2JMIA

Nmr solution structure of phd finger fragment of yeast yng1 protein in free state
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein YNG1
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmiA00
1V87A 3O35A 5KH7A 4P5OB 2H0DB 2LN0A 2HDPA 5B8DA 2LV9A 3QZVA 4A49A 5FB1A 2VPGA 2KFTA 3T7LA 5TDWA 5H1TA 4LJNA 5G04B 2MD7B 3ZPVE 2AN6A 2YREA 4L58A 4ZDTA 1T1HA 4GNEA 2ECGA 4UP0A 4AP4A 1G25A 1WEUA 2VJEB 1N87A 5EYAF 2YW8A 5DKAA 2JMJA 3PUQA 4UI9B 2ECVA 5D1LB 4A0CD 5B75A 2CKLB 2YQMA 3FL2A 3N9PA 2MA5A 2YSJA 2Y43A 3ZPV1 2PNXA 2JMIA 2KGGA 1F62A 4YC9A 2M6MA 2QIZA 3HCSA 2KREA 5FB0A 4XI1A 2KYUA 2L75A 2VPDA 4V3LC 3PHDA 3RTRB 4FK5A 5B79A 1X4IA 3VK6A 4YBTA 2K4DA 3RPGC 2QJ0A 4FJCA 2FSAA 4I7DA 2FUUA 3KNVA 4GNDA 4I7CA 3O37A 2VPEA 3MHHA 1WEQA 2KE1A 4AYCB 5B78A 3U5NA 5JG6A 3GL6A 4BBQA 3ZVZB 3LRQA 1WILA 4AYCA 4CCGX 2NAAA 4QF3A 2FUIA 5FERA 1WEVA 4ZQLA 5C13A 4S3OB 4ZUXU 3MHSA 4YATA 3M63A 1WENA 3I2DA 4WZ0A 1LDJB 3N9QA 2XB1A 2VP7A 2OXQC 4LKAA 2KR4A 2KWJA 4YBMA 3LQJA 1WGMA 1JM7B 2EA6A 4R7EA 3LQHA 2MIQA 3N9MA 5H9MA 4N3WA 4A4CA 1WEOA 3N9LA 2YT5A 5KH3A 1WEPA 3C6WA 3N9NA 4YAXA 5D1KB 3EB6A 1WE9A 4GNGA 3ZNIA 4S3OC 1CHCA 3KQIA 1WEWA 5LKXA 3ZVYA 2LXHC 4IC3A 2K16A 5LKUA 2IDAA 2M1RA 4O64A 4TKPB 3KV5A 5B76A 2YURA 4WA6A 1RMDA 1JM7A 3LQIA 2F6JA 1WEMA 1DVPA 2LQ6A 2ECWA 2E6RA 1K2FA 3RPGB 5H1UA 3O70A 2RSDA 2BAYA 2KWNA 2ECJA 4Q6FA 2CT2A 4CA1A 2G43A 2JRJA 4QF2A 2C2LA 1WEEA 3IHPA 4PPEA 2KGIA 2EODA 4YADA 3SOXA 5D1MB 3M99A 5TDRA 3ZTGA 2MD8C 2LXPC 3V43A 2K17A 1X4JA 3T6RA 1FP0A 1MM2A 5B77A 1VYXA 4MSXA 2D8SA 3L1ZB 3M62A 4LADB 3ZYQA 4MVTA 2LGVA 3U5PA 3O7AA 2UZGA 4GB0A 4FIPA 1LDKC 2Y1MA 3L11A 2LGGA 4WZ2A 1HYJA 2C2VS 5TBNA 4IC2A 2PUYA 2G6QA 2YYRA 3SOUA 1E4UA 2I50A 5H1VA 2VNFA 4PTBA 4YBSA 3SHBA 2YHOA 2YQLA 3O36A 1Z60A 5TABA 2XEUA 3KV6A 3N9OA 4AVXA 2MNYA 2G45A 5DINA 2VJFA 4R2YA 2KU3A 3GV4A 1FBVA 5LKTA 3HCUA 4AUQB 2ECNA 3SOWA 1VD4A 2EGPA 2QICA 4B86C 2L0BA 1MM3A 5TRBA 2MNZA 4R8PK 2KWOA 2DX8A 3DPLR 4YABA 1HYIA 3U5OA 1WFKA 2CSZA 2LRIC 3C5KA 2VPBA 2K1JA 5AIUA 3DQVR 4GNFA 2CSYA 4N4FA 1WESA 2LGKA 2MT5A 5G0FA 2F6NA 2YSMA 2YUCA 2HYED 2L80A 1U6GB 2L43A 2ZETC 1VFYA 4C9ZA 2F42A 5FEYA 4LLBA 1Z2QA 2CKLA 5G05B 3O34A 4I7BA 4X3GA 1WIMA 1IYMA 2ECTA 4V3KC 5C11A 2LGLA 2YU4A 4L7XA 4LK9A 2LDRA 1X4UA 3EB5A 1ZBDB 2L5UA 4BHWA 2KIZA 2Y1NA 4UP5A 4F52B 2RI7A 4W4UA 2E6SA 2KWKA 3U5MA 4FO9A 2MA6A 3HTKC 4B7YC 4A4BA 3L1XA 3HCTA 2VJEA 1Z6UA 1JOCA 1BORA 4NN2A 5LCWB 1XWHA 2VJFB 2YHNA 3ASLA 2MUMA 5I3LA 3O33A 2ECIA 2M85A 5J3XA 5LKZA 3NG2A 4WZ3B 5AITA 3PURA 2M3HA 5KH9A 2H0DA 2JMDA
chains in the Genus database with same CATH superfamily
1V87A 3O35A 5KH7A 4P5OB 2H0DB 2LN0A 2HDPA 5B8DA 2JUNA 2LV9A 3QZVA 4A49A 5FB1A 2VPGA 2KFTA 3T7LA 5TDWA 5H1TA 4LJNA 5G04B 2B0OE 2MD7B 3ZPVE 2AN6A 3JUEA 2YREA 4L58A 4ZDTA 1T1HA 4GNEA 2ECGA 2KKYA 4UP0A 4AP4A 1G25A 1WEUA 2VJEB 1N87A 5EYAF 2YW8A 5DKAA 2JMJA 3PUQA 4UI9B 2ECVA 5D1LB 3SUBA 4A0CD 5B75A 2CKLB 2YQMA 3FL2A 3N9PA 2MA5A 2YSJA 2Y43A 3ZPV1 2PNXA 2JMIA 2KGGA 3LVRE 1F62A 4YC9A 2M6MA 2QIZA 3HCSA 2KREA 5FB0A 4XI1A 2KYUA 2L75A 2FD4A 2VPDA 4V3LC 3PHDA 3RTRB 4FK5A 5B79A 2FFWA 1X4IA 2DJAA 3VK6A 4YBTA 3FJUB 2K4DA 3RPGC 2QJ0A 4FJCA 2L7PA 2FSAA 4I7DA 2FUUA 3MDBC 3KNVA 4GNDA 4I7CA 3O37A 4F1PA 3DWDA 2M13A 2VPEA 3MHHA 1WEQA 2KE1A 2XOCA 4AYCB 4O62A 5B78A 3U5NA 5JG6A 3GL6A 4Z0OA 4BBQA 3ZVZB 3LRQA 2LAUA 1WILA 2CRRA 4AYCA 4CCGX 2NAAA 3KDEC 4QF3A 2FUIA 5FERA 1WEVA 4ZQLA 5C13A 1DCQA 4S3OB 4ZUXU 5K3QA 3MHSA 4YATA 3M63A 1WENA 3I2DA 4WZ0A 1LDJB 3N9QA 2XB1A 2VP7A 2OXQC 4LKAA 2KR4A 2KWJA 4YBMA 3LQJA 1WGMA 1JM7B 3LVQE 2EA6A 4R7EA 3LQHA 5SVYA 4Z0RA 2MIQA 3N9MA 5H9MA 4N3WA 4A4CA 1WEOA 3N9LA 3E2DA 2YT5A 4H9DA 5KH3A 2P57A 1WEPA 4OGEA 3C6WA 3T9KA 3N9NA 4YAXA 5D1KB 3EB6A 1WE9A 4GNGA 3ZNIA 2CONA 2RR4A 4S3OC 1CHCA 3KQIA 1WEWA 2IQJA 5LKXA 3ZVYA 2LXHC 4IC3A 2K16A 5LKUA 2IDAA 2M1RA 2EGMA 4O64A 4TKPB 3KV5A 5B76A 2YURA 4WA6A 1RMDA 1JM7A 3LQIA 2F6JA 1WEMA 1DVPA 2LQ6A 3FEHA 2ECWA 2E6RA 3O47A 1K2FA 3RPGB 5H1UA 3O70A 2RSDA 2CSVA 3FM8C 2BAYA 2KWNA 2ECJA 4Q6FA 2CT2A 4CA1A 2G43A 2JRJA 2OWAA 4QF2A 2C2LA 1WEEA 3IHPA 4PPEA 2KGIA 2EODA 3DDTA 4YADA 3SOXA 5D1MB 3M99A 5TDRA 3ZTGA 2MD8C 2LXPC 3V43A 2K17A 2JM3A 1X4JA 3T6RA 1FP0A 1MM2A 2YVRA 3LDYA 5B77A 1VYXA 4MSXA 2D8SA 3L1ZB 3M62A 2MKEA 4LADB 4MVTA 3ZYQA 2LGVA 3U5PA 1MBMA 3O7AA 2UZGA 2D8UA 4GB0A 4FIPA 1LDKC 2Y1MA 3L11A 2LGGA 4WZ2A 3PLWA 2EXUA 1HYJA 2C2VS 5TBNA 4IC2A 2PUYA 2G6QA 2YYRA 2E61A 3SOUA 1E4UA 2I50A 2DSMA 5H1VA 2VNFA 3Q1DA 4PTBA 4YBSA 3SHBA 2YHOA 2YQLA 3O36A 1Z60A 5TABA 2XEUA 3KV6A 3N9OA 4AVXA 4QQ4A 2MNYA 2G45A 5DINA 2VJFA 4R2YA 2KU3A 3GV4A 1FBVA 5LKTA 3HCUA 4AUQB 2ECNA 3SOWA 1VD4A 2EGPA 2QICA 4B86C 2L0BA 1MM3A 5TRBA 2MNZA 4R8PK 2KWOA 2DX8A 3DPLR 4YABA 1HYIA 3U5OA 1WFKA 2CSZA 3LJUX 2LRIC 3FAOA 3C5KA 2VPBA 2K1JA 5AIUA 3H7HA 3DQVR 2XP0A 4GNFA 4OGCA 2CSYA 4N4FA 1WESA 2LGKA 2MT5A 5G0FA 2F6NA 2YSMA 5SVIB 5SVXA 2YUCA 2HYED 2L80A 1U6GB 2L43A 2ZETC 1VFYA 5SVIA 4C9ZA 2F42A 5FEYA 4LLBA 1Z2QA 2CKLA 5G05B 3O34A 4I7BA 4X3GA 2KKXA 1WIMA 1IYMA 2ECTA 4V3KC 5C11A 2LGLA 2YU4A 4L7XA 4LK9A 2LDRA 1X4UA 3EB5A 1ZBDB 2L5UA 4BHWA 2KIZA 2Y1NA 3FANA 4UP5A 4F52B 2RI7A 4W4UA 2XOYA 2E6SA 2KWKA 3U5MA 4FO9A 2MA6A 3HTKC 4B7YC 3L1XA 3HCTA 4A4BA 2VJEA 1Z6UA 1JOCA 1BORA 2XOZA 4NN2A 5LCWB 1XWHA 2VJFB 2YHNA 3ASLA 2MUMA 5I3LA 3O33A 2CRWA 2ECIA 2M85A 5J3XA 5LKZA 3NG2A 4WZ3B 5AITA 3PURA 2M3HA 5KH9A 2H0DA 3M7KA 2JMDA
chains in the Genus database with same CATH topology
1V87A 3O35A 5KH7A 4P5OB 2H0DB 2LN0A 2HDPA 5B8DA 2LV9A 3QZVA 4A49A 5FB1A 2VPGA 2KFTA 3T7LA 5TDWA 5H1TA 4LJNA 5G04B 2MD7B 3ZPVE 2AN6A 2YREA 4L58A 4ZDTA 1T1HA 4GNEA 2ECGA 4UP0A 4AP4A 1G25A 1WEUA 2VJEB 1N87A 5EYAF 2YW8A 5DKAA 2JMJA 3PUQA 4UI9B 2ECVA 5D1LB 4A0CD 5B75A 2CKLB 2YQMA 3FL2A 3N9PA 2MA5A 2YSJA 2Y43A 3ZPV1 2PNXA 2JMIA 2KGGA 1F62A 4YC9A 2M6MA 2QIZA 3HCSA 2KREA 5FB0A 4XI1A 2KYUA 2L75A 2VPDA 4V3LC 3PHDA 3RTRB 4FK5A 5B79A 1X4IA 3VK6A 4YBTA 2K4DA 3RPGC 2QJ0A 4FJCA 2FSAA 4I7DA 2FUUA 3KNVA 4GNDA 4I7CA 3O37A 2VPEA 3MHHA 1WEQA 2KE1A 4AYCB 5B78A 3U5NA 5JG6A 3GL6A 4BBQA 3ZVZB 3LRQA 1WILA 4AYCA 4CCGX 2NAAA 4QF3A 2FUIA 5FERA 1WEVA 4ZQLA 5C13A 4S3OB 4ZUXU 3MHSA 4YATA 3M63A 1WENA 3I2DA 4WZ0A 1LDJB 3N9QA 2XB1A 2VP7A 2OXQC 4LKAA 2KR4A 2KWJA 4YBMA 3LQJA 1WGMA 1JM7B 2EA6A 4R7EA 3LQHA 2MIQA 3N9MA 5H9MA 4N3WA 4A4CA 1WEOA 3N9LA 2YT5A 5KH3A 1WEPA 3C6WA 3N9NA 4YAXA 5D1KB 3EB6A 1WE9A 4GNGA 3ZNIA 4S3OC 1CHCA 3KQIA 1WEWA 5LKXA 3ZVYA 2LXHC 4IC3A 2K16A 5LKUA 2IDAA 2M1RA 4O64A 4TKPB 3KV5A 5B76A 2YURA 4WA6A 1RMDA 1JM7A 3LQIA 2F6JA 1WEMA 1DVPA 2LQ6A 2ECWA 2E6RA 1K2FA 3RPGB 5H1UA 3O70A 2RSDA 2BAYA 2KWNA 2ECJA 4Q6FA 2CT2A 4CA1A 2G43A 2JRJA 4QF2A 2C2LA 1WEEA 3IHPA 4PPEA 2KGIA 2EODA 4YADA 3SOXA 5D1MB 3M99A 5TDRA 3ZTGA 2MD8C 2LXPC 3V43A 2K17A 1X4JA 3T6RA 1FP0A 1MM2A 5B77A 1VYXA 4MSXA 2D8SA 3L1ZB 3M62A 4LADB 3ZYQA 4MVTA 2LGVA 3U5PA 3O7AA 2UZGA 4GB0A 4FIPA 1LDKC 2Y1MA 3L11A 2LGGA 4WZ2A 1HYJA 2C2VS 5TBNA 4IC2A 2PUYA 2G6QA 2YYRA 3SOUA 1E4UA 2I50A 5H1VA 2VNFA 4PTBA 4YBSA 3SHBA 2YHOA 2YQLA 3O36A 1Z60A 5TABA 2XEUA 3KV6A 3N9OA 4AVXA 2MNYA 2G45A 5DINA 2VJFA 4R2YA 2KU3A 3GV4A 1FBVA 5LKTA 3HCUA 4AUQB 2ECNA 3SOWA 1VD4A 2EGPA 2QICA 4B86C 2L0BA 1MM3A 5TRBA 2MNZA 4R8PK 2KWOA 2DX8A 3DPLR 4YABA 1HYIA 3U5OA 1WFKA 2CSZA 2LRIC 3C5KA 2VPBA 2K1JA 5AIUA 3DQVR 4GNFA 2CSYA 4N4FA 1WESA 2LGKA 2MT5A 5G0FA 2F6NA 2YSMA 2YUCA 2HYED 2L80A 1U6GB 2L43A 2ZETC 1VFYA 4C9ZA 2F42A 5FEYA 4LLBA 1Z2QA 2CKLA 5G05B 3O34A 4I7BA 4X3GA 1WIMA 1IYMA 2ECTA 4V3KC 5C11A 2LGLA 2YU4A 4L7XA 4LK9A 2LDRA 1X4UA 3EB5A 1ZBDB 2L5UA 4BHWA 2KIZA 2Y1NA 4UP5A 4F52B 2RI7A 4W4UA 2E6SA 2KWKA 3U5MA 4FO9A 2MA6A 3HTKC 4B7YC 4A4BA 3L1XA 3HCTA 2VJEA 1Z6UA 1JOCA 1BORA 4NN2A 5LCWB 1XWHA 2VJFB 2YHNA 3ASLA 2MUMA 5I3LA 3O33A 2ECIA 2M85A 5J3XA 5LKZA 3NG2A 4WZ3B 5AITA 3PURA 2M3HA 5KH9A 2H0DA 2JMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V87 A;  3O35 A;  5KH7 A;  4P5O B;  2H0D B;  2LN0 A;  2HDP A;  5B8D A;  2LV9 A;  3QZV A;  4A49 A;  5FB1 A;  2VPG A;  2KFT A;  3T7L A;  5TDW A;  5H1T A;  4LJN A;  5G04 B;  2MD7 B;  3ZPV E;  2AN6 A;  2YRE A;  4L58 A;  4ZDT A;  1T1H A;  4GNE A;  2ECG A;  4UP0 A;  4AP4 A;  1G25 A;  1WEU A;  2VJE B;  1N87 A;  5EYA F;  2YW8 A;  5DKA A;  2JMJ A;  3PUQ A;  4UI9 B;  2ECV A;  5D1L B;  4A0C D;  5B75 A;  2CKL B;  2YQM A;  3FL2 A;  3N9P A;  2MA5 A;  2YSJ A;  2Y43 A;  3ZPV 1;  2PNX A;  2JMI A;  2KGG A;  1F62 A;  4YC9 A;  2M6M A;  2QIZ A;  3HCS A;  2KRE A;  5FB0 A;  4XI1 A;  2KYU A;  2L75 A;  2VPD A;  4V3L C;  3PHD A;  3RTR B;  4FK5 A;  5B79 A;  1X4I A;  3VK6 A;  4YBT A;  2K4D A;  3RPG C;  2QJ0 A;  4FJC A;  2FSA A;  4I7D A;  2FUU A;  3KNV A;  4GND A;  4I7C A;  3O37 A;  2VPE A;  3MHH A;  1WEQ A;  2KE1 A;  4AYC B;  5B78 A;  3U5N A;  5JG6 A;  3GL6 A;  4BBQ A;  3ZVZ B;  3LRQ A;  1WIL A;  4AYC A;  4CCG X;  2NAA A;  4QF3 A;  2FUI A;  5FER A;  1WEV A;  4ZQL A;  5C13 A;  4S3O B;  4ZUX U;  3MHS A;  4YAT A;  3M63 A;  1WEN A;  3I2D A;  4WZ0 A;  1LDJ B;  3N9Q A;  2XB1 A;  2VP7 A;  2OXQ C;  4LKA A;  2KR4 A;  2KWJ A;  4YBM A;  3LQJ A;  1WGM A;  1JM7 B;  2EA6 A;  4R7E A;  3LQH A;  2MIQ A;  3N9M A;  5H9M A;  4N3W A;  4A4C A;  1WEO A;  3N9L A;  2YT5 A;  5KH3 A;  1WEP A;  3C6W A;  3N9N A;  4YAX A;  5D1K B;  3EB6 A;  1WE9 A;  4GNG A;  3ZNI A;  4S3O C;  1CHC A;  3KQI A;  1WEW A;  5LKX A;  3ZVY A;  2LXH C;  4IC3 A;  2K16 A;  5LKU A;  2IDA A;  2M1R A;  4O64 A;  4TKP B;  3KV5 A;  5B76 A;  2YUR A;  4WA6 A;  1RMD A;  1JM7 A;  3LQI A;  2F6J A;  1WEM A;  1DVP A;  2LQ6 A;  2ECW A;  2E6R A;  1K2F A;  3RPG B;  5H1U A;  3O70 A;  2RSD A;  2BAY A;  2KWN A;  2ECJ A;  4Q6F A;  2CT2 A;  4CA1 A;  2G43 A;  2JRJ A;  4QF2 A;  2C2L A;  1WEE A;  3IHP A;  4PPE A;  2KGI A;  2EOD A;  4YAD A;  3SOX A;  5D1M B;  3M99 A;  5TDR A;  3ZTG A;  2MD8 C;  2LXP C;  3V43 A;  2K17 A;  1X4J A;  3T6R A;  1FP0 A;  1MM2 A;  5B77 A;  1VYX A;  4MSX A;  2D8S A;  3L1Z B;  3M62 A;  4LAD B;  3ZYQ A;  4MVT A;  2LGV A;  3U5P A;  3O7A A;  2UZG A;  4GB0 A;  4FIP A;  1LDK C;  2Y1M A;  3L11 A;  2LGG A;  4WZ2 A;  1HYJ A;  2C2V S;  5TBN A;  4IC2 A;  2PUY A;  2G6Q A;  2YYR A;  3SOU A;  1E4U A;  2I50 A;  5H1V A;  2VNF A;  4PTB A;  4YBS A;  3SHB A;  2YHO A;  2YQL A;  3O36 A;  1Z60 A;  5TAB A;  2XEU A;  3KV6 A;  3N9O A;  4AVX A;  2MNY A;  2G45 A;  5DIN A;  2VJF A;  4R2Y A;  2KU3 A;  3GV4 A;  1FBV A;  5LKT A;  3HCU A;  4AUQ B;  2ECN A;  3SOW A;  1VD4 A;  2EGP A;  2QIC A;  4B86 C;  2L0B A;  1MM3 A;  5TRB A;  2MNZ A;  4R8P K;  2KWO A;  2DX8 A;  3DPL R;  4YAB A;  1HYI A;  3U5O A;  1WFK A;  2CSZ A;  2LRI C;  3C5K A;  2VPB A;  2K1J A;  5AIU A;  3DQV R;  4GNF A;  2CSY A;  4N4F A;  1WES A;  2LGK A;  2MT5 A;  5G0F A;  2F6N A;  2YSM A;  2YUC A;  2HYE D;  2L80 A;  1U6G B;  2L43 A;  2ZET C;  1VFY A;  4C9Z A;  2F42 A;  5FEY A;  4LLB A;  1Z2Q A;  2CKL A;  5G05 B;  3O34 A;  4I7B A;  4X3G A;  1WIM A;  1IYM A;  2ECT A;  4V3K C;  5C11 A;  2LGL A;  2YU4 A;  4L7X A;  4LK9 A;  2LDR A;  1X4U A;  3EB5 A;  1ZBD B;  2L5U A;  4BHW A;  2KIZ A;  2Y1N A;  4UP5 A;  4F52 B;  2RI7 A;  4W4U A;  2E6S A;  2KWK A;  3U5M A;  4FO9 A;  2MA6 A;  3HTK C;  4B7Y C;  4A4B A;  3L1X A;  3HCT A;  2VJE A;  1Z6U A;  1JOC A;  1BOR A;  4NN2 A;  5LCW B;  1XWH A;  2VJF B;  2YHN A;  3ASL A;  2MUM A;  5I3L A;  3O33 A;  2ECI A;  2M85 A;  5J3X A;  5LKZ A;  3NG2 A;  4WZ3 B;  5AIT A;  3PUR A;  2M3H A;  5KH9 A;  2H0D A;  2JMD A; 
#chains in the Genus database with same CATH topology
 1V87 A;  3O35 A;  5KH7 A;  4P5O B;  2H0D B;  2LN0 A;  2HDP A;  5B8D A;  2JUN A;  2LV9 A;  3QZV A;  4A49 A;  5FB1 A;  2VPG A;  2KFT A;  3T7L A;  5TDW A;  5H1T A;  4LJN A;  5G04 B;  2B0O E;  2MD7 B;  3ZPV E;  2AN6 A;  3JUE A;  2YRE A;  4L58 A;  4ZDT A;  1T1H A;  4GNE A;  2ECG A;  2KKY A;  4UP0 A;  4AP4 A;  1G25 A;  1WEU A;  2VJE B;  1N87 A;  5EYA F;  2YW8 A;  5DKA A;  2JMJ A;  3PUQ A;  4UI9 B;  2ECV A;  5D1L B;  3SUB A;  4A0C D;  5B75 A;  2CKL B;  2YQM A;  3FL2 A;  3N9P A;  2MA5 A;  2YSJ A;  2Y43 A;  3ZPV 1;  2PNX A;  2JMI A;  2KGG A;  3LVR E;  1F62 A;  4YC9 A;  2M6M A;  2QIZ A;  3HCS A;  2KRE A;  5FB0 A;  4XI1 A;  2KYU A;  2L75 A;  2FD4 A;  2VPD A;  4V3L C;  3PHD A;  3RTR B;  4FK5 A;  5B79 A;  2FFW A;  1X4I A;  2DJA A;  3VK6 A;  4YBT A;  3FJU B;  2K4D A;  3RPG C;  2QJ0 A;  4FJC A;  2L7P A;  2FSA A;  4I7D A;  2FUU A;  3MDB C;  3KNV A;  4GND A;  4I7C A;  3O37 A;  4F1P A;  3DWD A;  2M13 A;  2VPE A;  3MHH A;  1WEQ A;  2KE1 A;  2XOC A;  4AYC B;  4O62 A;  5B78 A;  3U5N A;  5JG6 A;  3GL6 A;  4Z0O A;  4BBQ A;  3ZVZ B;  3LRQ A;  2LAU A;  1WIL A;  2CRR A;  4AYC A;  4CCG X;  2NAA A;  3KDE C;  4QF3 A;  2FUI A;  5FER A;  1WEV A;  4ZQL A;  5C13 A;  1DCQ A;  4S3O B;  4ZUX U;  5K3Q A;  3MHS A;  4YAT A;  3M63 A;  1WEN A;  3I2D A;  4WZ0 A;  1LDJ B;  3N9Q A;  2XB1 A;  2VP7 A;  2OXQ C;  4LKA A;  2KR4 A;  2KWJ A;  4YBM A;  3LQJ A;  1WGM A;  1JM7 B;  3LVQ E;  2EA6 A;  4R7E A;  3LQH A;  5SVY A;  4Z0R A;  2MIQ A;  3N9M A;  5H9M A;  4N3W A;  4A4C A;  1WEO A;  3N9L A;  3E2D A;  2YT5 A;  4H9D A;  5KH3 A;  2P57 A;  1WEP A;  4OGE A;  3C6W A;  3T9K A;  3N9N A;  4YAX A;  5D1K B;  3EB6 A;  1WE9 A;  4GNG A;  3ZNI A;  2CON A;  2RR4 A;  4S3O C;  1CHC A;  3KQI A;  1WEW A;  2IQJ A;  5LKX A;  3ZVY A;  2LXH C;  4IC3 A;  2K16 A;  5LKU A;  2IDA A;  2M1R A;  2EGM A;  4O64 A;  4TKP B;  3KV5 A;  5B76 A;  2YUR A;  4WA6 A;  1RMD A;  1JM7 A;  3LQI A;  2F6J A;  1WEM A;  1DVP A;  2LQ6 A;  3FEH A;  2ECW A;  2E6R A;  3O47 A;  1K2F A;  3RPG B;  5H1U A;  3O70 A;  2RSD A;  2CSV A;  3FM8 C;  2BAY A;  2KWN A;  2ECJ A;  4Q6F A;  2CT2 A;  4CA1 A;  2G43 A;  2JRJ A;  2OWA A;  4QF2 A;  2C2L A;  1WEE A;  3IHP A;  4PPE A;  2KGI A;  2EOD A;  3DDT A;  4YAD A;  3SOX A;  5D1M B;  3M99 A;  5TDR A;  3ZTG A;  2MD8 C;  2LXP C;  3V43 A;  2K17 A;  2JM3 A;  1X4J A;  3T6R A;  1FP0 A;  1MM2 A;  2YVR A;  3LDY A;  5B77 A;  1VYX A;  4MSX A;  2D8S A;  3L1Z B;  3M62 A;  2MKE A;  4LAD B;  4MVT A;  3ZYQ A;  2LGV A;  3U5P A;  1MBM A;  3O7A A;  2UZG A;  2D8U A;  4GB0 A;  4FIP A;  1LDK C;  2Y1M A;  3L11 A;  2LGG A;  4WZ2 A;  3PLW A;  2EXU A;  1HYJ A;  2C2V S;  5TBN A;  4IC2 A;  2PUY A;  2G6Q A;  2YYR A;  2E61 A;  3SOU A;  1E4U A;  2I50 A;  2DSM A;  5H1V A;  2VNF A;  3Q1D A;  4PTB A;  4YBS A;  3SHB A;  2YHO A;  2YQL A;  3O36 A;  1Z60 A;  5TAB A;  2XEU A;  3KV6 A;  3N9O A;  4AVX A;  4QQ4 A;  2MNY A;  2G45 A;  5DIN A;  2VJF A;  4R2Y A;  2KU3 A;  3GV4 A;  1FBV A;  5LKT A;  3HCU A;  4AUQ B;  2ECN A;  3SOW A;  1VD4 A;  2EGP A;  2QIC A;  4B86 C;  2L0B A;  1MM3 A;  5TRB A;  2MNZ A;  4R8P K;  2KWO A;  2DX8 A;  3DPL R;  4YAB A;  1HYI A;  3U5O A;  1WFK A;  2CSZ A;  3LJU X;  2LRI C;  3FAO A;  3C5K A;  2VPB A;  2K1J A;  5AIU A;  3H7H A;  3DQV R;  2XP0 A;  4GNF A;  4OGC A;  2CSY A;  4N4F A;  1WES A;  2LGK A;  2MT5 A;  5G0F A;  2F6N A;  2YSM A;  5SVI B;  5SVX A;  2YUC A;  2HYE D;  2L80 A;  1U6G B;  2L43 A;  2ZET C;  1VFY A;  5SVI A;  4C9Z A;  2F42 A;  5FEY A;  4LLB A;  1Z2Q A;  2CKL A;  5G05 B;  3O34 A;  4I7B A;  4X3G A;  2KKX A;  1WIM A;  1IYM A;  2ECT A;  4V3K C;  5C11 A;  2LGL A;  2YU4 A;  4L7X A;  4LK9 A;  2LDR A;  1X4U A;  3EB5 A;  1ZBD B;  2L5U A;  4BHW A;  2KIZ A;  2Y1N A;  3FAN A;  4UP5 A;  4F52 B;  2RI7 A;  4W4U A;  2XOY A;  2E6S A;  2KWK A;  3U5M A;  4FO9 A;  2MA6 A;  3HTK C;  4B7Y C;  3L1X A;  3HCT A;  4A4B A;  2VJE A;  1Z6U A;  1JOC A;  1BOR A;  2XOZ A;  4NN2 A;  5LCW B;  1XWH A;  2VJF B;  2YHN A;  3ASL A;  2MUM A;  5I3L A;  3O33 A;  2CRW A;  2ECI A;  2M85 A;  5J3X A;  5LKZ A;  3NG2 A;  4WZ3 B;  5AIT A;  3PUR A;  2M3H A;  5KH9 A;  2H0D A;  3M7K A;  2JMD A; 
#chains in the Genus database with same CATH homology
 1V87 A;  3O35 A;  5KH7 A;  4P5O B;  2H0D B;  2LN0 A;  2HDP A;  5B8D A;  2LV9 A;  3QZV A;  4A49 A;  5FB1 A;  2VPG A;  2KFT A;  3T7L A;  5TDW A;  5H1T A;  4LJN A;  5G04 B;  2MD7 B;  3ZPV E;  2AN6 A;  2YRE A;  4L58 A;  4ZDT A;  1T1H A;  4GNE A;  2ECG A;  4UP0 A;  4AP4 A;  1G25 A;  1WEU A;  2VJE B;  1N87 A;  5EYA F;  2YW8 A;  5DKA A;  2JMJ A;  3PUQ A;  4UI9 B;  2ECV A;  5D1L B;  4A0C D;  5B75 A;  2CKL B;  2YQM A;  3FL2 A;  3N9P A;  2MA5 A;  2YSJ A;  2Y43 A;  3ZPV 1;  2PNX A;  2JMI A;  2KGG A;  1F62 A;  4YC9 A;  2M6M A;  2QIZ A;  3HCS A;  2KRE A;  5FB0 A;  4XI1 A;  2KYU A;  2L75 A;  2VPD A;  4V3L C;  3PHD A;  3RTR B;  4FK5 A;  5B79 A;  1X4I A;  3VK6 A;  4YBT A;  2K4D A;  3RPG C;  2QJ0 A;  4FJC A;  2FSA A;  4I7D A;  2FUU A;  3KNV A;  4GND A;  4I7C A;  3O37 A;  2VPE A;  3MHH A;  1WEQ A;  2KE1 A;  4AYC B;  5B78 A;  3U5N A;  5JG6 A;  3GL6 A;  4BBQ A;  3ZVZ B;  3LRQ A;  1WIL A;  4AYC A;  4CCG X;  2NAA A;  4QF3 A;  2FUI A;  5FER A;  1WEV A;  4ZQL A;  5C13 A;  4S3O B;  4ZUX U;  3MHS A;  4YAT A;  3M63 A;  1WEN A;  3I2D A;  4WZ0 A;  1LDJ B;  3N9Q A;  2XB1 A;  2VP7 A;  2OXQ C;  4LKA A;  2KR4 A;  2KWJ A;  4YBM A;  3LQJ A;  1WGM A;  1JM7 B;  2EA6 A;  4R7E A;  3LQH A;  2MIQ A;  3N9M A;  5H9M A;  4N3W A;  4A4C A;  1WEO A;  3N9L A;  2YT5 A;  5KH3 A;  1WEP A;  3C6W A;  3N9N A;  4YAX A;  5D1K B;  3EB6 A;  1WE9 A;  4GNG A;  3ZNI A;  4S3O C;  1CHC A;  3KQI A;  1WEW A;  5LKX A;  3ZVY A;  2LXH C;  4IC3 A;  2K16 A;  5LKU A;  2IDA A;  2M1R A;  4O64 A;  4TKP B;  3KV5 A;  5B76 A;  2YUR A;  4WA6 A;  1RMD A;  1JM7 A;  3LQI A;  2F6J A;  1WEM A;  1DVP A;  2LQ6 A;  2ECW A;  2E6R A;  1K2F A;  3RPG B;  5H1U A;  3O70 A;  2RSD A;  2BAY A;  2KWN A;  2ECJ A;  4Q6F A;  2CT2 A;  4CA1 A;  2G43 A;  2JRJ A;  4QF2 A;  2C2L A;  1WEE A;  3IHP A;  4PPE A;  2KGI A;  2EOD A;  4YAD A;  3SOX A;  5D1M B;  3M99 A;  5TDR A;  3ZTG A;  2MD8 C;  2LXP C;  3V43 A;  2K17 A;  1X4J A;  3T6R A;  1FP0 A;  1MM2 A;  5B77 A;  1VYX A;  4MSX A;  2D8S A;  3L1Z B;  3M62 A;  4LAD B;  3ZYQ A;  4MVT A;  2LGV A;  3U5P A;  3O7A A;  2UZG A;  4GB0 A;  4FIP A;  1LDK C;  2Y1M A;  3L11 A;  2LGG A;  4WZ2 A;  1HYJ A;  2C2V S;  5TBN A;  4IC2 A;  2PUY A;  2G6Q A;  2YYR A;  3SOU A;  1E4U A;  2I50 A;  5H1V A;  2VNF A;  4PTB A;  4YBS A;  3SHB A;  2YHO A;  2YQL A;  3O36 A;  1Z60 A;  5TAB A;  2XEU A;  3KV6 A;  3N9O A;  4AVX A;  2MNY A;  2G45 A;  5DIN A;  2VJF A;  4R2Y A;  2KU3 A;  3GV4 A;  1FBV A;  5LKT A;  3HCU A;  4AUQ B;  2ECN A;  3SOW A;  1VD4 A;  2EGP A;  2QIC A;  4B86 C;  2L0B A;  1MM3 A;  5TRB A;  2MNZ A;  4R8P K;  2KWO A;  2DX8 A;  3DPL R;  4YAB A;  1HYI A;  3U5O A;  1WFK A;  2CSZ A;  2LRI C;  3C5K A;  2VPB A;  2K1J A;  5AIU A;  3DQV R;  4GNF A;  2CSY A;  4N4F A;  1WES A;  2LGK A;  2MT5 A;  5G0F A;  2F6N A;  2YSM A;  2YUC A;  2HYE D;  2L80 A;  1U6G B;  2L43 A;  2ZET C;  1VFY A;  4C9Z A;  2F42 A;  5FEY A;  4LLB A;  1Z2Q A;  2CKL A;  5G05 B;  3O34 A;  4I7B A;  4X3G A;  1WIM A;  1IYM A;  2ECT A;  4V3K C;  5C11 A;  2LGL A;  2YU4 A;  4L7X A;  4LK9 A;  2LDR A;  1X4U A;  3EB5 A;  1ZBD B;  2L5U A;  4BHW A;  2KIZ A;  2Y1N A;  4UP5 A;  4F52 B;  2RI7 A;  4W4U A;  2E6S A;  2KWK A;  3U5M A;  4FO9 A;  2MA6 A;  3HTK C;  4B7Y C;  4A4B A;  3L1X A;  3HCT A;  2VJE A;  1Z6U A;  1JOC A;  1BOR A;  4NN2 A;  5LCW B;  1XWH A;  2VJF B;  2YHN A;  3ASL A;  2MUM A;  5I3L A;  3O33 A;  2ECI A;  2M85 A;  5J3X A;  5LKZ A;  3NG2 A;  4WZ3 B;  5AIT A;  3PUR A;  2M3H A;  5KH9 A;  2H0D A;  2JMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...