4O64A

Zinc fingers of kdm2b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
RRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2B
publication title DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16866 PHD_4 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4o64A01
2MT5A 4LJNA 2KWJA 3O70A 2LQ6A 2RSDA 4WZ3B 4A4CA 1VD4A 4CCGX 2F42A 1Z6UA 3SOUA 4AUQB 2K4DA 3MHSA 2YREA 4A49A 2JMIA 4FK5A 3U5OA 5TBNA 2C2VS 2OXQC 2H0DA 2K17A 2MD8C 2YYRA 4MSXA 4CA1A 3KQIA 4IC3A 4AP4A 4NN2A 2MUMA 1JOCA 5FEYA 5B8DA 5B75A 5LKXA 4S3OC 4L58A 4AVXA 3O36A 3FL2A 4O64A 5FB0A 2G45A 3RTRB 4XI1A 1MM3A 3T6RA 2VJEB 3DPLR 3O33A 5AIUA 3DQVR 4R2YA 3VK6A 2ECTA 4FJCA 2QJ0A 1T1HA 3C6WA 2F6JA 1WEWA 5J3XA 2UZGA 1WEVA 1VFYA 1F62A 3N9PA 2JMDA 2MNZA 3ZYQA 4C9ZA 1N87A 4S3OB 3HCSA 2XEUA 4MVTA 1BORA 5LCWB 4ZUXU 3HCUA 4B86C 2YU4A 2KYUA 2KE1A 2YT5A 1WILA 2G43A 3SOWA 4FO9A 4W4UA 4N4FA 3SOXA 1HYIA 4GB0A 2BAYA 3O7AA 5TDWA 2FUIA 1WENA 2YQMA 2DX8A 1HYJA 5G0FA 1WEMA 2E6RA 2VJFB 2KWKA 1X4UA 2ZETC 3ZVZB 2M1RA 1WESA 2PUYA 2EGPA 3L11A 2YUCA 2KIZA 5H9MA 4YC9A 2RI7A 2KR4A 4I7CA 2JMJA 3T7LA 3O34A 5LKTA 3RPGC 1JM7B 2QIZA 3SHBA 3LQIA 4V3KC 1WE9A 5H1UA 5DKAA 5KH7A 2LRIC 1WEUA 5LKZA 4UP5A 2E6SA 2HYED 4ZDTA 4X3GA 2FUUA 4FIPA 4AYCA 1WEQA 1CHCA 1ZBDB 2VNFA 3RPGB 3GV4A 3MHHA 4WZ0A 5TRBA 3ASLA 4YATA 4N3WA 4PPEA 3EB5A 1WEEA 2KU3A 3U5MA 5TDRA 4PTBA 2NAAA 2AN6A 1XWHA 3O37A 5EYAF 5H1TA 2K1JA 2ECVA 5D1LB 2YSJA 2MD7B 4I7BA 4R7EA 5B79A 3EB6A 2QICA 2H0DB 2YSMA 2CSZA 4YADA 5KH3A 2EA6A 5G04B 5LKUA 1V87A 2YQLA 4L7XA 2K16A 5KH9A 3N9LA 3I2DA 5C11A 1VYXA 2I50A 2HDPA 1FBVA 2YHNA 2YURA 2VPBA 4B7YC 5G05B 3O35A 3N9QA 2VJEA 1LDKC 3LQJA 3PURA 2L0BA 4YBSA 3KV5A 1WEPA 4YBMA 2XB1A 2YHOA 3N9MA 2IDAA 4A4BA 3M99A 4GNDA 3V43A 5TABA 2LGKA 4WZ2A 3IHPA 2C2LA 3U5NA 2JRJA 1WEOA 4UI9B 1Z60A 2MNYA 3M62A 2VP7A 5B78A 2M85A 2VPGA 2KGGA 2ECGA 2F6NA 4IC2A 5JG6A 4A0CD 2PNXA 3KNVA 3ZPV1 3PHDA 2CKLB 1WFKA 2VPDA 2LXPC 3L1XA 4LK9A 1WGMA 2ECWA 4YBTA 2CSYA 1X4IA 5D1MB 2M3HA 2YW8A 4P5OB 2MA6A 3ZNIA 2Y1MA 2LGVA 2LGLA 3N9NA 3KV6A 1Z2QA 2KREA 4GNFA 2LN0A 4WA6A 2EODA 3LRQA 4I7DA 2VJFA 4LKAA 4GNGA 4UP0A 5FB1A 5D1KB 1IYMA 3L1ZB 5AITA 1FP0A 3HTKC 4V3LC 2M6MA 2LXHC 2LV9A 1RMDA 1WIMA 5B77A 2L43A 1MM2A 4QF2A 5B76A 3LQHA 3ZPVE 3HCTA 5FERA 1LDJB 2KGIA 3ZVYA 2KFTA 4ZQLA 2MA5A 5H1VA 2LGGA 4YABA 2KWNA 5I3LA 4BHWA 1X4JA 1JM7A 4BBQA 2L5UA 2VPEA 1DVPA 4R8PK 4LADB 2ECNA 3U5PA 3M63A 1E4UA 2G6QA 4TKPB 3PUQA 4AYCB 2Y43A 3C5KA 2MIQA 2ECJA 5C13A 2CT2A 1G25A 2L80A 4QF3A 2CKLA 3QZVA 3N9OA 1U6GB 2KWOA 2ECIA 1K2FA 4LLBA 2D8SA 2FSAA 2LDRA 3ZTGA 4Q6FA 2Y1NA 4YAXA 4GNEA 2L75A 3NG2A 4F52B 5DINA 3GL6A
chains in the Genus database with same CATH superfamily
2MT5A 4LJNA 2KWJA 3O70A 2LQ6A 2RSDA 4WZ3B 4A4CA 1VD4A 4CCGX 2OWAA 2F42A 1Z6UA 3SOUA 2D8UA 4AUQB 2K4DA 3MHSA 2YREA 4A49A 2KKXA 2JMIA 2RR4A 4FK5A 3U5OA 4F1PA 5TBNA 2C2VS 2IQJA 3LVQE 3LDYA 2OXQC 2H0DA 2K17A 2MD8C 2YYRA 4Z0OA 3M7KA 4MSXA 4CA1A 3KQIA 4IC3A 4AP4A 4NN2A 2MUMA 1JOCA 3Q1DA 5FEYA 5B8DA 5B75A 2LAUA 4S3OC 5LKXA 2DSMA 4Z0RA 4L58A 4AVXA 3O36A 3FL2A 4O64A 5FB0A 2XOCA 3DWDA 2G45A 3RTRB 5SVYA 2FFWA 4XI1A 1MM3A 3T6RA 2VJEB 3DPLR 3O33A 5AIUA 3DQVR 4R2YA 3VK6A 2ECTA 4FJCA 2QJ0A 1T1HA 5K3QA 3C6WA 2F6JA 1WEWA 5J3XA 2UZGA 1WEVA 1VFYA 1F62A 3N9PA 2JMDA 2MNZA 3ZYQA 3H7HA 4C9ZA 1N87A 4S3OB 3HCSA 2XEUA 4MVTA 1BORA 4O62A 5LCWB 4ZUXU 3HCUA 4B86C 2YU4A 3E2DA 2KYUA 2KE1A 2YT5A 1WILA 2G43A 3SOWA 4FO9A 4OGEA 4W4UA 4N4FA 2KKYA 3SOXA 1HYIA 4GB0A 2BAYA 3O7AA 5TDWA 2FUIA 2CSVA 1WENA 2YQMA 2DX8A 1HYJA 5G0FA 1WEMA 2E6RA 2VJFB 2KWKA 1X4UA 2ZETC 3ZVZB 2M1RA 1WESA 3FM8C 2PUYA 2EGPA 3L11A 2YUCA 2KIZA 5H9MA 4YC9A 2RI7A 2KR4A 4I7CA 4QQ4A 2JMJA 3T7LA 3FAOA 2E61A 3O34A 5LKTA 3RPGC 1JM7B 2QIZA 3SHBA 3LQIA 4V3KC 1MBMA 1WE9A 5H1UA 5DKAA 2XOYA 5SVIB 5KH7A 2LRIC 1WEUA 5LKZA 4UP5A 2E6SA 2HYED 4ZDTA 4FIPA 2FUUA 4X3GA 4AYCA 1WEQA 1CHCA 1ZBDB 2VNFA 3LVRE 3RPGB 3GV4A 3MHHA 4WZ0A 5TRBA 5SVXA 3PLWA 3ASLA 4YATA 2EXUA 2CRWA 4N3WA 4PPEA 3EB5A 1WEEA 3SUBA 2KU3A 3U5MA 5TDRA 4PTBA 2NAAA 2AN6A 1XWHA 3O37A 5EYAF 5H1TA 2K1JA 2ECVA 5D1LB 2YSJA 2MD7B 4I7BA 4R7EA 5B79A 3EB6A 2QICA 3T9KA 2H0DB 2YSMA 2CSZA 4YADA 5KH3A 2EA6A 3DDTA 5G04B 5LKUA 2MKEA 1V87A 2YQLA 2M13A 4L7XA 2K16A 5KH9A 3N9LA 3I2DA 5C11A 1VYXA 2I50A 1FBVA 2HDPA 2YHNA 2YURA 2VPBA 4B7YC 5G05B 2CONA 3O35A 3N9QA 2VJEA 1LDKC 3LQJA 3PURA 2L0BA 3JUEA 4YBSA 3KV5A 1WEPA 4YBMA 2XB1A 2YHOA 3N9MA 2IDAA 4A4BA 3M99A 4GNDA 3V43A 5TABA 2LGKA 4WZ2A 3IHPA 2C2LA 3U5NA 2JRJA 1WEOA 4UI9B 1Z60A 2MNYA 3M62A 2VP7A 5B78A 2M85A 2P57A 2VPGA 3KDEC 2KGGA 2ECGA 2F6NA 3FJUB 4IC2A 5JG6A 4A0CD 2PNXA 3KNVA 3ZPV1 3PHDA 2CKLB 2XOZA 1WFKA 2VPDA 2LXPC 3L1XA 4LK9A 1WGMA 2ECWA 4YBTA 2CSYA 1X4IA 5D1MB 2M3HA 2YW8A 4P5OB 2MA6A 2JM3A 2Y1MA 3ZNIA 2LGVA 2LGLA 3N9NA 3KV6A 2CRRA 1Z2QA 2KREA 4GNFA 2LN0A 4WA6A 2EODA 3LRQA 4I7DA 2VJFA 4LKAA 4GNGA 2JUNA 4UP0A 5FB1A 5D1KB 1IYMA 2EGMA 2L7PA 3L1ZB 5AITA 1FP0A 3HTKC 4V3LC 4H9DA 2M6MA 2LXHC 2LV9A 1RMDA 1WIMA 5B77A 2L43A 1MM2A 4QF2A 5B76A 3LQHA 2YVRA 2FD4A 3ZPVE 3HCTA 5FERA 1LDJB 2KGIA 3ZVYA 2KFTA 4ZQLA 2MA5A 5H1VA 2LGGA 4YABA 2KWNA 5I3LA 3MDBC 4BHWA 1X4JA 1JM7A 4BBQA 2XP0A 2L5UA 2VPEA 1DVPA 4R8PK 4LADB 2ECNA 3U5PA 2DJAA 3M63A 4OGCA 1E4UA 2G6QA 4TKPB 3PUQA 5SVIA 4AYCB 2B0OE 2Y43A 3C5KA 2MIQA 2ECJA 5C13A 3LJUX 2CT2A 1G25A 1DCQA 2L80A 4QF3A 3FEHA 2CKLA 3QZVA 3N9OA 1U6GB 2KWOA 2ECIA 1K2FA 4LLBA 2D8SA 2FSAA 2LDRA 3O47A 3ZTGA 4Q6FA 2Y1NA 4YAXA 3FANA 4GNEA 2L75A 3NG2A 4F52B 5DINA 3GL6A
chains in the Genus database with same CATH topology
2MT5A 4LJNA 2KWJA 3O70A 2LQ6A 2RSDA 4WZ3B 4A4CA 1VD4A 4CCGX 2F42A 1Z6UA 3SOUA 4AUQB 2K4DA 3MHSA 2YREA 4A49A 2JMIA 4FK5A 3U5OA 5TBNA 2C2VS 2OXQC 2H0DA 2K17A 2MD8C 2YYRA 4MSXA 4CA1A 3KQIA 4IC3A 4AP4A 4NN2A 2MUMA 1JOCA 5FEYA 5B8DA 5B75A 5LKXA 4S3OC 4L58A 4AVXA 3O36A 3FL2A 4O64A 5FB0A 2G45A 3RTRB 4XI1A 1MM3A 3T6RA 2VJEB 3DPLR 3O33A 5AIUA 3DQVR 4R2YA 3VK6A 2ECTA 4FJCA 2QJ0A 1T1HA 3C6WA 2F6JA 1WEWA 5J3XA 2UZGA 1WEVA 1VFYA 1F62A 3N9PA 2JMDA 2MNZA 3ZYQA 4C9ZA 1N87A 4S3OB 3HCSA 2XEUA 4MVTA 1BORA 5LCWB 4ZUXU 3HCUA 4B86C 2YU4A 2KYUA 2KE1A 2YT5A 1WILA 2G43A 3SOWA 4FO9A 4W4UA 4N4FA 3SOXA 1HYIA 4GB0A 2BAYA 3O7AA 5TDWA 2FUIA 1WENA 2YQMA 2DX8A 1HYJA 5G0FA 1WEMA 2E6RA 2VJFB 2KWKA 1X4UA 2ZETC 3ZVZB 2M1RA 1WESA 2PUYA 2EGPA 3L11A 2YUCA 2KIZA 5H9MA 4YC9A 2RI7A 2KR4A 4I7CA 2JMJA 3T7LA 3O34A 5LKTA 3RPGC 1JM7B 2QIZA 3SHBA 3LQIA 4V3KC 1WE9A 5H1UA 5DKAA 5KH7A 2LRIC 1WEUA 5LKZA 4UP5A 2E6SA 2HYED 4ZDTA 4X3GA 2FUUA 4FIPA 4AYCA 1WEQA 1CHCA 1ZBDB 2VNFA 3RPGB 3GV4A 3MHHA 4WZ0A 5TRBA 3ASLA 4YATA 4N3WA 4PPEA 3EB5A 1WEEA 2KU3A 3U5MA 5TDRA 4PTBA 2NAAA 2AN6A 1XWHA 3O37A 5EYAF 5H1TA 2K1JA 2ECVA 5D1LB 2YSJA 2MD7B 4I7BA 4R7EA 5B79A 3EB6A 2QICA 2H0DB 2YSMA 2CSZA 4YADA 5KH3A 2EA6A 5G04B 5LKUA 1V87A 2YQLA 4L7XA 2K16A 5KH9A 3N9LA 3I2DA 5C11A 1VYXA 2I50A 2HDPA 1FBVA 2YHNA 2YURA 2VPBA 4B7YC 5G05B 3O35A 3N9QA 2VJEA 1LDKC 3LQJA 3PURA 2L0BA 4YBSA 3KV5A 1WEPA 4YBMA 2XB1A 2YHOA 3N9MA 2IDAA 4A4BA 3M99A 4GNDA 3V43A 5TABA 2LGKA 4WZ2A 3IHPA 2C2LA 3U5NA 2JRJA 1WEOA 4UI9B 1Z60A 2MNYA 3M62A 2VP7A 5B78A 2M85A 2VPGA 2KGGA 2ECGA 2F6NA 4IC2A 5JG6A 4A0CD 2PNXA 3KNVA 3ZPV1 3PHDA 2CKLB 1WFKA 2VPDA 2LXPC 3L1XA 4LK9A 1WGMA 2ECWA 4YBTA 2CSYA 1X4IA 5D1MB 2M3HA 2YW8A 4P5OB 2MA6A 3ZNIA 2Y1MA 2LGVA 2LGLA 3N9NA 3KV6A 1Z2QA 2KREA 4GNFA 2LN0A 4WA6A 2EODA 3LRQA 4I7DA 2VJFA 4LKAA 4GNGA 4UP0A 5FB1A 5D1KB 1IYMA 3L1ZB 5AITA 1FP0A 3HTKC 4V3LC 2M6MA 2LXHC 2LV9A 1RMDA 1WIMA 5B77A 2L43A 1MM2A 4QF2A 5B76A 3LQHA 3ZPVE 3HCTA 5FERA 1LDJB 2KGIA 3ZVYA 2KFTA 4ZQLA 2MA5A 5H1VA 2LGGA 4YABA 2KWNA 5I3LA 4BHWA 1X4JA 1JM7A 4BBQA 2L5UA 2VPEA 1DVPA 4R8PK 4LADB 2ECNA 3U5PA 3M63A 1E4UA 2G6QA 4TKPB 3PUQA 4AYCB 2Y43A 3C5KA 2MIQA 2ECJA 5C13A 2CT2A 1G25A 2L80A 4QF3A 2CKLA 3QZVA 3N9OA 1U6GB 2KWOA 2ECIA 1K2FA 4LLBA 2D8SA 2FSAA 2LDRA 3ZTGA 4Q6FA 2Y1NA 4YAXA 4GNEA 2L75A 3NG2A 4F52B 5DINA 3GL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MT5 A;  4LJN A;  2KWJ A;  3O70 A;  2LQ6 A;  2RSD A;  4WZ3 B;  4A4C A;  1VD4 A;  4CCG X;  2F42 A;  1Z6U A;  3SOU A;  4AUQ B;  2K4D A;  3MHS A;  2YRE A;  4A49 A;  2JMI A;  4FK5 A;  3U5O A;  5TBN A;  2C2V S;  2OXQ C;  2H0D A;  2K17 A;  2MD8 C;  2YYR A;  4MSX A;  4CA1 A;  3KQI A;  4IC3 A;  4AP4 A;  4NN2 A;  2MUM A;  1JOC A;  5FEY A;  5B8D A;  5B75 A;  5LKX A;  4S3O C;  4L58 A;  4AVX A;  3O36 A;  3FL2 A;  4O64 A;  5FB0 A;  2G45 A;  3RTR B;  4XI1 A;  1MM3 A;  3T6R A;  2VJE B;  3DPL R;  3O33 A;  5AIU A;  3DQV R;  4R2Y A;  3VK6 A;  2ECT A;  4FJC A;  2QJ0 A;  1T1H A;  3C6W A;  2F6J A;  1WEW A;  5J3X A;  2UZG A;  1WEV A;  1VFY A;  1F62 A;  3N9P A;  2JMD A;  2MNZ A;  3ZYQ A;  4C9Z A;  1N87 A;  4S3O B;  3HCS A;  2XEU A;  4MVT A;  1BOR A;  5LCW B;  4ZUX U;  3HCU A;  4B86 C;  2YU4 A;  2KYU A;  2KE1 A;  2YT5 A;  1WIL A;  2G43 A;  3SOW A;  4FO9 A;  4W4U A;  4N4F A;  3SOX A;  1HYI A;  4GB0 A;  2BAY A;  3O7A A;  5TDW A;  2FUI A;  1WEN A;  2YQM A;  2DX8 A;  1HYJ A;  5G0F A;  1WEM A;  2E6R A;  2VJF B;  2KWK A;  1X4U A;  2ZET C;  3ZVZ B;  2M1R A;  1WES A;  2PUY A;  2EGP A;  3L11 A;  2YUC A;  2KIZ A;  5H9M A;  4YC9 A;  2RI7 A;  2KR4 A;  4I7C A;  2JMJ A;  3T7L A;  3O34 A;  5LKT A;  3RPG C;  1JM7 B;  2QIZ A;  3SHB A;  3LQI A;  4V3K C;  1WE9 A;  5H1U A;  5DKA A;  5KH7 A;  2LRI C;  1WEU A;  5LKZ A;  4UP5 A;  2E6S A;  2HYE D;  4ZDT A;  4X3G A;  2FUU A;  4FIP A;  4AYC A;  1WEQ A;  1CHC A;  1ZBD B;  2VNF A;  3RPG B;  3GV4 A;  3MHH A;  4WZ0 A;  5TRB A;  3ASL A;  4YAT A;  4N3W A;  4PPE A;  3EB5 A;  1WEE A;  2KU3 A;  3U5M A;  5TDR A;  4PTB A;  2NAA A;  2AN6 A;  1XWH A;  3O37 A;  5EYA F;  5H1T A;  2K1J A;  2ECV A;  5D1L B;  2YSJ A;  2MD7 B;  4I7B A;  4R7E A;  5B79 A;  3EB6 A;  2QIC A;  2H0D B;  2YSM A;  2CSZ A;  4YAD A;  5KH3 A;  2EA6 A;  5G04 B;  5LKU A;  1V87 A;  2YQL A;  4L7X A;  2K16 A;  5KH9 A;  3N9L A;  3I2D A;  5C11 A;  1VYX A;  2I50 A;  2HDP A;  1FBV A;  2YHN A;  2YUR A;  2VPB A;  4B7Y C;  5G05 B;  3O35 A;  3N9Q A;  2VJE A;  1LDK C;  3LQJ A;  3PUR A;  2L0B A;  4YBS A;  3KV5 A;  1WEP A;  4YBM A;  2XB1 A;  2YHO A;  3N9M A;  2IDA A;  4A4B A;  3M99 A;  4GND A;  3V43 A;  5TAB A;  2LGK A;  4WZ2 A;  3IHP A;  2C2L A;  3U5N A;  2JRJ A;  1WEO A;  4UI9 B;  1Z60 A;  2MNY A;  3M62 A;  2VP7 A;  5B78 A;  2M85 A;  2VPG A;  2KGG A;  2ECG A;  2F6N A;  4IC2 A;  5JG6 A;  4A0C D;  2PNX A;  3KNV A;  3ZPV 1;  3PHD A;  2CKL B;  1WFK A;  2VPD A;  2LXP C;  3L1X A;  4LK9 A;  1WGM A;  2ECW A;  4YBT A;  2CSY A;  1X4I A;  5D1M B;  2M3H A;  2YW8 A;  4P5O B;  2MA6 A;  3ZNI A;  2Y1M A;  2LGV A;  2LGL A;  3N9N A;  3KV6 A;  1Z2Q A;  2KRE A;  4GNF A;  2LN0 A;  4WA6 A;  2EOD A;  3LRQ A;  4I7D A;  2VJF A;  4LKA A;  4GNG A;  4UP0 A;  5FB1 A;  5D1K B;  1IYM A;  3L1Z B;  5AIT A;  1FP0 A;  3HTK C;  4V3L C;  2M6M A;  2LXH C;  2LV9 A;  1RMD A;  1WIM A;  5B77 A;  2L43 A;  1MM2 A;  4QF2 A;  5B76 A;  3LQH A;  3ZPV E;  3HCT A;  5FER A;  1LDJ B;  2KGI A;  3ZVY A;  2KFT A;  4ZQL A;  2MA5 A;  5H1V A;  2LGG A;  4YAB A;  2KWN A;  5I3L A;  4BHW A;  1X4J A;  1JM7 A;  4BBQ A;  2L5U A;  2VPE A;  1DVP A;  4R8P K;  4LAD B;  2ECN A;  3U5P A;  3M63 A;  1E4U A;  2G6Q A;  4TKP B;  3PUQ A;  4AYC B;  2Y43 A;  3C5K A;  2MIQ A;  2ECJ A;  5C13 A;  2CT2 A;  1G25 A;  2L80 A;  4QF3 A;  2CKL A;  3QZV A;  3N9O A;  1U6G B;  2KWO A;  2ECI A;  1K2F A;  4LLB A;  2D8S A;  2FSA A;  2LDR A;  3ZTG A;  4Q6F A;  2Y1N A;  4YAX A;  4GNE A;  2L75 A;  3NG2 A;  4F52 B;  5DIN A;  3GL6 A; 
#chains in the Genus database with same CATH topology
 2MT5 A;  4LJN A;  2KWJ A;  3O70 A;  2LQ6 A;  2RSD A;  4WZ3 B;  4A4C A;  1VD4 A;  4CCG X;  2OWA A;  2F42 A;  1Z6U A;  3SOU A;  2D8U A;  4AUQ B;  2K4D A;  3MHS A;  2YRE A;  4A49 A;  2KKX A;  2JMI A;  2RR4 A;  4FK5 A;  3U5O A;  4F1P A;  5TBN A;  2C2V S;  2IQJ A;  3LVQ E;  3LDY A;  2OXQ C;  2H0D A;  2K17 A;  2MD8 C;  2YYR A;  4Z0O A;  3M7K A;  4MSX A;  4CA1 A;  3KQI A;  4IC3 A;  4AP4 A;  4NN2 A;  2MUM A;  1JOC A;  3Q1D A;  5FEY A;  5B8D A;  5B75 A;  2LAU A;  4S3O C;  5LKX A;  2DSM A;  4Z0R A;  4L58 A;  4AVX A;  3O36 A;  3FL2 A;  4O64 A;  5FB0 A;  2XOC A;  3DWD A;  2G45 A;  3RTR B;  5SVY A;  2FFW A;  4XI1 A;  1MM3 A;  3T6R A;  2VJE B;  3DPL R;  3O33 A;  5AIU A;  3DQV R;  4R2Y A;  3VK6 A;  2ECT A;  4FJC A;  2QJ0 A;  1T1H A;  5K3Q A;  3C6W A;  2F6J A;  1WEW A;  5J3X A;  2UZG A;  1WEV A;  1VFY A;  1F62 A;  3N9P A;  2JMD A;  2MNZ A;  3ZYQ A;  3H7H A;  4C9Z A;  1N87 A;  4S3O B;  3HCS A;  2XEU A;  4MVT A;  1BOR A;  4O62 A;  5LCW B;  4ZUX U;  3HCU A;  4B86 C;  2YU4 A;  3E2D A;  2KYU A;  2KE1 A;  2YT5 A;  1WIL A;  2G43 A;  3SOW A;  4FO9 A;  4OGE A;  4W4U A;  4N4F A;  2KKY A;  3SOX A;  1HYI A;  4GB0 A;  2BAY A;  3O7A A;  5TDW A;  2FUI A;  2CSV A;  1WEN A;  2YQM A;  2DX8 A;  1HYJ A;  5G0F A;  1WEM A;  2E6R A;  2VJF B;  2KWK A;  1X4U A;  2ZET C;  3ZVZ B;  2M1R A;  1WES A;  3FM8 C;  2PUY A;  2EGP A;  3L11 A;  2YUC A;  2KIZ A;  5H9M A;  4YC9 A;  2RI7 A;  2KR4 A;  4I7C A;  4QQ4 A;  2JMJ A;  3T7L A;  3FAO A;  2E61 A;  3O34 A;  5LKT A;  3RPG C;  1JM7 B;  2QIZ A;  3SHB A;  3LQI A;  4V3K C;  1MBM A;  1WE9 A;  5H1U A;  5DKA A;  2XOY A;  5SVI B;  5KH7 A;  2LRI C;  1WEU A;  5LKZ A;  4UP5 A;  2E6S A;  2HYE D;  4ZDT A;  4FIP A;  2FUU A;  4X3G A;  4AYC A;  1WEQ A;  1CHC A;  1ZBD B;  2VNF A;  3LVR E;  3RPG B;  3GV4 A;  3MHH A;  4WZ0 A;  5TRB A;  5SVX A;  3PLW A;  3ASL A;  4YAT A;  2EXU A;  2CRW A;  4N3W A;  4PPE A;  3EB5 A;  1WEE A;  3SUB A;  2KU3 A;  3U5M A;  5TDR A;  4PTB A;  2NAA A;  2AN6 A;  1XWH A;  3O37 A;  5EYA F;  5H1T A;  2K1J A;  2ECV A;  5D1L B;  2YSJ A;  2MD7 B;  4I7B A;  4R7E A;  5B79 A;  3EB6 A;  2QIC A;  3T9K A;  2H0D B;  2YSM A;  2CSZ A;  4YAD A;  5KH3 A;  2EA6 A;  3DDT A;  5G04 B;  5LKU A;  2MKE A;  1V87 A;  2YQL A;  2M13 A;  4L7X A;  2K16 A;  5KH9 A;  3N9L A;  3I2D A;  5C11 A;  1VYX A;  2I50 A;  1FBV A;  2HDP A;  2YHN A;  2YUR A;  2VPB A;  4B7Y C;  5G05 B;  2CON A;  3O35 A;  3N9Q A;  2VJE A;  1LDK C;  3LQJ A;  3PUR A;  2L0B A;  3JUE A;  4YBS A;  3KV5 A;  1WEP A;  4YBM A;  2XB1 A;  2YHO A;  3N9M A;  2IDA A;  4A4B A;  3M99 A;  4GND A;  3V43 A;  5TAB A;  2LGK A;  4WZ2 A;  3IHP A;  2C2L A;  3U5N A;  2JRJ A;  1WEO A;  4UI9 B;  1Z60 A;  2MNY A;  3M62 A;  2VP7 A;  5B78 A;  2M85 A;  2P57 A;  2VPG A;  3KDE C;  2KGG A;  2ECG A;  2F6N A;  3FJU B;  4IC2 A;  5JG6 A;  4A0C D;  2PNX A;  3KNV A;  3ZPV 1;  3PHD A;  2CKL B;  2XOZ A;  1WFK A;  2VPD A;  2LXP C;  3L1X A;  4LK9 A;  1WGM A;  2ECW A;  4YBT A;  2CSY A;  1X4I A;  5D1M B;  2M3H A;  2YW8 A;  4P5O B;  2MA6 A;  2JM3 A;  2Y1M A;  3ZNI A;  2LGV A;  2LGL A;  3N9N A;  3KV6 A;  2CRR A;  1Z2Q A;  2KRE A;  4GNF A;  2LN0 A;  4WA6 A;  2EOD A;  3LRQ A;  4I7D A;  2VJF A;  4LKA A;  4GNG A;  2JUN A;  4UP0 A;  5FB1 A;  5D1K B;  1IYM A;  2EGM A;  2L7P A;  3L1Z B;  5AIT A;  1FP0 A;  3HTK C;  4V3L C;  4H9D A;  2M6M A;  2LXH C;  2LV9 A;  1RMD A;  1WIM A;  5B77 A;  2L43 A;  1MM2 A;  4QF2 A;  5B76 A;  3LQH A;  2YVR A;  2FD4 A;  3ZPV E;  3HCT A;  5FER A;  1LDJ B;  2KGI A;  3ZVY A;  2KFT A;  4ZQL A;  2MA5 A;  5H1V A;  2LGG A;  4YAB A;  2KWN A;  5I3L A;  3MDB C;  4BHW A;  1X4J A;  1JM7 A;  4BBQ A;  2XP0 A;  2L5U A;  2VPE A;  1DVP A;  4R8P K;  4LAD B;  2ECN A;  3U5P A;  2DJA A;  3M63 A;  4OGC A;  1E4U A;  2G6Q A;  4TKP B;  3PUQ A;  5SVI A;  4AYC B;  2B0O E;  2Y43 A;  3C5K A;  2MIQ A;  2ECJ A;  5C13 A;  3LJU X;  2CT2 A;  1G25 A;  1DCQ A;  2L80 A;  4QF3 A;  3FEH A;  2CKL A;  3QZV A;  3N9O A;  1U6G B;  2KWO A;  2ECI A;  1K2F A;  4LLB A;  2D8S A;  2FSA A;  2LDR A;  3O47 A;  3ZTG A;  4Q6F A;  2Y1N A;  4YAX A;  3FAN A;  4GNE A;  2L75 A;  3NG2 A;  4F52 B;  5DIN A;  3GL6 A; 
#chains in the Genus database with same CATH homology
 2MT5 A;  4LJN A;  2KWJ A;  3O70 A;  2LQ6 A;  2RSD A;  4WZ3 B;  4A4C A;  1VD4 A;  4CCG X;  2F42 A;  1Z6U A;  3SOU A;  4AUQ B;  2K4D A;  3MHS A;  2YRE A;  4A49 A;  2JMI A;  4FK5 A;  3U5O A;  5TBN A;  2C2V S;  2OXQ C;  2H0D A;  2K17 A;  2MD8 C;  2YYR A;  4MSX A;  4CA1 A;  3KQI A;  4IC3 A;  4AP4 A;  4NN2 A;  2MUM A;  1JOC A;  5FEY A;  5B8D A;  5B75 A;  5LKX A;  4S3O C;  4L58 A;  4AVX A;  3O36 A;  3FL2 A;  4O64 A;  5FB0 A;  2G45 A;  3RTR B;  4XI1 A;  1MM3 A;  3T6R A;  2VJE B;  3DPL R;  3O33 A;  5AIU A;  3DQV R;  4R2Y A;  3VK6 A;  2ECT A;  4FJC A;  2QJ0 A;  1T1H A;  3C6W A;  2F6J A;  1WEW A;  5J3X A;  2UZG A;  1WEV A;  1VFY A;  1F62 A;  3N9P A;  2JMD A;  2MNZ A;  3ZYQ A;  4C9Z A;  1N87 A;  4S3O B;  3HCS A;  2XEU A;  4MVT A;  1BOR A;  5LCW B;  4ZUX U;  3HCU A;  4B86 C;  2YU4 A;  2KYU A;  2KE1 A;  2YT5 A;  1WIL A;  2G43 A;  3SOW A;  4FO9 A;  4W4U A;  4N4F A;  3SOX A;  1HYI A;  4GB0 A;  2BAY A;  3O7A A;  5TDW A;  2FUI A;  1WEN A;  2YQM A;  2DX8 A;  1HYJ A;  5G0F A;  1WEM A;  2E6R A;  2VJF B;  2KWK A;  1X4U A;  2ZET C;  3ZVZ B;  2M1R A;  1WES A;  2PUY A;  2EGP A;  3L11 A;  2YUC A;  2KIZ A;  5H9M A;  4YC9 A;  2RI7 A;  2KR4 A;  4I7C A;  2JMJ A;  3T7L A;  3O34 A;  5LKT A;  3RPG C;  1JM7 B;  2QIZ A;  3SHB A;  3LQI A;  4V3K C;  1WE9 A;  5H1U A;  5DKA A;  5KH7 A;  2LRI C;  1WEU A;  5LKZ A;  4UP5 A;  2E6S A;  2HYE D;  4ZDT A;  4X3G A;  2FUU A;  4FIP A;  4AYC A;  1WEQ A;  1CHC A;  1ZBD B;  2VNF A;  3RPG B;  3GV4 A;  3MHH A;  4WZ0 A;  5TRB A;  3ASL A;  4YAT A;  4N3W A;  4PPE A;  3EB5 A;  1WEE A;  2KU3 A;  3U5M A;  5TDR A;  4PTB A;  2NAA A;  2AN6 A;  1XWH A;  3O37 A;  5EYA F;  5H1T A;  2K1J A;  2ECV A;  5D1L B;  2YSJ A;  2MD7 B;  4I7B A;  4R7E A;  5B79 A;  3EB6 A;  2QIC A;  2H0D B;  2YSM A;  2CSZ A;  4YAD A;  5KH3 A;  2EA6 A;  5G04 B;  5LKU A;  1V87 A;  2YQL A;  4L7X A;  2K16 A;  5KH9 A;  3N9L A;  3I2D A;  5C11 A;  1VYX A;  2I50 A;  2HDP A;  1FBV A;  2YHN A;  2YUR A;  2VPB A;  4B7Y C;  5G05 B;  3O35 A;  3N9Q A;  2VJE A;  1LDK C;  3LQJ A;  3PUR A;  2L0B A;  4YBS A;  3KV5 A;  1WEP A;  4YBM A;  2XB1 A;  2YHO A;  3N9M A;  2IDA A;  4A4B A;  3M99 A;  4GND A;  3V43 A;  5TAB A;  2LGK A;  4WZ2 A;  3IHP A;  2C2L A;  3U5N A;  2JRJ A;  1WEO A;  4UI9 B;  1Z60 A;  2MNY A;  3M62 A;  2VP7 A;  5B78 A;  2M85 A;  2VPG A;  2KGG A;  2ECG A;  2F6N A;  4IC2 A;  5JG6 A;  4A0C D;  2PNX A;  3KNV A;  3ZPV 1;  3PHD A;  2CKL B;  1WFK A;  2VPD A;  2LXP C;  3L1X A;  4LK9 A;  1WGM A;  2ECW A;  4YBT A;  2CSY A;  1X4I A;  5D1M B;  2M3H A;  2YW8 A;  4P5O B;  2MA6 A;  3ZNI A;  2Y1M A;  2LGV A;  2LGL A;  3N9N A;  3KV6 A;  1Z2Q A;  2KRE A;  4GNF A;  2LN0 A;  4WA6 A;  2EOD A;  3LRQ A;  4I7D A;  2VJF A;  4LKA A;  4GNG A;  4UP0 A;  5FB1 A;  5D1K B;  1IYM A;  3L1Z B;  5AIT A;  1FP0 A;  3HTK C;  4V3L C;  2M6M A;  2LXH C;  2LV9 A;  1RMD A;  1WIM A;  5B77 A;  2L43 A;  1MM2 A;  4QF2 A;  5B76 A;  3LQH A;  3ZPV E;  3HCT A;  5FER A;  1LDJ B;  2KGI A;  3ZVY A;  2KFT A;  4ZQL A;  2MA5 A;  5H1V A;  2LGG A;  4YAB A;  2KWN A;  5I3L A;  4BHW A;  1X4J A;  1JM7 A;  4BBQ A;  2L5U A;  2VPE A;  1DVP A;  4R8P K;  4LAD B;  2ECN A;  3U5P A;  3M63 A;  1E4U A;  2G6Q A;  4TKP B;  3PUQ A;  4AYC B;  2Y43 A;  3C5K A;  2MIQ A;  2ECJ A;  5C13 A;  2CT2 A;  1G25 A;  2L80 A;  4QF3 A;  2CKL A;  3QZV A;  3N9O A;  1U6G B;  2KWO A;  2ECI A;  1K2F A;  4LLB A;  2D8S A;  2FSA A;  2LDR A;  3ZTG A;  4Q6F A;  2Y1N A;  4YAX A;  4GNE A;  2L75 A;  3NG2 A;  4F52 B;  5DIN A;  3GL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...