2JMIA

Nmr solution structure of phd finger fragment of yeast yng1 protein in free state
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YNG1
publication title Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmiA00
2F6NA 2KE1A 2QICA 1JM7A 2RI7A 2BAYA 2K1JA 1JOCA 3DPLR 1V87A 2FUUA 2DX8A 4S3OC 2KU3A 2VJEB 1BORA 4TKPB 3ZNIA 2XB1A 4I7DA 2M1RA 4ZDTA 2E6SA 3M99A 4GB0A 4V3LC 5C13A 3ZPV1 5TRBA 2LXPC 3ZTGA 3KV5A 4AUQB 1U6GB 4B86C 1XWHA 3KNVA 2LGVA 2Y1NA 2LGGA 4YBMA 5C11A 2MNYA 2PNXA 4L7XA 4V3KC 5FERA 3SOUA 4LKAA 5DINA 3M63A 4B7YC 2YUCA 3HCUA 2YYRA 5FEYA 1WESA 3L1XA 3O34A 3PUQA 5I3LA 4YAXA 1WFKA 2KWOA 3KV6A 5B79A 1WE9A 4FO9A 3SOXA 3GV4A 3M62A 3MHHA 1X4JA 2YSMA 1LDKC 2EODA 1FBVA 1WIMA 5FB0A 1ZBDB 1G25A 5G04B 4MSXA 3PHDA 2KWKA 3V43A 4A4BA 2LRIC 2I50A 4WZ2A 2CT2A 2JMIA 3QZVA 4Q6FA 5AITA 2KYUA 1Z2QA 4WZ0A 2MT5A 2LGKA 5B76A 3ZVYA 3LQHA 4A0CD 2M3HA 4ZUXU 2VP7A 2CSYA 2YQMA 2KGIA 2KREA 2YSJA 2YW8A 3EB6A 5LKXA 4GNGA 3N9NA 4R2YA 4I7BA 4N4FA 2FSAA 1VFYA 1FP0A 4LLBA 2C2VS 5TDRA 3U5MA 3KQIA 5D1LB 4A4CA 4O64A 4XI1A 5LKUA 2ECIA 2LN0A 2E6RA 2H0DB 2ZETC 1WEOA 3N9OA 1VD4A 2HDPA 2NAAA 4A49A 4YADA 2L80A 3LQJA 3DQVR 2H0DA 2G6QA 2YQLA 3LRQA 5H1UA 2LDRA 2ECNA 3L11A 4FJCA 4UI9B 5LKZA 4C9ZA 4AYCB 5G05B 1CHCA 3N9PA 5H9MA 3PURA 4IC3A 1N87A 2QJ0A 1WENA 4AYCA 1Z60A 2K16A 2JMJA 2D8SA 2MUMA 4UP5A 4QF3A 1WEWA 4X3GA 2YHNA 2YHOA 3RPGB 2VPGA 3HCSA 3NG2A 1IYMA 4GNFA 3N9MA 3IHPA 3RTRB 2VPBA 3LQIA 3MHSA 4YBTA 3HCTA 5KH3A 5B8DA 3O36A 5JG6A 4WZ3B 4MVTA 2RSDA 4F52B 1DVPA 3C6WA 3T7LA 2G45A 3U5OA 4R7EA 2K17A 2EA6A 2Y43A 2Y1MA 2KWNA 4PTBA 2KIZA 2F42A 2M85A 2KGGA 1X4IA 3ASLA 1MM3A 4LADB 3O33A 2K4DA 5DKAA 2L43A 3L1ZB 3O7AA 4YABA 3O37A 2UZGA 2ECTA 4R8PK 3RPGC 2VPDA 3U5PA 2M6MA 3I2DA 5EYAF 2ECGA 2G43A 5LCWB 2YT5A 2MNZA 4IC2A 1VYXA 4ZQLA 2LXHC 1LDJB 4LK9A 4W4UA 5TDWA 1WEPA 4PPEA 3N9QA 4CCGX 5KH9A 2VJFB 2PUYA 2VNFA 5D1MB 4FK5A 5TBNA 2ECVA 1E4UA 4L58A 3EB5A 3ZPVE 3ZVZB 2VJFA 3O70A 1HYIA 5KH7A 2C2LA 3T6RA 2VJEA 5B78A 5G0FA 2YURA 3SOWA 2FUIA 1WEEA 1WGMA 2JMDA 2XEUA 5LKTA 4AVXA 4P5OB 1MM2A 4LJNA 2YU4A 5AIUA 5H1TA 4YC9A 5H1VA 4N3WA 5J3XA 3HTKC 2CSZA 2VPEA 5FB1A 2L75A 2OXQC 3SHBA 3N9LA 2JRJA 4WA6A 2AN6A 2LGLA 4FIPA 2IDAA 1WEVA 4NN2A 2EGPA 4S3OB 1WILA 2MD8C 2KWJA 2YREA 1T1HA 4UP0A 1Z6UA 1X4UA 2MA6A 2KFTA 4AP4A 3GL6A 3O35A 4YATA 4BBQA 2LQ6A 3FL2A 4CA1A 2HYED 1WEMA 5TABA 3VK6A 5B77A 1HYJA 3U5NA 2CKLB 4GNEA 4GNDA 2QIZA 2LV9A 2F6JA 4I7CA 1RMDA 4YBSA 2MIQA 1K2FA 2MD7B 2CKLA 1F62A 2KR4A 5D1KB 3C5KA 2ECWA 2L0BA 1JM7B 4QF2A 4BHWA 1WEUA 5B75A 2ECJA 1WEQA 2L5UA 3ZYQA 2MA5A
chains in the Genus database with same CATH superfamily
2F6NA 2KE1A 2QICA 1JM7A 3MDBC 2RI7A 2BAYA 2K1JA 1JOCA 3DPLR 3DWDA 1V87A 2FUUA 2JM3A 2DX8A 4S3OC 2KU3A 2VJEB 1BORA 4TKPB 3ZNIA 2XB1A 3FANA 4I7DA 2M1RA 4ZDTA 2E6SA 3M99A 4GB0A 4V3LC 5C13A 3ZPV1 5TRBA 2LXPC 3ZTGA 3KV5A 4AUQB 1U6GB 3JUEA 4B86C 1XWHA 3KNVA 2LGVA 2Y1NA 2LGGA 2M13A 4YBMA 2D8UA 5C11A 2MNYA 2PNXA 4L7XA 4V3KC 5FERA 3SOUA 4LKAA 2CSVA 4H9DA 5DINA 3M63A 4B7YC 2YUCA 3HCUA 2YYRA 5FEYA 1WESA 3LDYA 3L1XA 3O34A 3PUQA 5I3LA 4YAXA 1WFKA 2KWOA 3KV6A 2RR4A 5B79A 1WE9A 4FO9A 3SOXA 3GV4A 3M62A 3MHHA 1X4JA 2YSMA 1LDKC 2EODA 1FBVA 1WIMA 5FB0A 1ZBDB 1G25A 5G04B 4MSXA 3PHDA 2KWKA 3KDEC 3V43A 4A4BA 2LRIC 2I50A 4WZ2A 2CT2A 2JMIA 3QZVA 4Q6FA 5AITA 2KYUA 1Z2QA 1DCQA 4WZ0A 2MT5A 2LGKA 5B76A 3ZVYA 3LQHA 4A0CD 3DDTA 2M3HA 4ZUXU 2VP7A 2CSYA 2YQMA 5SVYA 2KGIA 2KREA 2YSJA 2YW8A 3EB6A 5LKXA 4GNGA 3N9NA 4R2YA 3PLWA 4I7BA 4N4FA 2FSAA 1VFYA 3O47A 1FP0A 4LLBA 2C2VS 5TDRA 3U5MA 3KQIA 2LAUA 5D1LB 4OGCA 4A4CA 4O64A 4XI1A 5LKUA 2ECIA 2LN0A 2E6RA 2H0DB 2ZETC 1WEOA 3N9OA 2CRRA 1VD4A 2HDPA 2NAAA 4A49A 3FJUB 4OGEA 3Q1DA 2L80A 3LQJA 4YADA 3DQVR 2DJAA 2H0DA 2G6QA 2YQLA 3LRQA 5H1UA 2LDRA 2ECNA 3L11A 4FJCA 4UI9B 5LKZA 4C9ZA 4AYCB 5G05B 1CHCA 3N9PA 5H9MA 3M7KA 2XP0A 3PURA 4IC3A 2CRWA 1N87A 2QJ0A 1WENA 4AYCA 1Z60A 2K16A 2JMJA 2D8SA 2MUMA 4UP5A 4QF3A 1WEWA 4X3GA 2YHNA 2YHOA 2OWAA 3RPGB 2VPGA 3HCSA 3NG2A 2EXUA 3FM8C 1IYMA 2JUNA 4GNFA 3N9MA 3IHPA 3RTRB 2VPBA 3LQIA 3MHSA 4YBTA 3HCTA 5KH3A 2YVRA 5SVIA 5B8DA 3O36A 5JG6A 4QQ4A 4WZ3B 4MVTA 2RSDA 2XOCA 4F52B 1DVPA 3C6WA 3T7LA 4Z0OA 2G45A 3U5OA 4R7EA 2K17A 2EA6A 2Y43A 2Y1MA 2CONA 2KWNA 4PTBA 2KIZA 2F42A 2M85A 2KGGA 1X4IA 3ASLA 2P57A 1MM3A 4LADB 3O33A 2K4DA 5DKAA 3LVQE 2L43A 3L1ZB 3O7AA 4YABA 3O37A 2UZGA 2ECTA 4R8PK 3RPGC 2VPDA 3U5PA 2M6MA 3I2DA 5EYAF 2ECGA 2G43A 5LCWB 2YT5A 2MNZA 4IC2A 1VYXA 4ZQLA 2LXHC 2EGMA 1LDJB 4LK9A 4W4UA 5TDWA 1WEPA 4PPEA 3N9QA 3T9KA 4CCGX 5KH9A 2VJFB 2PUYA 2VNFA 5D1MB 2FFWA 4FK5A 5TBNA 2ECVA 1E4UA 4L58A 2FD4A 3EB5A 3ZPVE 4Z0RA 3ZVZB 2VJFA 3O70A 1HYIA 5KH7A 2C2LA 3T6RA 2VJEA 4O62A 5B78A 5G0FA 2YURA 3SOWA 2FUIA 1WEEA 1WGMA 2JMDA 2XEUA 5LKTA 4AVXA 4P5OB 2IQJA 1MM2A 4LJNA 2YU4A 5AIUA 5H1TA 4YC9A 5H1VA 5SVIB 4N3WA 2B0OE 5J3XA 3HTKC 2CSZA 5SVXA 2VPEA 5FB1A 2XOYA 2DSMA 2L75A 2OXQC 3SHBA 3H7HA 3N9LA 2JRJA 4WA6A 3E2DA 2AN6A 3LJUX 2LGLA 4FIPA 2KKYA 3SUBA 2IDAA 1WEVA 4NN2A 2EGPA 4S3OB 1WILA 2MD8C 2KWJA 2YREA 1MBMA 1T1HA 2E61A 4UP0A 1Z6UA 2KKXA 1X4UA 2MA6A 2KFTA 4AP4A 2XOZA 3GL6A 3O35A 4YATA 4BBQA 3FEHA 2LQ6A 3FL2A 4CA1A 2HYED 1WEMA 5TABA 3VK6A 5B77A 1HYJA 3U5NA 2CKLB 2MKEA 4GNEA 4GNDA 2QIZA 2LV9A 2F6JA 4I7CA 3LVRE 1RMDA 4YBSA 2MIQA 1K2FA 2MD7B 5K3QA 2CKLA 1F62A 2KR4A 5D1KB 3C5KA 2ECWA 2L0BA 1JM7B 4F1PA 2L7PA 4QF2A 4BHWA 1WEUA 5B75A 2ECJA 1WEQA 3FAOA 2L5UA 3ZYQA 2MA5A
chains in the Genus database with same CATH topology
2F6NA 2KE1A 2QICA 1JM7A 2RI7A 2BAYA 2K1JA 1JOCA 3DPLR 1V87A 2FUUA 2DX8A 4S3OC 2KU3A 2VJEB 1BORA 4TKPB 3ZNIA 2XB1A 4I7DA 2M1RA 4ZDTA 2E6SA 3M99A 4GB0A 4V3LC 5C13A 3ZPV1 5TRBA 2LXPC 3ZTGA 3KV5A 4AUQB 1U6GB 4B86C 1XWHA 3KNVA 2LGVA 2Y1NA 2LGGA 4YBMA 5C11A 2MNYA 2PNXA 4L7XA 4V3KC 5FERA 3SOUA 4LKAA 5DINA 3M63A 4B7YC 2YUCA 3HCUA 2YYRA 5FEYA 1WESA 3L1XA 3O34A 3PUQA 5I3LA 4YAXA 1WFKA 2KWOA 3KV6A 5B79A 1WE9A 4FO9A 3SOXA 3GV4A 3M62A 3MHHA 1X4JA 2YSMA 1LDKC 2EODA 1FBVA 1WIMA 5FB0A 1ZBDB 1G25A 5G04B 4MSXA 3PHDA 2KWKA 3V43A 4A4BA 2LRIC 2I50A 4WZ2A 2CT2A 2JMIA 3QZVA 4Q6FA 5AITA 2KYUA 1Z2QA 4WZ0A 2MT5A 2LGKA 5B76A 3ZVYA 3LQHA 4A0CD 2M3HA 4ZUXU 2VP7A 2CSYA 2YQMA 2KGIA 2KREA 2YSJA 2YW8A 3EB6A 5LKXA 4GNGA 3N9NA 4R2YA 4I7BA 4N4FA 2FSAA 1VFYA 1FP0A 4LLBA 2C2VS 5TDRA 3U5MA 3KQIA 5D1LB 4A4CA 4O64A 4XI1A 5LKUA 2ECIA 2LN0A 2E6RA 2H0DB 2ZETC 1WEOA 3N9OA 1VD4A 2HDPA 2NAAA 4A49A 4YADA 2L80A 3LQJA 3DQVR 2H0DA 2G6QA 2YQLA 3LRQA 5H1UA 2LDRA 2ECNA 3L11A 4FJCA 4UI9B 5LKZA 4C9ZA 4AYCB 5G05B 1CHCA 3N9PA 5H9MA 3PURA 4IC3A 1N87A 2QJ0A 1WENA 4AYCA 1Z60A 2K16A 2JMJA 2D8SA 2MUMA 4UP5A 4QF3A 1WEWA 4X3GA 2YHNA 2YHOA 3RPGB 2VPGA 3HCSA 3NG2A 1IYMA 4GNFA 3N9MA 3IHPA 3RTRB 2VPBA 3LQIA 3MHSA 4YBTA 3HCTA 5KH3A 5B8DA 3O36A 5JG6A 4WZ3B 4MVTA 2RSDA 4F52B 1DVPA 3C6WA 3T7LA 2G45A 3U5OA 4R7EA 2K17A 2EA6A 2Y43A 2Y1MA 2KWNA 4PTBA 2KIZA 2F42A 2M85A 2KGGA 1X4IA 3ASLA 1MM3A 4LADB 3O33A 2K4DA 5DKAA 2L43A 3L1ZB 3O7AA 4YABA 3O37A 2UZGA 2ECTA 4R8PK 3RPGC 2VPDA 3U5PA 2M6MA 3I2DA 5EYAF 2ECGA 2G43A 5LCWB 2YT5A 2MNZA 4IC2A 1VYXA 4ZQLA 2LXHC 1LDJB 4LK9A 4W4UA 5TDWA 1WEPA 4PPEA 3N9QA 4CCGX 5KH9A 2VJFB 2PUYA 2VNFA 5D1MB 4FK5A 5TBNA 2ECVA 1E4UA 4L58A 3EB5A 3ZPVE 3ZVZB 2VJFA 3O70A 1HYIA 5KH7A 2C2LA 3T6RA 2VJEA 5B78A 5G0FA 2YURA 3SOWA 2FUIA 1WEEA 1WGMA 2JMDA 2XEUA 5LKTA 4AVXA 4P5OB 1MM2A 4LJNA 2YU4A 5AIUA 5H1TA 4YC9A 5H1VA 4N3WA 5J3XA 3HTKC 2CSZA 2VPEA 5FB1A 2L75A 2OXQC 3SHBA 3N9LA 2JRJA 4WA6A 2AN6A 2LGLA 4FIPA 2IDAA 1WEVA 4NN2A 2EGPA 4S3OB 1WILA 2MD8C 2KWJA 2YREA 1T1HA 4UP0A 1Z6UA 1X4UA 2MA6A 2KFTA 4AP4A 3GL6A 3O35A 4YATA 4BBQA 2LQ6A 3FL2A 4CA1A 2HYED 1WEMA 5TABA 3VK6A 5B77A 1HYJA 3U5NA 2CKLB 4GNEA 4GNDA 2QIZA 2LV9A 2F6JA 4I7CA 1RMDA 4YBSA 2MIQA 1K2FA 2MD7B 2CKLA 1F62A 2KR4A 5D1KB 3C5KA 2ECWA 2L0BA 1JM7B 4QF2A 4BHWA 1WEUA 5B75A 2ECJA 1WEQA 2L5UA 3ZYQA 2MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6N A;  2KE1 A;  2QIC A;  1JM7 A;  2RI7 A;  2BAY A;  2K1J A;  1JOC A;  3DPL R;  1V87 A;  2FUU A;  2DX8 A;  4S3O C;  2KU3 A;  2VJE B;  1BOR A;  4TKP B;  3ZNI A;  2XB1 A;  4I7D A;  2M1R A;  4ZDT A;  2E6S A;  3M99 A;  4GB0 A;  4V3L C;  5C13 A;  3ZPV 1;  5TRB A;  2LXP C;  3ZTG A;  3KV5 A;  4AUQ B;  1U6G B;  4B86 C;  1XWH A;  3KNV A;  2LGV A;  2Y1N A;  2LGG A;  4YBM A;  5C11 A;  2MNY A;  2PNX A;  4L7X A;  4V3K C;  5FER A;  3SOU A;  4LKA A;  5DIN A;  3M63 A;  4B7Y C;  2YUC A;  3HCU A;  2YYR A;  5FEY A;  1WES A;  3L1X A;  3O34 A;  3PUQ A;  5I3L A;  4YAX A;  1WFK A;  2KWO A;  3KV6 A;  5B79 A;  1WE9 A;  4FO9 A;  3SOX A;  3GV4 A;  3M62 A;  3MHH A;  1X4J A;  2YSM A;  1LDK C;  2EOD A;  1FBV A;  1WIM A;  5FB0 A;  1ZBD B;  1G25 A;  5G04 B;  4MSX A;  3PHD A;  2KWK A;  3V43 A;  4A4B A;  2LRI C;  2I50 A;  4WZ2 A;  2CT2 A;  2JMI A;  3QZV A;  4Q6F A;  5AIT A;  2KYU A;  1Z2Q A;  4WZ0 A;  2MT5 A;  2LGK A;  5B76 A;  3ZVY A;  3LQH A;  4A0C D;  2M3H A;  4ZUX U;  2VP7 A;  2CSY A;  2YQM A;  2KGI A;  2KRE A;  2YSJ A;  2YW8 A;  3EB6 A;  5LKX A;  4GNG A;  3N9N A;  4R2Y A;  4I7B A;  4N4F A;  2FSA A;  1VFY A;  1FP0 A;  4LLB A;  2C2V S;  5TDR A;  3U5M A;  3KQI A;  5D1L B;  4A4C A;  4O64 A;  4XI1 A;  5LKU A;  2ECI A;  2LN0 A;  2E6R A;  2H0D B;  2ZET C;  1WEO A;  3N9O A;  1VD4 A;  2HDP A;  2NAA A;  4A49 A;  4YAD A;  2L80 A;  3LQJ A;  3DQV R;  2H0D A;  2G6Q A;  2YQL A;  3LRQ A;  5H1U A;  2LDR A;  2ECN A;  3L11 A;  4FJC A;  4UI9 B;  5LKZ A;  4C9Z A;  4AYC B;  5G05 B;  1CHC A;  3N9P A;  5H9M A;  3PUR A;  4IC3 A;  1N87 A;  2QJ0 A;  1WEN A;  4AYC A;  1Z60 A;  2K16 A;  2JMJ A;  2D8S A;  2MUM A;  4UP5 A;  4QF3 A;  1WEW A;  4X3G A;  2YHN A;  2YHO A;  3RPG B;  2VPG A;  3HCS A;  3NG2 A;  1IYM A;  4GNF A;  3N9M A;  3IHP A;  3RTR B;  2VPB A;  3LQI A;  3MHS A;  4YBT A;  3HCT A;  5KH3 A;  5B8D A;  3O36 A;  5JG6 A;  4WZ3 B;  4MVT A;  2RSD A;  4F52 B;  1DVP A;  3C6W A;  3T7L A;  2G45 A;  3U5O A;  4R7E A;  2K17 A;  2EA6 A;  2Y43 A;  2Y1M A;  2KWN A;  4PTB A;  2KIZ A;  2F42 A;  2M85 A;  2KGG A;  1X4I A;  3ASL A;  1MM3 A;  4LAD B;  3O33 A;  2K4D A;  5DKA A;  2L43 A;  3L1Z B;  3O7A A;  4YAB A;  3O37 A;  2UZG A;  2ECT A;  4R8P K;  3RPG C;  2VPD A;  3U5P A;  2M6M A;  3I2D A;  5EYA F;  2ECG A;  2G43 A;  5LCW B;  2YT5 A;  2MNZ A;  4IC2 A;  1VYX A;  4ZQL A;  2LXH C;  1LDJ B;  4LK9 A;  4W4U A;  5TDW A;  1WEP A;  4PPE A;  3N9Q A;  4CCG X;  5KH9 A;  2VJF B;  2PUY A;  2VNF A;  5D1M B;  4FK5 A;  5TBN A;  2ECV A;  1E4U A;  4L58 A;  3EB5 A;  3ZPV E;  3ZVZ B;  2VJF A;  3O70 A;  1HYI A;  5KH7 A;  2C2L A;  3T6R A;  2VJE A;  5B78 A;  5G0F A;  2YUR A;  3SOW A;  2FUI A;  1WEE A;  1WGM A;  2JMD A;  2XEU A;  5LKT A;  4AVX A;  4P5O B;  1MM2 A;  4LJN A;  2YU4 A;  5AIU A;  5H1T A;  4YC9 A;  5H1V A;  4N3W A;  5J3X A;  3HTK C;  2CSZ A;  2VPE A;  5FB1 A;  2L75 A;  2OXQ C;  3SHB A;  3N9L A;  2JRJ A;  4WA6 A;  2AN6 A;  2LGL A;  4FIP A;  2IDA A;  1WEV A;  4NN2 A;  2EGP A;  4S3O B;  1WIL A;  2MD8 C;  2KWJ A;  2YRE A;  1T1H A;  4UP0 A;  1Z6U A;  1X4U A;  2MA6 A;  2KFT A;  4AP4 A;  3GL6 A;  3O35 A;  4YAT A;  4BBQ A;  2LQ6 A;  3FL2 A;  4CA1 A;  2HYE D;  1WEM A;  5TAB A;  3VK6 A;  5B77 A;  1HYJ A;  3U5N A;  2CKL B;  4GNE A;  4GND A;  2QIZ A;  2LV9 A;  2F6J A;  4I7C A;  1RMD A;  4YBS A;  2MIQ A;  1K2F A;  2MD7 B;  2CKL A;  1F62 A;  2KR4 A;  5D1K B;  3C5K A;  2ECW A;  2L0B A;  1JM7 B;  4QF2 A;  4BHW A;  1WEU A;  5B75 A;  2ECJ A;  1WEQ A;  2L5U A;  3ZYQ A;  2MA5 A; 
#chains in the Genus database with same CATH topology
 2F6N A;  2KE1 A;  2QIC A;  1JM7 A;  3MDB C;  2RI7 A;  2BAY A;  2K1J A;  1JOC A;  3DPL R;  3DWD A;  1V87 A;  2FUU A;  2JM3 A;  2DX8 A;  4S3O C;  2KU3 A;  2VJE B;  1BOR A;  4TKP B;  3ZNI A;  2XB1 A;  3FAN A;  4I7D A;  2M1R A;  4ZDT A;  2E6S A;  3M99 A;  4GB0 A;  4V3L C;  5C13 A;  3ZPV 1;  5TRB A;  2LXP C;  3ZTG A;  3KV5 A;  4AUQ B;  1U6G B;  3JUE A;  4B86 C;  1XWH A;  3KNV A;  2LGV A;  2Y1N A;  2LGG A;  2M13 A;  4YBM A;  2D8U A;  5C11 A;  2MNY A;  2PNX A;  4L7X A;  4V3K C;  5FER A;  3SOU A;  4LKA A;  2CSV A;  4H9D A;  5DIN A;  3M63 A;  4B7Y C;  2YUC A;  3HCU A;  2YYR A;  5FEY A;  1WES A;  3LDY A;  3L1X A;  3O34 A;  3PUQ A;  5I3L A;  4YAX A;  1WFK A;  2KWO A;  3KV6 A;  2RR4 A;  5B79 A;  1WE9 A;  4FO9 A;  3SOX A;  3GV4 A;  3M62 A;  3MHH A;  1X4J A;  2YSM A;  1LDK C;  2EOD A;  1FBV A;  1WIM A;  5FB0 A;  1ZBD B;  1G25 A;  5G04 B;  4MSX A;  3PHD A;  2KWK A;  3KDE C;  3V43 A;  4A4B A;  2LRI C;  2I50 A;  4WZ2 A;  2CT2 A;  2JMI A;  3QZV A;  4Q6F A;  5AIT A;  2KYU A;  1Z2Q A;  1DCQ A;  4WZ0 A;  2MT5 A;  2LGK A;  5B76 A;  3ZVY A;  3LQH A;  4A0C D;  3DDT A;  2M3H A;  4ZUX U;  2VP7 A;  2CSY A;  2YQM A;  5SVY A;  2KGI A;  2KRE A;  2YSJ A;  2YW8 A;  3EB6 A;  5LKX A;  4GNG A;  3N9N A;  4R2Y A;  3PLW A;  4I7B A;  4N4F A;  2FSA A;  1VFY A;  3O47 A;  1FP0 A;  4LLB A;  2C2V S;  5TDR A;  3U5M A;  3KQI A;  2LAU A;  5D1L B;  4OGC A;  4A4C A;  4O64 A;  4XI1 A;  5LKU A;  2ECI A;  2LN0 A;  2E6R A;  2H0D B;  2ZET C;  1WEO A;  3N9O A;  2CRR A;  1VD4 A;  2HDP A;  2NAA A;  4A49 A;  3FJU B;  4OGE A;  3Q1D A;  2L80 A;  3LQJ A;  4YAD A;  3DQV R;  2DJA A;  2H0D A;  2G6Q A;  2YQL A;  3LRQ A;  5H1U A;  2LDR A;  2ECN A;  3L11 A;  4FJC A;  4UI9 B;  5LKZ A;  4C9Z A;  4AYC B;  5G05 B;  1CHC A;  3N9P A;  5H9M A;  3M7K A;  2XP0 A;  3PUR A;  4IC3 A;  2CRW A;  1N87 A;  2QJ0 A;  1WEN A;  4AYC A;  1Z60 A;  2K16 A;  2JMJ A;  2D8S A;  2MUM A;  4UP5 A;  4QF3 A;  1WEW A;  4X3G A;  2YHN A;  2YHO A;  2OWA A;  3RPG B;  2VPG A;  3HCS A;  3NG2 A;  2EXU A;  3FM8 C;  1IYM A;  2JUN A;  4GNF A;  3N9M A;  3IHP A;  3RTR B;  2VPB A;  3LQI A;  3MHS A;  4YBT A;  3HCT A;  5KH3 A;  2YVR A;  5SVI A;  5B8D A;  3O36 A;  5JG6 A;  4QQ4 A;  4WZ3 B;  4MVT A;  2RSD A;  2XOC A;  4F52 B;  1DVP A;  3C6W A;  3T7L A;  4Z0O A;  2G45 A;  3U5O A;  4R7E A;  2K17 A;  2EA6 A;  2Y43 A;  2Y1M A;  2CON A;  2KWN A;  4PTB A;  2KIZ A;  2F42 A;  2M85 A;  2KGG A;  1X4I A;  3ASL A;  2P57 A;  1MM3 A;  4LAD B;  3O33 A;  2K4D A;  5DKA A;  3LVQ E;  2L43 A;  3L1Z B;  3O7A A;  4YAB A;  3O37 A;  2UZG A;  2ECT A;  4R8P K;  3RPG C;  2VPD A;  3U5P A;  2M6M A;  3I2D A;  5EYA F;  2ECG A;  2G43 A;  5LCW B;  2YT5 A;  2MNZ A;  4IC2 A;  1VYX A;  4ZQL A;  2LXH C;  2EGM A;  1LDJ B;  4LK9 A;  4W4U A;  5TDW A;  1WEP A;  4PPE A;  3N9Q A;  3T9K A;  4CCG X;  5KH9 A;  2VJF B;  2PUY A;  2VNF A;  5D1M B;  2FFW A;  4FK5 A;  5TBN A;  2ECV A;  1E4U A;  4L58 A;  2FD4 A;  3EB5 A;  3ZPV E;  4Z0R A;  3ZVZ B;  2VJF A;  3O70 A;  1HYI A;  5KH7 A;  2C2L A;  3T6R A;  2VJE A;  4O62 A;  5B78 A;  5G0F A;  2YUR A;  3SOW A;  2FUI A;  1WEE A;  1WGM A;  2JMD A;  2XEU A;  5LKT A;  4AVX A;  4P5O B;  2IQJ A;  1MM2 A;  4LJN A;  2YU4 A;  5AIU A;  5H1T A;  4YC9 A;  5H1V A;  5SVI B;  4N3W A;  2B0O E;  5J3X A;  3HTK C;  2CSZ A;  5SVX A;  2VPE A;  5FB1 A;  2XOY A;  2DSM A;  2L75 A;  2OXQ C;  3SHB A;  3H7H A;  3N9L A;  2JRJ A;  4WA6 A;  3E2D A;  2AN6 A;  3LJU X;  2LGL A;  4FIP A;  2KKY A;  3SUB A;  2IDA A;  1WEV A;  4NN2 A;  2EGP A;  4S3O B;  1WIL A;  2MD8 C;  2KWJ A;  2YRE A;  1MBM A;  1T1H A;  2E61 A;  4UP0 A;  1Z6U A;  2KKX A;  1X4U A;  2MA6 A;  2KFT A;  4AP4 A;  2XOZ A;  3GL6 A;  3O35 A;  4YAT A;  4BBQ A;  3FEH A;  2LQ6 A;  3FL2 A;  4CA1 A;  2HYE D;  1WEM A;  5TAB A;  3VK6 A;  5B77 A;  1HYJ A;  3U5N A;  2CKL B;  2MKE A;  4GNE A;  4GND A;  2QIZ A;  2LV9 A;  2F6J A;  4I7C A;  3LVR E;  1RMD A;  4YBS A;  2MIQ A;  1K2F A;  2MD7 B;  5K3Q A;  2CKL A;  1F62 A;  2KR4 A;  5D1K B;  3C5K A;  2ECW A;  2L0B A;  1JM7 B;  4F1P A;  2L7P A;  4QF2 A;  4BHW A;  1WEU A;  5B75 A;  2ECJ A;  1WEQ A;  3FAO A;  2L5U A;  3ZYQ A;  2MA5 A; 
#chains in the Genus database with same CATH homology
 2F6N A;  2KE1 A;  2QIC A;  1JM7 A;  2RI7 A;  2BAY A;  2K1J A;  1JOC A;  3DPL R;  1V87 A;  2FUU A;  2DX8 A;  4S3O C;  2KU3 A;  2VJE B;  1BOR A;  4TKP B;  3ZNI A;  2XB1 A;  4I7D A;  2M1R A;  4ZDT A;  2E6S A;  3M99 A;  4GB0 A;  4V3L C;  5C13 A;  3ZPV 1;  5TRB A;  2LXP C;  3ZTG A;  3KV5 A;  4AUQ B;  1U6G B;  4B86 C;  1XWH A;  3KNV A;  2LGV A;  2Y1N A;  2LGG A;  4YBM A;  5C11 A;  2MNY A;  2PNX A;  4L7X A;  4V3K C;  5FER A;  3SOU A;  4LKA A;  5DIN A;  3M63 A;  4B7Y C;  2YUC A;  3HCU A;  2YYR A;  5FEY A;  1WES A;  3L1X A;  3O34 A;  3PUQ A;  5I3L A;  4YAX A;  1WFK A;  2KWO A;  3KV6 A;  5B79 A;  1WE9 A;  4FO9 A;  3SOX A;  3GV4 A;  3M62 A;  3MHH A;  1X4J A;  2YSM A;  1LDK C;  2EOD A;  1FBV A;  1WIM A;  5FB0 A;  1ZBD B;  1G25 A;  5G04 B;  4MSX A;  3PHD A;  2KWK A;  3V43 A;  4A4B A;  2LRI C;  2I50 A;  4WZ2 A;  2CT2 A;  2JMI A;  3QZV A;  4Q6F A;  5AIT A;  2KYU A;  1Z2Q A;  4WZ0 A;  2MT5 A;  2LGK A;  5B76 A;  3ZVY A;  3LQH A;  4A0C D;  2M3H A;  4ZUX U;  2VP7 A;  2CSY A;  2YQM A;  2KGI A;  2KRE A;  2YSJ A;  2YW8 A;  3EB6 A;  5LKX A;  4GNG A;  3N9N A;  4R2Y A;  4I7B A;  4N4F A;  2FSA A;  1VFY A;  1FP0 A;  4LLB A;  2C2V S;  5TDR A;  3U5M A;  3KQI A;  5D1L B;  4A4C A;  4O64 A;  4XI1 A;  5LKU A;  2ECI A;  2LN0 A;  2E6R A;  2H0D B;  2ZET C;  1WEO A;  3N9O A;  1VD4 A;  2HDP A;  2NAA A;  4A49 A;  4YAD A;  2L80 A;  3LQJ A;  3DQV R;  2H0D A;  2G6Q A;  2YQL A;  3LRQ A;  5H1U A;  2LDR A;  2ECN A;  3L11 A;  4FJC A;  4UI9 B;  5LKZ A;  4C9Z A;  4AYC B;  5G05 B;  1CHC A;  3N9P A;  5H9M A;  3PUR A;  4IC3 A;  1N87 A;  2QJ0 A;  1WEN A;  4AYC A;  1Z60 A;  2K16 A;  2JMJ A;  2D8S A;  2MUM A;  4UP5 A;  4QF3 A;  1WEW A;  4X3G A;  2YHN A;  2YHO A;  3RPG B;  2VPG A;  3HCS A;  3NG2 A;  1IYM A;  4GNF A;  3N9M A;  3IHP A;  3RTR B;  2VPB A;  3LQI A;  3MHS A;  4YBT A;  3HCT A;  5KH3 A;  5B8D A;  3O36 A;  5JG6 A;  4WZ3 B;  4MVT A;  2RSD A;  4F52 B;  1DVP A;  3C6W A;  3T7L A;  2G45 A;  3U5O A;  4R7E A;  2K17 A;  2EA6 A;  2Y43 A;  2Y1M A;  2KWN A;  4PTB A;  2KIZ A;  2F42 A;  2M85 A;  2KGG A;  1X4I A;  3ASL A;  1MM3 A;  4LAD B;  3O33 A;  2K4D A;  5DKA A;  2L43 A;  3L1Z B;  3O7A A;  4YAB A;  3O37 A;  2UZG A;  2ECT A;  4R8P K;  3RPG C;  2VPD A;  3U5P A;  2M6M A;  3I2D A;  5EYA F;  2ECG A;  2G43 A;  5LCW B;  2YT5 A;  2MNZ A;  4IC2 A;  1VYX A;  4ZQL A;  2LXH C;  1LDJ B;  4LK9 A;  4W4U A;  5TDW A;  1WEP A;  4PPE A;  3N9Q A;  4CCG X;  5KH9 A;  2VJF B;  2PUY A;  2VNF A;  5D1M B;  4FK5 A;  5TBN A;  2ECV A;  1E4U A;  4L58 A;  3EB5 A;  3ZPV E;  3ZVZ B;  2VJF A;  3O70 A;  1HYI A;  5KH7 A;  2C2L A;  3T6R A;  2VJE A;  5B78 A;  5G0F A;  2YUR A;  3SOW A;  2FUI A;  1WEE A;  1WGM A;  2JMD A;  2XEU A;  5LKT A;  4AVX A;  4P5O B;  1MM2 A;  4LJN A;  2YU4 A;  5AIU A;  5H1T A;  4YC9 A;  5H1V A;  4N3W A;  5J3X A;  3HTK C;  2CSZ A;  2VPE A;  5FB1 A;  2L75 A;  2OXQ C;  3SHB A;  3N9L A;  2JRJ A;  4WA6 A;  2AN6 A;  2LGL A;  4FIP A;  2IDA A;  1WEV A;  4NN2 A;  2EGP A;  4S3O B;  1WIL A;  2MD8 C;  2KWJ A;  2YRE A;  1T1H A;  4UP0 A;  1Z6U A;  1X4U A;  2MA6 A;  2KFT A;  4AP4 A;  3GL6 A;  3O35 A;  4YAT A;  4BBQ A;  2LQ6 A;  3FL2 A;  4CA1 A;  2HYE D;  1WEM A;  5TAB A;  3VK6 A;  5B77 A;  1HYJ A;  3U5N A;  2CKL B;  4GNE A;  4GND A;  2QIZ A;  2LV9 A;  2F6J A;  4I7C A;  1RMD A;  4YBS A;  2MIQ A;  1K2F A;  2MD7 B;  2CKL A;  1F62 A;  2KR4 A;  5D1K B;  3C5K A;  2ECW A;  2L0B A;  1JM7 B;  4QF2 A;  4BHW A;  1WEU A;  5B75 A;  2ECJ A;  1WEQ A;  2L5U A;  3ZYQ A;  2MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...