4O64A

Zinc fingers of kdm2b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
b'RRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2B
publication title DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16866 PHD_4 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4o64A01
4I7CA 2KR4A 2LN0A 2H0DA 2LXPC 4WZ2A 2L75A 1WE9A 2YSMA 2CKLA 4AYCA 5FEYA 5B78A 2L43A 1X4IA 2KWKA 2E6RA 2QIZA 4LJNA 3RPGC 2KWNA 4P5OB 4L7XA 3ZYQA 4B7YC 5KH7A 3EB5A 2ECIA 3O70A 4BHWA 3M63A 2FUUA 5G04B 2VJFB 2MNYA 2KYUA 3O33A 2KIZA 4YBSA 1WEWA 3SOXA 1WGMA 5G0FA 2M85A 4L58A 2JMDA 3SHBA 4IC2A 2CT2A 4N3WA 2NAAA 1WEUA 3ZVZB 3EB6A 5D1LB 4N4FA 5H9MA 2YHNA 2HYED 4CCGX 5JG6A 2YHOA 3O7AA 4GB0A 1WENA 1U6GB 5C13A 2JRJA 4PPEA 3MHHA 2FUIA 5B76A 2LGLA 5LKXA 3O37A 1IYMA 2UZGA 3HCSA 3VK6A 2MA5A 3T6RA 4B86C 3RPGB 2VJEB 5I3LA 3ZTGA 2KWOA 2VPEA 3U5NA 1K2FA 2YSJA 3N9MA 2OXQC 2MA6A 4FO9A 2YW8A 4NN2A 4CA1A 3LRQA 2EGPA 2VJFA 4LLBA 5LKUA 1WEPA 1WEVA 4I7DA 4ZUXU 2K17A 2LGVA 5TBNA 4YADA 3U5PA 4FK5A 2Y1NA 2KGGA 4UP0A 2CSYA 4FIPA 3HCTA 4MSXA 5DKAA 4GNFA 2G43A 2VPBA 2L80A 4A4BA 3ASLA 4V3LC 3HTKC 3L1XA 2QICA 2LRIC 4AP4A 5FERA 3L1ZB 3FL2A 1WEEA 2K1JA 3ZPV1 3PHDA 1WEQA 1JOCA 2KU3A 2DX8A 5B79A 1DVPA 1BORA 2VJEA 2EA6A 4I7BA 5TDWA 4GNDA 3O35A 4C9ZA 1N87A 4MVTA 2MD8C 2YUCA 3LQIA 3O34A 1JM7A 1ZBDB 2LGGA 4ZQLA 2YQMA 1G25A 3ZNIA 2KFTA 2E6SA 5TABA 1HYIA 4R7EA 2LV9A 1Z6UA 5KH9A 3HCUA 3KNVA 2PUYA 2MIQA 2QJ0A 4GNEA 3ZVYA 2XEUA 5DINA 4A49A 4YC9A 3GV4A 2KWJA 2MT5A 2RI7A 4QF3A 1X4JA 2ZETC 1MM3A 3LQJA 2VP7A 1X4UA 2KGIA 4UP5A 1RMDA 2IDAA 1VD4A 1WEOA 3U5MA 3SOUA 3V43A 2VPDA 2VNFA 4S3OB 5C11A 3KV6A 2RSDA 1WESA 4YBTA 5AITA 1T1HA 2MUMA 1VYXA 1VFYA 2JMIA 2G6QA 4QF2A 5B75A 4X3GA 3PURA 3U5OA 2AN6A 2KREA 3NG2A 2LXHC 2CSZA 4R2YA 4W4UA 3L11A 4TKPB 3DQVR 2ECTA 4WZ0A 5J3XA 3LQHA 2LQ6A 1F62A 3I2DA 4IC3A 2I50A 5FB0A 4O64A 3KQIA 5H1UA 5H1VA 5LCWB 4PTBA 1FP0A 1Z2QA 2ECNA 5D1KB 2L5UA 4AUQB 2PNXA 5LKTA 2YT5A 2K4DA 4V3KC 4WA6A 2YREA 2Y43A 2YURA 4Q6FA 3N9OA 4UI9B 2F6JA 1MM2A 1E4UA 2M3HA 3N9PA 1LDKC 1XWHA 5H1TA 2K16A 3ZPVE 4S3OC 2XB1A 5B77A 3MHSA 4F52B 3N9QA 2HDPA 2VPGA 3T7LA 3IHPA 4YATA 2MNZA 2C2LA 2M6MA 4ZDTA 1WIMA 2F6NA 5KH3A 4A0CD 1WILA 5TDRA 2LDRA 2M1RA 3QZVA 4LK9A 2YQLA 1LDJB 1WFKA 3M99A 3GL6A 1Z60A 2L0BA 2BAYA 5G05B 2MD7B 3N9LA 1CHCA 5EYAF 3PUQA 2G45A 1V87A 2Y1MA 4GNGA 4A4CA 3SOWA 2ECVA 3C5KA 5D1MB 1FBVA 2EODA 2ECGA 4FJCA 2H0DB 5FB1A 4R8PK 2F42A 2CKLB 3N9NA 4AYCB 2D8SA 2LGKA 5TRBA 4YABA 4LADB 4BBQA 2ECWA 2YYRA 1WEMA 3RTRB 5LKZA 5B8DA 4AVXA 2C2VS 4XI1A 1JM7B 2KE1A 4WZ3B 3DPLR 3M62A 2YU4A 3KV5A 4YBMA 1HYJA 5AIUA 3C6WA 4YAXA 3O36A 2JMJA 4LKAA 2FSAA 2ECJA
chains in the Genus database with same CATH superfamily
4I7CA 2KR4A 2LN0A 2H0DA 2LXPC 2YVRA 2L75A 4WZ2A 1WE9A 2YSMA 2CKLA 4AYCA 5FEYA 5B78A 2L43A 1X4IA 2KWKA 2E6RA 2QIZA 4LJNA 3RPGC 2KWNA 4P5OB 4L7XA 3ZYQA 4B7YC 2EXUA 5KH7A 3EB5A 2ECIA 3O70A 2FD4A 4BHWA 3M63A 2FUUA 5G04B 2VJFB 2MNYA 2KYUA 3O33A 2KIZA 4YBSA 1WEWA 4F1PA 3SOXA 1WGMA 5G0FA 2M85A 3PLWA 4L58A 2JMDA 2XOCA 3SHBA 4IC2A 2CT2A 4N3WA 2NAAA 1WEUA 3ZVZB 3EB6A 5D1LB 4N4FA 5H9MA 2CRRA 2YHNA 2HYED 4CCGX 5JG6A 2YHOA 3O7AA 5K3QA 4GB0A 1WENA 1U6GB 5C13A 2JRJA 4PPEA 3MHHA 2FUIA 2L7PA 5B76A 2LGLA 5LKXA 3O37A 1IYMA 2UZGA 3HCSA 3VK6A 2MA5A 3T6RA 4B86C 3RPGB 2VJEB 4Z0OA 5I3LA 3ZTGA 2KWOA 2VPEA 3U5NA 1K2FA 2YSJA 3N9MA 2OXQC 2MA6A 4FO9A 2YW8A 4NN2A 2D8UA 4CA1A 3LRQA 2M13A 2EGPA 2VJFA 4LLBA 3DWDA 5LKUA 1WEPA 1WEVA 4I7DA 3LJUX 4ZUXU 2K17A 2LGVA 5TBNA 4YADA 3U5PA 4FK5A 2Y1NA 2KGGA 3Q1DA 4UP0A 2CSYA 4FIPA 3HCTA 4MSXA 5DKAA 4GNFA 2G43A 2VPBA 2L80A 3MDBC 3JUEA 4A4BA 3ASLA 4V3LC 4OGCA 3HTKC 3L1XA 2QICA 2LRIC 4AP4A 5FERA 3L1ZB 3FL2A 1WEEA 2K1JA 3ZPV1 3PHDA 1WEQA 1JOCA 3LVQE 2KU3A 2DX8A 3O47A 5B79A 2EGMA 1DVPA 1BORA 2VJEA 2EA6A 4I7BA 5TDWA 4GNDA 3O35A 4C9ZA 1N87A 4MVTA 3LVRE 2MD8C 2JM3A 2YUCA 3LQIA 3O34A 1JM7A 1ZBDB 2LGGA 4ZQLA 2YQMA 1G25A 3ZNIA 2KFTA 2JUNA 2E6SA 5TABA 1HYIA 4R7EA 2LV9A 1Z6UA 5KH9A 4Z0RA 3HCUA 3KNVA 2PUYA 2MIQA 2QJ0A 4GNEA 3ZVYA 3FJUB 2XEUA 5DINA 4A49A 2KKXA 4YC9A 3GV4A 4OGEA 2KWJA 2MT5A 2LAUA 2RI7A 4QF3A 2DSMA 1X4JA 2ZETC 1MM3A 3LQJA 2VP7A 3FM8C 1X4UA 3FAOA 2KGIA 2CSVA 4UP5A 1RMDA 2IDAA 1VD4A 1WEOA 2P57A 3U5MA 3SOUA 3V43A 2VPDA 2VNFA 4S3OB 5C11A 3KV6A 2RSDA 1WESA 4YBTA 5AITA 1T1HA 2MUMA 1VYXA 1VFYA 2JMIA 2G6QA 4O62A 4QF2A 5B75A 4X3GA 3PURA 5SVYA 3U5OA 2AN6A 2KREA 3NG2A 3KDEC 2LXHC 2CSZA 4R2YA 4W4UA 3L11A 4TKPB 3DQVR 2ECTA 4WZ0A 5J3XA 3LQHA 2LQ6A 1F62A 3I2DA 4IC3A 2I50A 5FB0A 4O64A 3KQIA 5H1UA 5H1VA 5LCWB 4PTBA 1FP0A 1Z2QA 2ECNA 5D1KB 2L5UA 4AUQB 2PNXA 5LKTA 2YT5A 2K4DA 2XP0A 4V3KC 4WA6A 2YREA 2Y43A 2YURA 4Q6FA 3N9OA 4UI9B 2F6JA 1MM2A 1E4UA 2M3HA 2XOZA 3N9PA 1LDKC 1XWHA 5H1TA 2K16A 3ZPVE 4S3OC 2XB1A 5B77A 3MHSA 4F52B 3N9QA 2HDPA 2VPGA 3T7LA 3IHPA 4YATA 2MNZA 2C2LA 2M6MA 4ZDTA 1WIMA 2F6NA 2CONA 5KH3A 4A0CD 1WILA 5TDRA 2LDRA 3SUBA 2XOYA 2M1RA 3QZVA 4LK9A 2YQLA 1LDJB 1WFKA 3M99A 1DCQA 5SVIB 3GL6A 1Z60A 2L0BA 2CRWA 2BAYA 2RR4A 5G05B 2KKYA 2MD7B 3N9LA 1CHCA 5EYAF 3PUQA 2G45A 1V87A 2Y1MA 4GNGA 4A4CA 3SOWA 2ECVA 3C5KA 5D1MB 1FBVA 2EODA 2ECGA 4FJCA 2H0DB 5FB1A 4R8PK 2F42A 4H9DA 2E61A 2CKLB 2DJAA 3N9NA 5SVXA 4AYCB 2D8SA 2LGKA 3H7HA 5TRBA 4YABA 3FANA 4LADB 4BBQA 2ECWA 2YYRA 1WEMA 4QQ4A 3RTRB 2OWAA 5LKZA 5B8DA 3FEHA 2FFWA 4AVXA 3DDTA 2C2VS 5SVIA 4XI1A 1JM7B 2KE1A 4WZ3B 3E2DA 3DPLR 3M62A 2IQJA 2YU4A 3KV5A 4YBMA 1HYJA 5AIUA 3C6WA 2MKEA 4YAXA 3O36A 2JMJA 4LKAA 1MBMA 2FSAA 3M7KA 3LDYA 3T9KA 2ECJA 2B0OE
chains in the Genus database with same CATH topology
4I7CA 2KR4A 2LN0A 2H0DA 2LXPC 4WZ2A 2L75A 1WE9A 2YSMA 2CKLA 4AYCA 5FEYA 5B78A 2L43A 1X4IA 2KWKA 2E6RA 2QIZA 4LJNA 3RPGC 2KWNA 4P5OB 4L7XA 3ZYQA 4B7YC 5KH7A 3EB5A 2ECIA 3O70A 4BHWA 3M63A 2FUUA 5G04B 2VJFB 2MNYA 2KYUA 3O33A 2KIZA 4YBSA 1WEWA 3SOXA 1WGMA 5G0FA 2M85A 4L58A 2JMDA 3SHBA 4IC2A 2CT2A 4N3WA 2NAAA 1WEUA 3ZVZB 3EB6A 5D1LB 4N4FA 5H9MA 2YHNA 2HYED 4CCGX 5JG6A 2YHOA 3O7AA 4GB0A 1WENA 1U6GB 5C13A 2JRJA 4PPEA 3MHHA 2FUIA 5B76A 2LGLA 5LKXA 3O37A 1IYMA 2UZGA 3HCSA 3VK6A 2MA5A 3T6RA 4B86C 3RPGB 2VJEB 5I3LA 3ZTGA 2KWOA 2VPEA 3U5NA 1K2FA 2YSJA 3N9MA 2OXQC 2MA6A 4FO9A 2YW8A 4NN2A 4CA1A 3LRQA 2EGPA 2VJFA 4LLBA 5LKUA 1WEPA 1WEVA 4I7DA 4ZUXU 2K17A 2LGVA 5TBNA 4YADA 3U5PA 4FK5A 2Y1NA 2KGGA 4UP0A 2CSYA 4FIPA 3HCTA 4MSXA 5DKAA 4GNFA 2G43A 2VPBA 2L80A 4A4BA 3ASLA 4V3LC 3HTKC 3L1XA 2QICA 2LRIC 4AP4A 5FERA 3L1ZB 3FL2A 1WEEA 2K1JA 3ZPV1 3PHDA 1WEQA 1JOCA 2KU3A 2DX8A 5B79A 1DVPA 1BORA 2VJEA 2EA6A 4I7BA 5TDWA 4GNDA 3O35A 4C9ZA 1N87A 4MVTA 2MD8C 2YUCA 3LQIA 3O34A 1JM7A 1ZBDB 2LGGA 4ZQLA 2YQMA 1G25A 3ZNIA 2KFTA 2E6SA 5TABA 1HYIA 4R7EA 2LV9A 1Z6UA 5KH9A 3HCUA 3KNVA 2PUYA 2MIQA 2QJ0A 4GNEA 3ZVYA 2XEUA 5DINA 4A49A 4YC9A 3GV4A 2KWJA 2MT5A 2RI7A 4QF3A 1X4JA 2ZETC 1MM3A 3LQJA 2VP7A 1X4UA 2KGIA 4UP5A 1RMDA 2IDAA 1VD4A 1WEOA 3U5MA 3SOUA 3V43A 2VPDA 2VNFA 4S3OB 5C11A 3KV6A 2RSDA 1WESA 4YBTA 5AITA 1T1HA 2MUMA 1VYXA 1VFYA 2JMIA 2G6QA 4QF2A 5B75A 4X3GA 3PURA 3U5OA 2AN6A 2KREA 3NG2A 2LXHC 2CSZA 4R2YA 4W4UA 3L11A 4TKPB 3DQVR 2ECTA 4WZ0A 5J3XA 3LQHA 2LQ6A 1F62A 3I2DA 4IC3A 2I50A 5FB0A 4O64A 3KQIA 5H1UA 5H1VA 5LCWB 4PTBA 1FP0A 1Z2QA 2ECNA 5D1KB 2L5UA 4AUQB 2PNXA 5LKTA 2YT5A 2K4DA 4V3KC 4WA6A 2YREA 2Y43A 2YURA 4Q6FA 3N9OA 4UI9B 2F6JA 1MM2A 1E4UA 2M3HA 3N9PA 1LDKC 1XWHA 5H1TA 2K16A 3ZPVE 4S3OC 2XB1A 5B77A 3MHSA 4F52B 3N9QA 2HDPA 2VPGA 3T7LA 3IHPA 4YATA 2MNZA 2C2LA 2M6MA 4ZDTA 1WIMA 2F6NA 5KH3A 4A0CD 1WILA 5TDRA 2LDRA 2M1RA 3QZVA 4LK9A 2YQLA 1LDJB 1WFKA 3M99A 3GL6A 1Z60A 2L0BA 2BAYA 5G05B 2MD7B 3N9LA 1CHCA 5EYAF 3PUQA 2G45A 1V87A 2Y1MA 4GNGA 4A4CA 3SOWA 2ECVA 3C5KA 5D1MB 1FBVA 2EODA 2ECGA 4FJCA 2H0DB 5FB1A 4R8PK 2F42A 2CKLB 3N9NA 4AYCB 2D8SA 2LGKA 5TRBA 4YABA 4LADB 4BBQA 2ECWA 2YYRA 1WEMA 3RTRB 5LKZA 5B8DA 4AVXA 2C2VS 4XI1A 1JM7B 2KE1A 4WZ3B 3DPLR 3M62A 2YU4A 3KV5A 4YBMA 1HYJA 5AIUA 3C6WA 4YAXA 3O36A 2JMJA 4LKAA 2FSAA 2ECJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7C A;  2KR4 A;  2LN0 A;  2H0D A;  2LXP C;  4WZ2 A;  2L75 A;  1WE9 A;  2YSM A;  2CKL A;  4AYC A;  5FEY A;  5B78 A;  2L43 A;  1X4I A;  2KWK A;  2E6R A;  2QIZ A;  4LJN A;  3RPG C;  2KWN A;  4P5O B;  4L7X A;  3ZYQ A;  4B7Y C;  5KH7 A;  3EB5 A;  2ECI A;  3O70 A;  4BHW A;  3M63 A;  2FUU A;  5G04 B;  2VJF B;  2MNY A;  2KYU A;  3O33 A;  2KIZ A;  4YBS A;  1WEW A;  3SOX A;  1WGM A;  5G0F A;  2M85 A;  4L58 A;  2JMD A;  3SHB A;  4IC2 A;  2CT2 A;  4N3W A;  2NAA A;  1WEU A;  3ZVZ B;  3EB6 A;  5D1L B;  4N4F A;  5H9M A;  2YHN A;  2HYE D;  4CCG X;  5JG6 A;  2YHO A;  3O7A A;  4GB0 A;  1WEN A;  1U6G B;  5C13 A;  2JRJ A;  4PPE A;  3MHH A;  2FUI A;  5B76 A;  2LGL A;  5LKX A;  3O37 A;  1IYM A;  2UZG A;  3HCS A;  3VK6 A;  2MA5 A;  3T6R A;  4B86 C;  3RPG B;  2VJE B;  5I3L A;  3ZTG A;  2KWO A;  2VPE A;  3U5N A;  1K2F A;  2YSJ A;  3N9M A;  2OXQ C;  2MA6 A;  4FO9 A;  2YW8 A;  4NN2 A;  4CA1 A;  3LRQ A;  2EGP A;  2VJF A;  4LLB A;  5LKU A;  1WEP A;  1WEV A;  4I7D A;  4ZUX U;  2K17 A;  2LGV A;  5TBN A;  4YAD A;  3U5P A;  4FK5 A;  2Y1N A;  2KGG A;  4UP0 A;  2CSY A;  4FIP A;  3HCT A;  4MSX A;  5DKA A;  4GNF A;  2G43 A;  2VPB A;  2L80 A;  4A4B A;  3ASL A;  4V3L C;  3HTK C;  3L1X A;  2QIC A;  2LRI C;  4AP4 A;  5FER A;  3L1Z B;  3FL2 A;  1WEE A;  2K1J A;  3ZPV 1;  3PHD A;  1WEQ A;  1JOC A;  2KU3 A;  2DX8 A;  5B79 A;  1DVP A;  1BOR A;  2VJE A;  2EA6 A;  4I7B A;  5TDW A;  4GND A;  3O35 A;  4C9Z A;  1N87 A;  4MVT A;  2MD8 C;  2YUC A;  3LQI A;  3O34 A;  1JM7 A;  1ZBD B;  2LGG A;  4ZQL A;  2YQM A;  1G25 A;  3ZNI A;  2KFT A;  2E6S A;  5TAB A;  1HYI A;  4R7E A;  2LV9 A;  1Z6U A;  5KH9 A;  3HCU A;  3KNV A;  2PUY A;  2MIQ A;  2QJ0 A;  4GNE A;  3ZVY A;  2XEU A;  5DIN A;  4A49 A;  4YC9 A;  3GV4 A;  2KWJ A;  2MT5 A;  2RI7 A;  4QF3 A;  1X4J A;  2ZET C;  1MM3 A;  3LQJ A;  2VP7 A;  1X4U A;  2KGI A;  4UP5 A;  1RMD A;  2IDA A;  1VD4 A;  1WEO A;  3U5M A;  3SOU A;  3V43 A;  2VPD A;  2VNF A;  4S3O B;  5C11 A;  3KV6 A;  2RSD A;  1WES A;  4YBT A;  5AIT A;  1T1H A;  2MUM A;  1VYX A;  1VFY A;  2JMI A;  2G6Q A;  4QF2 A;  5B75 A;  4X3G A;  3PUR A;  3U5O A;  2AN6 A;  2KRE A;  3NG2 A;  2LXH C;  2CSZ A;  4R2Y A;  4W4U A;  3L11 A;  4TKP B;  3DQV R;  2ECT A;  4WZ0 A;  5J3X A;  3LQH A;  2LQ6 A;  1F62 A;  3I2D A;  4IC3 A;  2I50 A;  5FB0 A;  4O64 A;  3KQI A;  5H1U A;  5H1V A;  5LCW B;  4PTB A;  1FP0 A;  1Z2Q A;  2ECN A;  5D1K B;  2L5U A;  4AUQ B;  2PNX A;  5LKT A;  2YT5 A;  2K4D A;  4V3K C;  4WA6 A;  2YRE A;  2Y43 A;  2YUR A;  4Q6F A;  3N9O A;  4UI9 B;  2F6J A;  1MM2 A;  1E4U A;  2M3H A;  3N9P A;  1LDK C;  1XWH A;  5H1T A;  2K16 A;  3ZPV E;  4S3O C;  2XB1 A;  5B77 A;  3MHS A;  4F52 B;  3N9Q A;  2HDP A;  2VPG A;  3T7L A;  3IHP A;  4YAT A;  2MNZ A;  2C2L A;  2M6M A;  4ZDT A;  1WIM A;  2F6N A;  5KH3 A;  4A0C D;  1WIL A;  5TDR A;  2LDR A;  2M1R A;  3QZV A;  4LK9 A;  2YQL A;  1LDJ B;  1WFK A;  3M99 A;  3GL6 A;  1Z60 A;  2L0B A;  2BAY A;  5G05 B;  2MD7 B;  3N9L A;  1CHC A;  5EYA F;  3PUQ A;  2G45 A;  1V87 A;  2Y1M A;  4GNG A;  4A4C A;  3SOW A;  2ECV A;  3C5K A;  5D1M B;  1FBV A;  2EOD A;  2ECG A;  4FJC A;  2H0D B;  5FB1 A;  4R8P K;  2F42 A;  2CKL B;  3N9N A;  4AYC B;  2D8S A;  2LGK A;  5TRB A;  4YAB A;  4LAD B;  4BBQ A;  2ECW A;  2YYR A;  1WEM A;  3RTR B;  5LKZ A;  5B8D A;  4AVX A;  2C2V S;  4XI1 A;  1JM7 B;  2KE1 A;  4WZ3 B;  3DPL R;  3M62 A;  2YU4 A;  3KV5 A;  4YBM A;  1HYJ A;  5AIU A;  3C6W A;  4YAX A;  3O36 A;  2JMJ A;  4LKA A;  2FSA A;  2ECJ A; 
#chains in the Genus database with same CATH topology
 4I7C A;  2KR4 A;  2LN0 A;  2H0D A;  2LXP C;  2YVR A;  2L75 A;  4WZ2 A;  1WE9 A;  2YSM A;  2CKL A;  4AYC A;  5FEY A;  5B78 A;  2L43 A;  1X4I A;  2KWK A;  2E6R A;  2QIZ A;  4LJN A;  3RPG C;  2KWN A;  4P5O B;  4L7X A;  3ZYQ A;  4B7Y C;  2EXU A;  5KH7 A;  3EB5 A;  2ECI A;  3O70 A;  2FD4 A;  4BHW A;  3M63 A;  2FUU A;  5G04 B;  2VJF B;  2MNY A;  2KYU A;  3O33 A;  2KIZ A;  4YBS A;  1WEW A;  4F1P A;  3SOX A;  1WGM A;  5G0F A;  2M85 A;  3PLW A;  4L58 A;  2JMD A;  2XOC A;  3SHB A;  4IC2 A;  2CT2 A;  4N3W A;  2NAA A;  1WEU A;  3ZVZ B;  3EB6 A;  5D1L B;  4N4F A;  5H9M A;  2CRR A;  2YHN A;  2HYE D;  4CCG X;  5JG6 A;  2YHO A;  3O7A A;  5K3Q A;  4GB0 A;  1WEN A;  1U6G B;  5C13 A;  2JRJ A;  4PPE A;  3MHH A;  2FUI A;  2L7P A;  5B76 A;  2LGL A;  5LKX A;  3O37 A;  1IYM A;  2UZG A;  3HCS A;  3VK6 A;  2MA5 A;  3T6R A;  4B86 C;  3RPG B;  2VJE B;  4Z0O A;  5I3L A;  3ZTG A;  2KWO A;  2VPE A;  3U5N A;  1K2F A;  2YSJ A;  3N9M A;  2OXQ C;  2MA6 A;  4FO9 A;  2YW8 A;  4NN2 A;  2D8U A;  4CA1 A;  3LRQ A;  2M13 A;  2EGP A;  2VJF A;  4LLB A;  3DWD A;  5LKU A;  1WEP A;  1WEV A;  4I7D A;  3LJU X;  4ZUX U;  2K17 A;  2LGV A;  5TBN A;  4YAD A;  3U5P A;  4FK5 A;  2Y1N A;  2KGG A;  3Q1D A;  4UP0 A;  2CSY A;  4FIP A;  3HCT A;  4MSX A;  5DKA A;  4GNF A;  2G43 A;  2VPB A;  2L80 A;  3MDB C;  3JUE A;  4A4B A;  3ASL A;  4V3L C;  4OGC A;  3HTK C;  3L1X A;  2QIC A;  2LRI C;  4AP4 A;  5FER A;  3L1Z B;  3FL2 A;  1WEE A;  2K1J A;  3ZPV 1;  3PHD A;  1WEQ A;  1JOC A;  3LVQ E;  2KU3 A;  2DX8 A;  3O47 A;  5B79 A;  2EGM A;  1DVP A;  1BOR A;  2VJE A;  2EA6 A;  4I7B A;  5TDW A;  4GND A;  3O35 A;  4C9Z A;  1N87 A;  4MVT A;  3LVR E;  2MD8 C;  2JM3 A;  2YUC A;  3LQI A;  3O34 A;  1JM7 A;  1ZBD B;  2LGG A;  4ZQL A;  2YQM A;  1G25 A;  3ZNI A;  2KFT A;  2JUN A;  2E6S A;  5TAB A;  1HYI A;  4R7E A;  2LV9 A;  1Z6U A;  5KH9 A;  4Z0R A;  3HCU A;  3KNV A;  2PUY A;  2MIQ A;  2QJ0 A;  4GNE A;  3ZVY A;  3FJU B;  2XEU A;  5DIN A;  4A49 A;  2KKX A;  4YC9 A;  3GV4 A;  4OGE A;  2KWJ A;  2MT5 A;  2LAU A;  2RI7 A;  4QF3 A;  2DSM A;  1X4J A;  2ZET C;  1MM3 A;  3LQJ A;  2VP7 A;  3FM8 C;  1X4U A;  3FAO A;  2KGI A;  2CSV A;  4UP5 A;  1RMD A;  2IDA A;  1VD4 A;  1WEO A;  2P57 A;  3U5M A;  3SOU A;  3V43 A;  2VPD A;  2VNF A;  4S3O B;  5C11 A;  3KV6 A;  2RSD A;  1WES A;  4YBT A;  5AIT A;  1T1H A;  2MUM A;  1VYX A;  1VFY A;  2JMI A;  2G6Q A;  4O62 A;  4QF2 A;  5B75 A;  4X3G A;  3PUR A;  5SVY A;  3U5O A;  2AN6 A;  2KRE A;  3NG2 A;  3KDE C;  2LXH C;  2CSZ A;  4R2Y A;  4W4U A;  3L11 A;  4TKP B;  3DQV R;  2ECT A;  4WZ0 A;  5J3X A;  3LQH A;  2LQ6 A;  1F62 A;  3I2D A;  4IC3 A;  2I50 A;  5FB0 A;  4O64 A;  3KQI A;  5H1U A;  5H1V A;  5LCW B;  4PTB A;  1FP0 A;  1Z2Q A;  2ECN A;  5D1K B;  2L5U A;  4AUQ B;  2PNX A;  5LKT A;  2YT5 A;  2K4D A;  2XP0 A;  4V3K C;  4WA6 A;  2YRE A;  2Y43 A;  2YUR A;  4Q6F A;  3N9O A;  4UI9 B;  2F6J A;  1MM2 A;  1E4U A;  2M3H A;  2XOZ A;  3N9P A;  1LDK C;  1XWH A;  5H1T A;  2K16 A;  3ZPV E;  4S3O C;  2XB1 A;  5B77 A;  3MHS A;  4F52 B;  3N9Q A;  2HDP A;  2VPG A;  3T7L A;  3IHP A;  4YAT A;  2MNZ A;  2C2L A;  2M6M A;  4ZDT A;  1WIM A;  2F6N A;  2CON A;  5KH3 A;  4A0C D;  1WIL A;  5TDR A;  2LDR A;  3SUB A;  2XOY A;  2M1R A;  3QZV A;  4LK9 A;  2YQL A;  1LDJ B;  1WFK A;  3M99 A;  1DCQ A;  5SVI B;  3GL6 A;  1Z60 A;  2L0B A;  2CRW A;  2BAY A;  2RR4 A;  5G05 B;  2KKY A;  2MD7 B;  3N9L A;  1CHC A;  5EYA F;  3PUQ A;  2G45 A;  1V87 A;  2Y1M A;  4GNG A;  4A4C A;  3SOW A;  2ECV A;  3C5K A;  5D1M B;  1FBV A;  2EOD A;  2ECG A;  4FJC A;  2H0D B;  5FB1 A;  4R8P K;  2F42 A;  4H9D A;  2E61 A;  2CKL B;  2DJA A;  3N9N A;  5SVX A;  4AYC B;  2D8S A;  2LGK A;  3H7H A;  5TRB A;  4YAB A;  3FAN A;  4LAD B;  4BBQ A;  2ECW A;  2YYR A;  1WEM A;  4QQ4 A;  3RTR B;  2OWA A;  5LKZ A;  5B8D A;  3FEH A;  2FFW A;  4AVX A;  3DDT A;  2C2V S;  5SVI A;  4XI1 A;  1JM7 B;  2KE1 A;  4WZ3 B;  3E2D A;  3DPL R;  3M62 A;  2IQJ A;  2YU4 A;  3KV5 A;  4YBM A;  1HYJ A;  5AIU A;  3C6W A;  2MKE A;  4YAX A;  3O36 A;  2JMJ A;  4LKA A;  1MBM A;  2FSA A;  3M7K A;  3LDY A;  3T9K A;  2ECJ A;  2B0O E; 
#chains in the Genus database with same CATH homology
 4I7C A;  2KR4 A;  2LN0 A;  2H0D A;  2LXP C;  4WZ2 A;  2L75 A;  1WE9 A;  2YSM A;  2CKL A;  4AYC A;  5FEY A;  5B78 A;  2L43 A;  1X4I A;  2KWK A;  2E6R A;  2QIZ A;  4LJN A;  3RPG C;  2KWN A;  4P5O B;  4L7X A;  3ZYQ A;  4B7Y C;  5KH7 A;  3EB5 A;  2ECI A;  3O70 A;  4BHW A;  3M63 A;  2FUU A;  5G04 B;  2VJF B;  2MNY A;  2KYU A;  3O33 A;  2KIZ A;  4YBS A;  1WEW A;  3SOX A;  1WGM A;  5G0F A;  2M85 A;  4L58 A;  2JMD A;  3SHB A;  4IC2 A;  2CT2 A;  4N3W A;  2NAA A;  1WEU A;  3ZVZ B;  3EB6 A;  5D1L B;  4N4F A;  5H9M A;  2YHN A;  2HYE D;  4CCG X;  5JG6 A;  2YHO A;  3O7A A;  4GB0 A;  1WEN A;  1U6G B;  5C13 A;  2JRJ A;  4PPE A;  3MHH A;  2FUI A;  5B76 A;  2LGL A;  5LKX A;  3O37 A;  1IYM A;  2UZG A;  3HCS A;  3VK6 A;  2MA5 A;  3T6R A;  4B86 C;  3RPG B;  2VJE B;  5I3L A;  3ZTG A;  2KWO A;  2VPE A;  3U5N A;  1K2F A;  2YSJ A;  3N9M A;  2OXQ C;  2MA6 A;  4FO9 A;  2YW8 A;  4NN2 A;  4CA1 A;  3LRQ A;  2EGP A;  2VJF A;  4LLB A;  5LKU A;  1WEP A;  1WEV A;  4I7D A;  4ZUX U;  2K17 A;  2LGV A;  5TBN A;  4YAD A;  3U5P A;  4FK5 A;  2Y1N A;  2KGG A;  4UP0 A;  2CSY A;  4FIP A;  3HCT A;  4MSX A;  5DKA A;  4GNF A;  2G43 A;  2VPB A;  2L80 A;  4A4B A;  3ASL A;  4V3L C;  3HTK C;  3L1X A;  2QIC A;  2LRI C;  4AP4 A;  5FER A;  3L1Z B;  3FL2 A;  1WEE A;  2K1J A;  3ZPV 1;  3PHD A;  1WEQ A;  1JOC A;  2KU3 A;  2DX8 A;  5B79 A;  1DVP A;  1BOR A;  2VJE A;  2EA6 A;  4I7B A;  5TDW A;  4GND A;  3O35 A;  4C9Z A;  1N87 A;  4MVT A;  2MD8 C;  2YUC A;  3LQI A;  3O34 A;  1JM7 A;  1ZBD B;  2LGG A;  4ZQL A;  2YQM A;  1G25 A;  3ZNI A;  2KFT A;  2E6S A;  5TAB A;  1HYI A;  4R7E A;  2LV9 A;  1Z6U A;  5KH9 A;  3HCU A;  3KNV A;  2PUY A;  2MIQ A;  2QJ0 A;  4GNE A;  3ZVY A;  2XEU A;  5DIN A;  4A49 A;  4YC9 A;  3GV4 A;  2KWJ A;  2MT5 A;  2RI7 A;  4QF3 A;  1X4J A;  2ZET C;  1MM3 A;  3LQJ A;  2VP7 A;  1X4U A;  2KGI A;  4UP5 A;  1RMD A;  2IDA A;  1VD4 A;  1WEO A;  3U5M A;  3SOU A;  3V43 A;  2VPD A;  2VNF A;  4S3O B;  5C11 A;  3KV6 A;  2RSD A;  1WES A;  4YBT A;  5AIT A;  1T1H A;  2MUM A;  1VYX A;  1VFY A;  2JMI A;  2G6Q A;  4QF2 A;  5B75 A;  4X3G A;  3PUR A;  3U5O A;  2AN6 A;  2KRE A;  3NG2 A;  2LXH C;  2CSZ A;  4R2Y A;  4W4U A;  3L11 A;  4TKP B;  3DQV R;  2ECT A;  4WZ0 A;  5J3X A;  3LQH A;  2LQ6 A;  1F62 A;  3I2D A;  4IC3 A;  2I50 A;  5FB0 A;  4O64 A;  3KQI A;  5H1U A;  5H1V A;  5LCW B;  4PTB A;  1FP0 A;  1Z2Q A;  2ECN A;  5D1K B;  2L5U A;  4AUQ B;  2PNX A;  5LKT A;  2YT5 A;  2K4D A;  4V3K C;  4WA6 A;  2YRE A;  2Y43 A;  2YUR A;  4Q6F A;  3N9O A;  4UI9 B;  2F6J A;  1MM2 A;  1E4U A;  2M3H A;  3N9P A;  1LDK C;  1XWH A;  5H1T A;  2K16 A;  3ZPV E;  4S3O C;  2XB1 A;  5B77 A;  3MHS A;  4F52 B;  3N9Q A;  2HDP A;  2VPG A;  3T7L A;  3IHP A;  4YAT A;  2MNZ A;  2C2L A;  2M6M A;  4ZDT A;  1WIM A;  2F6N A;  5KH3 A;  4A0C D;  1WIL A;  5TDR A;  2LDR A;  2M1R A;  3QZV A;  4LK9 A;  2YQL A;  1LDJ B;  1WFK A;  3M99 A;  3GL6 A;  1Z60 A;  2L0B A;  2BAY A;  5G05 B;  2MD7 B;  3N9L A;  1CHC A;  5EYA F;  3PUQ A;  2G45 A;  1V87 A;  2Y1M A;  4GNG A;  4A4C A;  3SOW A;  2ECV A;  3C5K A;  5D1M B;  1FBV A;  2EOD A;  2ECG A;  4FJC A;  2H0D B;  5FB1 A;  4R8P K;  2F42 A;  2CKL B;  3N9N A;  4AYC B;  2D8S A;  2LGK A;  5TRB A;  4YAB A;  4LAD B;  4BBQ A;  2ECW A;  2YYR A;  1WEM A;  3RTR B;  5LKZ A;  5B8D A;  4AVX A;  2C2V S;  4XI1 A;  1JM7 B;  2KE1 A;  4WZ3 B;  3DPL R;  3M62 A;  2YU4 A;  3KV5 A;  4YBM A;  1HYJ A;  5AIU A;  3C6W A;  4YAX A;  3O36 A;  2JMJ A;  4LKA A;  2FSA A;  2ECJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...