FA 1BORA 3HCSA 4UI9B 4H9DA 4IC2A 1F62A 3L11A 5LKTA 2LN0A 3KV6A 2H0DA 2QIZA 4A0CD 2G45A 2VJFA 5G0FA 2Y1MA 2XOCA 1LDKC 3RPGB 3LQHA 4S3OC 4FIPA 1U6GB 2YURA 3PLWA 2VPBA 3DQVR 1CHCA 3U5PA 1MM3A 3MHSA 4YBMA 2CKLA 4P5OB 4IC3A 2F6JA 4CA1A 3M7KA 3O34A 3GV4A 2YQMA 4WZ2A 3M62A 5KH7A 5LKZA 2M13A 3N9NA 2ECVA 2JMJA 3N9QA 3FM8C 2EXUA 3EB6A 5I3LA 5B8DA 2E61A 2VPDA 1WEOA 4R7EA 2CSYA 1VD4A 3LVRE 3ZVZB 4QF3A 3FL2A 2HYED 3HCUA 2VNFA 3I2DA 4LK9A 1ZBDB 1HYIA 2YQLA 2L7PA 4GNFA 1DCQA 2L75A 2KGIA 5SVIB 5B77A 1WEWA 2MNYA 4R2YA 2XOYA 2M6MA 1VFYA 1WFKA 1WEMA 5LCWB 2CT2A 4W4UA 2XP0A 1RMDA 3O36A 4A4CA 2JUNA 2C2VS 5C13A 3IHPA 3DPLR 5D1KB 2KGGA 1X4JA 2L43A 4CCGX 4O64A 4B7YC 4YABA 4O62A 1HYJA 2C2LA 2L80A 3FEHA 2CRRA 2OWAA 2YUCA 1JM7A 3ASLA 3ZVYA 3N9OA 3SOUA 2YHNA 2K1JA 2L5UA 4AYCB 4AVXA 2K16A 1WILA 3O33A 4GNEA 2ECJA 5SVXA 2YU4A 4UP0A 3U5OA 3L1XA 2EGPA 2YYRA 5KH9A 2K17A 3GL6A 2ECIA 4XI1A 2YT5A 5AITA 2KFTA 2LGKA 2XOZA 2EODA 4YBTA 2JMDA 4Q6FA 4ZUXU 3FJUB 3LJUX
chains in the Genus database with same CATH topology
2KREA 2YSJA 3QZVA 2IDAA 3SHBA 1WEQA 2ECWA 3LQJA 1LDJB 2KWJA 5D1LB 3SOXA 2M85A 2KWKA 1WESA 3MHHA 5TBNA 2I50A 5TRBA 4PPEA 3U5MA 1X4UA 3HCTA 4F52B 4YC9A 5H9MA 5FERA 2LGGA 2MA6A 4GNGA 2YW8A 1WE9A 4ZDTA 2G43A 4BBQA 4MSXA 5DKAA 4N4FA 4LLBA 2M1RA 5FB1A 2VP7A 1G25A 2KE1A 5J3XA 3RTRB 2LV9A 2E6SA 2G6QA 2YSMA 3ZPV1 3U5NA 4YATA 4S3OB 1WGMA 5G05B 4GB0A 5TDWA 3O70A 3T7LA 2RI7A 3LRQA 1WENA 3N9LA 4X3GA 2LGLA 2Y1NA 4V3KC 4V3LC 2PUYA 4TKPB 2KR4A 2KU3A 5D1MB 5DINA 4UP5A 2FSAA 2PNXA 3C6WA 4LJNA 1IYMA 1E4UA 3RPGC 2VPGA 3M99A 1Z2QA 5FB0A 2VJEB 4GNDA 5EYAF 1Z6UA 3PUQA 3ZTGA 2NAAA 1V87A 2ECGA 2F6NA 2JRJA 2LXHC 2OXQC 2M3HA 1VYXA 1N87A 2MIQA 2MD8C 4L58A 4LADB 1JOCA 2LXPC 4YAXA 2CSZA 1WIMA 3N9MA 5LKUA 4A49A 1JM7B 5H1UA 2LQ6A 1X4IA 2MNZA 3KNVA 2D8SA 4YADA 3L1ZB 2YHOA 3V43A 4AP4A 4MVTA 2AN6A 2H0DB 2RSDA 2MA5A 2UZGA 3VK6A 2VJFB 1FBVA 3O7AA 4WZ0A 5LKXA 2LDRA 4YBSA 5B78A 4N3WA 3ZYQA 1XWHA 4NN2A 2QICA 4C9ZA 5TABA 4WA6A 2EA6A 4ZQLA 5H1VA 5KH3A 4QF2A 2ZETC 4PTBA 2CKLB 4L7XA 4B86C 2MD7B 4FK5A 4BHWA 1MM2A 2L0BA 3PURA 3ZNIA 2LRIC 1FP0A 2HDPA 2DX8A 2XEUA 3SOWA 3O35A 3ZPVE 5JG6A 3LQIA 3PHDA 2VPEA 1WEUA 5AIUA 2MUMA 2K4DA 4WZ3B 4AUQB 5C11A 5B79A 5B75A 1T1HA 2ECNA 3KQIA 2MT5A 1WEEA 2KIZA 2KWOA 5G04B 2XB1A 2FUIA 2ECTA 5TDRA 5H1TA 1DVPA 2VJEA 2YREA 2BAYA 3KV5A 4R8PK 3O37A 3C5KA 3N9PA 1WEVA 4I7BA 1WEPA 5FEYA 2KWNA 4I7CA 4AYCA 3HTKC 3M63A 4FJCA 4A4BA 3T6RA 2KYUA 4FO9A 2JMIA 4I7DA 2FUUA 2F42A 1Z60A 2LGVA 2E6RA 3NG2A 3EB5A 4LKAA 5B76A 2Y43A 2QJ0A 1K2FA 1BORA 3HCSA 4UI9B 4IC2A 1F62A 3L11A 5LKTA 2LN0A 3KV6A 2H0DA 2QIZA 4A0CD 2G45A 2VJFA 5G0FA 2Y1MA 1LDKC 3RPGB 3LQHA 4S3OC 4FIPA 1U6GB 2YURA 2VPBA 3DQVR 1CHCA 3U5PA 1MM3A 3MHSA 4YBMA 2CKLA 4P5OB 4IC3A 2F6JA 4CA1A 3O34A 3GV4A 2YQMA 4WZ2A 3M62A 5KH7A 5LKZA 3N9NA 2ECVA 2JMJA 3N9QA 3EB6A 5I3LA 5B8DA 2VPDA 1WEOA 4R7EA 2CSYA 1VD4A 3ZVZB 4QF3A 3FL2A 2HYED 3HCUA 2VNFA 3I2DA 4LK9A 1ZBDB 1HYIA 2YQLA 4GNFA 2L75A 2KGIA 5B77A 1WEWA 2MNYA 4R2YA 2M6MA 1VFYA 1WFKA 1WEMA 5LCWB 2CT2A 4W4UA 1RMDA 3O36A 4A4CA 2C2VS 5C13A 3IHPA 3DPLR 5D1KB 2KGGA 1X4JA 2L43A 4CCGX 4O64A 4B7YC 4YABA 1HYJA 2C2LA 2L80A 2YUCA 1JM7A 3ASLA 3ZVYA 3N9OA 3SOUA 2YHNA 2K1JA 2L5UA 4AYCB 4AVXA 2K16A 1WILA 3O33A 4GNEA 2ECJA 2YU4A 4UP0A 3U5OA 3L1XA 2EGPA 2YYRA 5KH9A 2K17A 3GL6A 2ECIA 4XI1A 2YT5A 5AITA 2KFTA 2LGKA 2EODA 4YBTA 2JMDA 4Q6FA 4ZUXU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRE A;  2YSJ A;  3QZV A;  2IDA A;  3SHB A;  1WEQ A;  2ECW A;  3LQJ A;  1LDJ B;  2KWJ A;  5D1L B;  3SOX A;  2M85 A;  2KWK A;  1WES A;  3MHH A;  5TBN A;  2I50 A;  5TRB A;  4PPE A;  3U5M A;  1X4U A;  3HCT A;  4F52 B;  4YC9 A;  5H9M A;  5FER A;  2LGG A;  2MA6 A;  4GNG A;  2YW8 A;  1WE9 A;  4ZDT A;  2G43 A;  4BBQ A;  4MSX A;  5DKA A;  4N4F A;  4LLB A;  2M1R A;  5FB1 A;  2VP7 A;  1G25 A;  2KE1 A;  5J3X A;  3RTR B;  2LV9 A;  2E6S A;  2G6Q A;  2YSM A;  3ZPV 1;  3U5N A;  4YAT A;  4S3O B;  1WGM A;  5G05 B;  4GB0 A;  5TDW A;  3O70 A;  3T7L A;  2RI7 A;  3LRQ A;  1WEN A;  3N9L A;  4X3G A;  2LGL A;  2Y1N A;  4V3K C;  4V3L C;  2PUY A;  4TKP B;  2KR4 A;  2KU3 A;  5D1M B;  5DIN A;  4UP5 A;  2FSA A;  2PNX A;  3C6W A;  4LJN A;  1IYM A;  1E4U A;  3RPG C;  2VPG A;  3M99 A;  1Z2Q A;  5FB0 A;  2VJE B;  4GND A;  5EYA F;  1Z6U A;  3PUQ A;  3ZTG A;  2NAA A;  1V87 A;  2ECG A;  2F6N A;  2JRJ A;  2LXH C;  2OXQ C;  2M3H A;  1VYX A;  1N87 A;  2MIQ A;  2MD8 C;  4L58 A;  4LAD B;  1JOC A;  2LXP C;  4YAX A;  2CSZ A;  1WIM A;  3N9M A;  5LKU A;  4A49 A;  1JM7 B;  5H1U A;  2LQ6 A;  1X4I A;  2MNZ A;  3KNV A;  2D8S A;  4YAD A;  3L1Z B;  2YHO A;  3V43 A;  4AP4 A;  4MVT A;  2AN6 A;  2H0D B;  2RSD A;  2MA5 A;  2UZG A;  3VK6 A;  2VJF B;  1FBV A;  3O7A A;  4WZ0 A;  5LKX A;  2LDR A;  4YBS A;  5B78 A;  4N3W A;  3ZYQ A;  1XWH A;  4NN2 A;  2QIC A;  4C9Z A;  5TAB A;  4WA6 A;  2EA6 A;  4ZQL A;  5H1V A;  5KH3 A;  4QF2 A;  2ZET C;  4PTB A;  2CKL B;  4L7X A;  4B86 C;  2MD7 B;  4FK5 A;  4BHW A;  1MM2 A;  2L0B A;  3PUR A;  3ZNI A;  2LRI C;  1FP0 A;  2HDP A;  2DX8 A;  2XEU A;  3SOW A;  3O35 A;  3ZPV E;  5JG6 A;  3LQI A;  3PHD A;  2VPE A;  1WEU A;  5AIU A;  2MUM A;  2K4D A;  4WZ3 B;  4AUQ B;  5C11 A;  5B79 A;  5B75 A;  1T1H A;  2ECN A;  3KQI A;  2MT5 A;  1WEE A;  2KIZ A;  2KWO A;  5G04 B;  2XB1 A;  2FUI A;  2ECT A;  5TDR A;  5H1T A;  1DVP A;  2VJE A;  2YRE A;  2BAY A;  3KV5 A;  4R8P K;  3O37 A;  3C5K A;  3N9P A;  1WEV A;  4I7B A;  1WEP A;  5FEY A;  2KWN A;  4I7C A;  4AYC A;  3HTK C;  3M63 A;  4FJC A;  4A4B A;  3T6R A;  2KYU A;  4FO9 A;  2JMI A;  4I7D A;  2FUU A;  2F42 A;  1Z60 A;  2LGV A;  2E6R A;  3NG2 A;  3EB5 A;  4LKA A;  5B76 A;  2Y43 A;  2QJ0 A;  1K2F A;  1BOR A;  3HCS A;  4UI9 B;  4IC2 A;  1F62 A;  3L11 A;  5LKT A;  2LN0 A;  3KV6 A;  2H0D A;  2QIZ A;  4A0C D;  2G45 A;  2VJF A;  5G0F A;  2Y1M A;  1LDK C;  3RPG B;  3LQH A;  4S3O C;  4FIP A;  1U6G B;  2YUR A;  2VPB A;  3DQV R;  1CHC A;  3U5P A;  1MM3 A;  3MHS A;  4YBM A;  2CKL A;  4P5O B;  4IC3 A;  2F6J A;  4CA1 A;  3O34 A;  3GV4 A;  2YQM A;  4WZ2 A;  3M62 A;  5KH7 A;  5LKZ A;  3N9N A;  2ECV A;  2JMJ A;  3N9Q A;  3EB6 A;  5I3L A;  5B8D A;  2VPD A;  1WEO A;  4R7E A;  2CSY A;  1VD4 A;  3ZVZ B;  4QF3 A;  3FL2 A;  2HYE D;  3HCU A;  2VNF A;  3I2D A;  4LK9 A;  1ZBD B;  1HYI A;  2YQL A;  4GNF A;  2L75 A;  2KGI A;  5B77 A;  1WEW A;  2MNY A;  4R2Y A;  2M6M A;  1VFY A;  1WFK A;  1WEM A;  5LCW B;  2CT2 A;  4W4U A;  1RMD A;  3O36 A;  4A4C A;  2C2V S;  5C13 A;  3IHP A;  3DPL R;  5D1K B;  2KGG A;  1X4J A;  2L43 A;  4CCG X;  4O64 A;  4B7Y C;  4YAB A;  1HYJ A;  2C2L A;  2L80 A;  2YUC A;  1JM7 A;  3ASL A;  3ZVY A;  3N9O A;  3SOU A;  2YHN A;  2K1J A;  2L5U A;  4AYC B;  4AVX A;  2K16 A;  1WIL A;  3O33 A;  4GNE A;  2ECJ A;  2YU4 A;  4UP0 A;  3U5O A;  3L1X A;  2EGP A;  2YYR A;  5KH9 A;  2K17 A;  3GL6 A;  2ECI A;  4XI1 A;  2YT5 A;  5AIT A;  2KFT A;  2LGK A;  2EOD A;  4YBT A;  2JMD A;  4Q6F A;  4ZUX U; 
#chains in the Genus database with same CATH topology
 2KRE A;  2YSJ A;  2YVR A;  3QZV A;  2IDA A;  2P57 A;  2DJA A;  3SHB A;  1WEQ A;  2ECW A;  3LQJ A;  1LDJ B;  2KWJ A;  5D1L B;  3SOX A;  2CON A;  2M85 A;  2KWK A;  1WES A;  3MHH A;  5TBN A;  2I50 A;  5TRB A;  4PPE A;  3U5M A;  1X4U A;  3HCT A;  4F52 B;  4YC9 A;  1MBM A;  5H9M A;  5FER A;  2LGG A;  2MA6 A;  3E2D A;  4GNG A;  2YW8 A;  1WE9 A;  3LDY A;  4ZDT A;  2G43 A;  2FD4 A;  4BBQ A;  4MSX A;  5DKA A;  4N4F A;  4LLB A;  2M1R A;  5FB1 A;  2VP7 A;  1G25 A;  2KE1 A;  2EGM A;  5J3X A;  3RTR B;  2LV9 A;  2E6S A;  2G6Q A;  4F1P A;  2YSM A;  3ZPV 1;  3DDT A;  3U5N A;  4YAT A;  4S3O B;  1WGM A;  5G05 B;  4GB0 A;  5TDW A;  3O70 A;  3T7L A;  2RI7 A;  3LRQ A;  2LAU A;  1WEN A;  3N9L A;  4X3G A;  2JM3 A;  2LGL A;  2Y1N A;  4V3K C;  4V3L C;  2PUY A;  2RR4 A;  3T9K A;  4Z0R A;  4TKP B;  3Q1D A;  2KR4 A;  2KU3 A;  5D1M B;  5DIN A;  4UP5 A;  2FSA A;  2PNX A;  3C6W A;  3FAN A;  4LJN A;  3KDE C;  1IYM A;  1E4U A;  3RPG C;  3JUE A;  2VPG A;  3M99 A;  1Z2Q A;  5FB0 A;  2VJE B;  3H7H A;  4GND A;  5EYA F;  1Z6U A;  3PUQ A;  3ZTG A;  2NAA A;  1V87 A;  2ECG A;  2F6N A;  2JRJ A;  2LXH C;  2OXQ C;  2M3H A;  1VYX A;  1N87 A;  2MIQ A;  2MD8 C;  4L58 A;  4LAD B;  2D8U A;  1JOC A;  2LXP C;  4YAX A;  2CSZ A;  1WIM A;  3N9M A;  5LKU A;  4A49 A;  1JM7 B;  5H1U A;  2LQ6 A;  1X4I A;  2MNZ A;  3KNV A;  2D8S A;  4YAD A;  3L1Z B;  2YHO A;  3V43 A;  4AP4 A;  4MVT A;  2AN6 A;  2H0D B;  2RSD A;  2MA5 A;  2UZG A;  3VK6 A;  2VJF B;  1FBV A;  3O7A A;  4WZ0 A;  5LKX A;  2LDR A;  4YBS A;  5B78 A;  4N3W A;  3ZYQ A;  1XWH A;  4NN2 A;  2QIC A;  3DWD A;  4C9Z A;  5TAB A;  4WA6 A;  2CRW A;  2EA6 A;  4ZQL A;  5H1V A;  5KH3 A;  4QF2 A;  2ZET C;  4PTB A;  2CKL B;  4L7X A;  2KKY A;  2FFW A;  4B86 C;  2MD7 B;  4FK5 A;  4BHW A;  1MM2 A;  2L0B A;  3PUR A;  3ZNI A;  3MDB C;  2MKE A;  2LRI C;  1FP0 A;  2HDP A;  2KKX A;  2IQJ A;  2DX8 A;  2XEU A;  3SOW A;  3O35 A;  3ZPV E;  5JG6 A;  5K3Q A;  2B0O E;  3LQI A;  5SVI A;  3PHD A;  4Z0O A;  2VPE A;  1WEU A;  5AIU A;  2MUM A;  2K4D A;  4WZ3 B;  4AUQ B;  5C11 A;  5SVY A;  3SUB A;  5B79 A;  5B75 A;  1T1H A;  2ECN A;  3KQI A;  2MT5 A;  1WEE A;  2KIZ A;  2KWO A;  4QQ4 A;  5G04 B;  2XB1 A;  2FUI A;  2ECT A;  5TDR A;  2CSV A;  5H1T A;  2DSM A;  1DVP A;  2VJE A;  2YRE A;  2BAY A;  4OGC A;  3KV5 A;  4R8P K;  3LVQ E;  3O37 A;  3C5K A;  3N9P A;  1WEV A;  4I7B A;  1WEP A;  5FEY A;  2KWN A;  4I7C A;  4AYC A;  3HTK C;  3M63 A;  4FJC A;  4A4B A;  3O47 A;  3T6R A;  2KYU A;  4FO9 A;  2JMI A;  4I7D A;  2FUU A;  2F42 A;  3FAO A;  1Z60 A;  2LGV A;  2E6R A;  3NG2 A;  3EB5 A;  4LKA A;  5B76 A;  2Y43 A;  4OGE A;  2QJ0 A;  1K2F A;  1BOR A;  3HCS A;  4UI9 B;  4H9D A;  4IC2 A;  1F62 A;  3L11 A;  5LKT A;  2LN0 A;  3KV6 A;  2H0D A;  2QIZ A;  4A0C D;  2G45 A;  2VJF A;  5G0F A;  2Y1M A;  2XOC A;  1LDK C;  3RPG B;  3LQH A;  4S3O C;  4FIP A;  1U6G B;  2YUR A;  3PLW A;  2VPB A;  3DQV R;  1CHC A;  3U5P A;  1MM3 A;  3MHS A;  4YBM A;  2CKL A;  4P5O B;  4IC3 A;  2F6J A;  4CA1 A;  3M7K A;  3O34 A;  3GV4 A;  2YQM A;  4WZ2 A;  3M62 A;  5KH7 A;  5LKZ A;  2M13 A;  3N9N A;  2ECV A;  2JMJ A;  3N9Q A;  3FM8 C;  2EXU A;  3EB6 A;  5I3L A;  5B8D A;  2E61 A;  2VPD A;  1WEO A;  4R7E A;  2CSY A;  1VD4 A;  3LVR E;  3ZVZ B;  4QF3 A;  3FL2 A;  2HYE D;  3HCU A;  2VNF A;  3I2D A;  4LK9 A;  1ZBD B;  1HYI A;  2YQL A;  2L7P A;  4GNF A;  1DCQ A;  2L75 A;  2KGI A;  5SVI B;  5B77 A;  1WEW A;  2MNY A;  4R2Y A;  2XOY A;  2M6M A;  1VFY A;  1WFK A;  1WEM A;  5LCW B;  2CT2 A;  4W4U A;  2XP0 A;  1RMD A;  3O36 A;  4A4C A;  2JUN A;  2C2V S;  5C13 A;  3IHP A;  3DPL R;  5D1K B;  2KGG A;  1X4J A;  2L43 A;  4CCG X;  4O64 A;  4B7Y C;  4YAB A;  4O62 A;  1HYJ A;  2C2L A;  2L80 A;  3FEH A;  2CRR A;  2OWA A;  2YUC A;  1JM7 A;  3ASL A;  3ZVY A;  3N9O A;  3SOU A;  2YHN A;  2K1J A;  2L5U A;  4AYC B;  4AVX A;  2K16 A;  1WIL A;  3O33 A;  4GNE A;  2ECJ A;  5SVX A;  2YU4 A;  4UP0 A;  3U5O A;  3L1X A;  2EGP A;  2YYR A;  5KH9 A;  2K17 A;  3GL6 A;  2ECI A;  4XI1 A;  2YT5 A;  5AIT A;  2KFT A;  2LGK A;  2XOZ A;  2EOD A;  4YBT A;  2JMD A;  4Q6F A;  4ZUX U;  3FJU B;  3LJU X; 
#chains in the Genus database with same CATH homology
 2KRE A;  2YSJ A;  3QZV A;  2IDA A;  3SHB A;  1WEQ A;  2ECW A;  3LQJ A;  1LDJ B;  2KWJ A;  5D1L B;  3SOX A;  2M85 A;  2KWK A;  1WES A;  3MHH A;  5TBN A;  2I50 A;  5TRB A;  4PPE A;  3U5M A;  1X4U A;  3HCT A;  4F52 B;  4YC9 A;  5H9M A;  5FER A;  2LGG A;  2MA6 A;  4GNG A;  2YW8 A;  1WE9 A;  4ZDT A;  2G43 A;  4BBQ A;  4MSX A;  5DKA A;  4N4F A;  4LLB A;  2M1R A;  5FB1 A;  2VP7 A;  1G25 A;  2KE1 A;  5J3X A;  3RTR B;  2LV9 A;  2E6S A;  2G6Q A;  2YSM A;  3ZPV 1;  3U5N A;  4YAT A;  4S3O B;  1WGM A;  5G05 B;  4GB0 A;  5TDW A;  3O70 A;  3T7L A;  2RI7 A;  3LRQ A;  1WEN A;  3N9L A;  4X3G A;  2LGL A;  2Y1N A;  4V3K C;  4V3L C;  2PUY A;  4TKP B;  2KR4 A;  2KU3 A;  5D1M B;  5DIN A;  4UP5 A;  2FSA A;  2PNX A;  3C6W A;  4LJN A;  1IYM A;  1E4U A;  3RPG C;  2VPG A;  3M99 A;  1Z2Q A;  5FB0 A;  2VJE B;  4GND A;  5EYA F;  1Z6U A;  3PUQ A;  3ZTG A;  2NAA A;  1V87 A;  2ECG A;  2F6N A;  2JRJ A;  2LXH C;  2OXQ C;  2M3H A;  1VYX A;  1N87 A;  2MIQ A;  2MD8 C;  4L58 A;  4LAD B;  1JOC A;  2LXP C;  4YAX A;  2CSZ A;  1WIM A;  3N9M A;  5LKU A;  4A49 A;  1JM7 B;  5H1U A;  2LQ6 A;  1X4I A;  2MNZ A;  3KNV A;  2D8S A;  4YAD A;  3L1Z B;  2YHO A;  3V43 A;  4AP4 A;  4MVT A;  2AN6 A;  2H0D B;  2RSD A;  2MA5 A;  2UZG A;  3VK6 A;  2VJF B;  1FBV A;  3O7A A;  4WZ0 A;  5LKX A;  2LDR A;  4YBS A;  5B78 A;  4N3W A;  3ZYQ A;  1XWH A;  4NN2 A;  2QIC A;  4C9Z A;  5TAB A;  4WA6 A;  2EA6 A;  4ZQL A;  5H1V A;  5KH3 A;  4QF2 A;  2ZET C;  4PTB A;  2CKL B;  4L7X A;  4B86 C;  2MD7 B;  4FK5 A;  4BHW A;  1MM2 A;  2L0B A;  3PUR A;  3ZNI A;  2LRI C;  1FP0 A;  2HDP A;  2DX8 A;  2XEU A;  3SOW A;  3O35 A;  3ZPV E;  5JG6 A;  3LQI A;  3PHD A;  2VPE A;  1WEU A;  5AIU A;  2MUM A;  2K4D A;  4WZ3 B;  4AUQ B;  5C11 A;  5B79 A;  5B75 A;  1T1H A;  2ECN A;  3KQI A;  2MT5 A;  1WEE A;  2KIZ A;  2KWO A;  5G04 B;  2XB1 A;  2FUI A;  2ECT A;  5TDR A;  5H1T A;  1DVP A;  2VJE A;  2YRE A;  2BAY A;  3KV5 A;  4R8P K;  3O37 A;  3C5K A;  3N9P A;  1WEV A;  4I7B A;  1WEP A;  5FEY A;  2KWN A;  4I7C A;  4AYC A;  3HTK C;  3M63 A;  4FJC A;  4A4B A;  3T6R A;  2KYU A;  4FO9 A;  2JMI A;  4I7D A;  2FUU A;  2F42 A;  1Z60 A;  2LGV A;  2E6R A;  3NG2 A;  3EB5 A;  4LKA A;  5B76 A;  2Y43 A;  2QJ0 A;  1K2F A;  1BOR A;  3HCS A;  4UI9 B;  4IC2 A;  1F62 A;  3L11 A;  5LKT A;  2LN0 A;  3KV6 A;  2H0D A;  2QIZ A;  4A0C D;  2G45 A;  2VJF A;  5G0F A;  2Y1M A;  1LDK C;  3RPG B;  3LQH A;  4S3O C;  4FIP A;  1U6G B;  2YUR A;  2VPB A;  3DQV R;  1CHC A;  3U5P A;  1MM3 A;  3MHS A;  4YBM A;  2CKL A;  4P5O B;  4IC3 A;  2F6J A;  4CA1 A;  3O34 A;  3GV4 A;  2YQM A;  4WZ2 A;  3M62 A;  5KH7 A;  5LKZ A;  3N9N A;  2ECV A;  2JMJ A;  3N9Q A;  3EB6 A;  5I3L A;  5B8D A;  2VPD A;  1WEO A;  4R7E A;  2CSY A;  1VD4 A;  3ZVZ B;  4QF3 A;  3FL2 A;  2HYE D;  3HCU A;  2VNF A;  3I2D A;  4LK9 A;  1ZBD B;  1HYI A;  2YQL A;  4GNF A;  2L75 A;  2KGI A;  5B77 A;  1WEW A;  2MNY A;  4R2Y A;  2M6M A;  1VFY A;  1WFK A;  1WEM A;  5LCW B;  2CT2 A;  4W4U A;  1RMD A;  3O36 A;  4A4C A;  2C2V S;  5C13 A;  3IHP A;  3DPL R;  5D1K B;  2KGG A;  1X4J A;  2L43 A;  4CCG X;  4O64 A;  4B7Y C;  4YAB A;  1HYJ A;  2C2L A;  2L80 A;  2YUC A;  1JM7 A;  3ASL A;  3ZVY A;  3N9O A;  3SOU A;  2YHN A;  2K1J A;  2L5U A;  4AYC B;  4AVX A;  2K16 A;  1WIL A;  3O33 A;  4GNE A;  2ECJ A;  2YU4 A;  4UP0 A;  3U5O A;  3L1X A;  2EGP A;  2YYR A;  5KH9 A;  2K17 A;  3GL6 A;  2ECI A;  4XI1 A;  2YT5 A;  5AIT A;  2KFT A;  2LGK A;  2EOD A;  4YBT A;  2JMD A;  4Q6F A;  4ZUX U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...