1VFYA

Phosphatidylinositol-3-phosphate binding fyve domain of vps27p protein from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
b'DWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFEDYEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-3-PHOSPHATE BINDING FYVE DOMAIN OF PROT
molecule tags Transport protein
source organism Saccharomyces cerevisiae
publication title Crystal structure of a phosphatidylinositol 3-phosphate-specific membrane-targeting motif, the FYVE domain of Vps27p.
pubmed doi rcsb
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vfyA00
4A4CA 2MUMA 3LRQA 2NAAA 2JRJA 2YUCA 3U5OA 1MM2A 2RSDA 2CKLB 2L0BA 2YURA 1WENA 1U6GB 2YT5A 4GNGA 3FL2A 5TBNA 3U5PA 3IHPA 3PUQA 2F42A 3SHBA 3SOXA 3M63A 4I7BA 4A4BA 2XB1A 4MSXA 1ZBDB 3L11A 3C5KA 2PNXA 2L80A 1WEVA 2K16A 2RI7A 2F6NA 4CA1A 1BORA 4LADB 4LK9A 5H9MA 2UZGA 1WEMA 5KH9A 2Y1NA 4R2YA 2MA5A 2KWOA 1WILA 1WEOA 4P5OB 2D8SA 5LKXA 2VPDA 2YREA 2LGVA 1JOCA 2FUUA 4FK5A 4L58A 3EB6A 5TRBA 4TKPB 3ZPVE 3SOUA 5D1LB 5B79A 4S3OB 1VD4A 2K1JA 4UP0A 3SOWA 2YQLA 4WA6A 3GV4A 4B86C 1V87A 3ASLA 4QF3A 3LQIA 2LDRA 2QICA 2LGLA 2YQMA 2KFTA 4I7DA 4GB0A 2G6QA 2KU3A 2JMIA 4V3KC 5J3XA 5LCWB 5H1VA 4YBTA 5H1UA 4YAXA 5B76A 3N9OA 4L7XA 2LXPC 3N9PA 5FEYA 3PURA 2MNYA 2XEUA 2CT2A 3T7LA 3O7AA 5C11A 3O33A 1FP0A 4YABA 4X3GA 2QJ0A 4PPEA 5DKAA 3ZVZB 3PHDA 4WZ3B 4FIPA 4C9ZA 3O36A 4LJNA 2LXHC 4GNFA 2E6RA 2FUIA 1WEUA 3V43A 5C13A 2KIZA 3MHHA 2MD8C 2MNZA 3O34A 1HYIA 2ECVA 2ECGA 2G43A 4WZ0A 2Y43A 3LQHA 2LN0A 2AN6A 1XWHA 3ZTGA 1X4JA 2L5UA 1FBVA 2YHOA 5LKZA 5G04B 1N87A 2LGGA 3KNVA 3U5MA 4AVXA 2LRIC 4LLBA 5I3LA 2FSAA 2C2LA 2YSJA 1WE9A 2CSYA 4LKAA 5AIUA 2C2VS 5KH3A 1Z2QA 1IYMA 4R8PK 3KV6A 2L75A 4IC3A 3N9QA 2HDPA 2ZETC 4MVTA 3T6RA 2M6MA 5LKTA 4F52B 4BBQA 1WFKA 2YU4A 2M3HA 5FB0A 2VP7A 4I7CA 2M1RA 3RTRB 2VPBA 4YC9A 1HYJA 2LQ6A 5B78A 4UI9B 4PTBA 2EODA 1WIMA 2PUYA 3KV5A 1Z6UA 5B75A 4S3OC 2VNFA 4NN2A 4A0CD 4R7EA 4QF2A 2YYRA 2VJEA 5H1TA 3M99A 4W4UA 2F6JA 5AITA 1LDJB 1MM3A 1RMDA 4GNDA 4YATA 3QZVA 3LQJA 4V3LC 2BAYA 2KE1A 4N3WA 5LKUA 2MD7B 4ZQLA 3RPGB 2VJFA 2L43A 4GNEA 5EYAF 1WEEA 2VJEB 3GL6A 2K4DA 2E6SA 5FB1A 4YBSA 2KYUA 3L1XA 2CSZA 3ZYQA 5D1KB 3N9MA 1WEPA 2KWNA 2ECWA 4AP4A 3U5NA 3ZVYA 2JMDA 3ZPV1 2IDAA 3O35A 2H0DA 3HCSA 5JG6A 2KGGA 3O70A 5TDRA 1X4UA 2MT5A 1K2FA 1DVPA 5G0FA 2YHNA 3DPLR 5KH7A 5TDWA 4AYCB 3KQIA 2KREA 3ZNIA 3EB5A 5D1MB 4YBMA 2I50A 2H0DB 2OXQC 2VJFB 3M62A 3I2DA 3O37A 2KGIA 3MHSA 3N9LA 4BHWA 2DX8A 2ECJA 4AYCA 2YW8A 4IC2A 1CHCA 3C6WA 2LV9A 2JMJA 2YSMA 1WESA 1F62A 2VPEA 2EA6A 2MIQA 3NG2A 1G25A 3L1ZB 2Y1MA 2HYED 2VPGA 4CCGX 4WZ2A 1VFYA 1T1HA 1WEQA 4B7YC 3HCTA 2ECNA 5DINA 4Q6FA 2EGPA 1JM7A 3DQVR 1WGMA 1WEWA 5B77A 2ECIA 5TABA 4O64A 4ZDTA 4UP5A 4YADA 2K17A 1E4UA 2M85A 5FERA 4XI1A 4FO9A 3N9NA 4FJCA 2KWKA 1Z60A 2CKLA 3HCUA 4AUQB 2QIZA 4A49A 3HTKC 4N4FA 2LGKA 1X4IA 2KWJA 5B8DA 4ZUXU 2G45A 2MA6A 5G05B 2ECTA 1VYXA 2KR4A 1JM7B 1LDKC 3VK6A 3RPGC
chains in the Genus database with same CATH superfamily
3FEHA 4A4CA 2MUMA 3LRQA 2M13A 2NAAA 5SVYA 2JRJA 2RR4A 2YUCA 2P57A 3U5OA 1MM2A 3T9KA 2RSDA 2YVRA 2CKLB 2OWAA 2L0BA 2YURA 1WENA 2EGMA 1U6GB 2YT5A 4GNGA 3FL2A 5TBNA 3U5PA 3IHPA 2E61A 3PUQA 4Z0OA 2F42A 3SHBA 3SOXA 3M63A 4I7BA 4A4BA 2XB1A 4MSXA 1ZBDB 3L11A 3C5KA 2PNXA 2L80A 1WEVA 2K16A 2RI7A 2F6NA 4H9DA 4CA1A 1BORA 2EXUA 4LADB 4LK9A 5H9MA 2UZGA 1WEMA 5KH9A 2Y1NA 4R2YA 3FANA 2MA5A 2KWOA 1WILA 1WEOA 4P5OB 2CRRA 2XOCA 2D8SA 5LKXA 2VPDA 2YREA 2LGVA 1JOCA 2FUUA 4FK5A 4L58A 3EB6A 5TRBA 4TKPB 3ZPVE 2L7PA 3SOUA 5D1LB 5B79A 4S3OB 1VD4A 2K1JA 4UP0A 3SOWA 3DDTA 2YQLA 4WA6A 3GV4A 4B86C 1V87A 3ASLA 4QF3A 3LQIA 2LDRA 2QICA 2JM3A 2LGLA 2YQMA 2KFTA 4I7DA 4GB0A 2G6QA 2KU3A 3MDBC 2JMIA 4V3KC 5J3XA 5LCWB 5SVIB 5H1VA 4YBTA 2XOYA 5H1UA 4YAXA 5B76A 3N9OA 4L7XA 2LXPC 3N9PA 5FEYA 3PURA 2MNYA 2XEUA 3M7KA 2CT2A 3T7LA 3O7AA 5C11A 3E2DA 3O33A 3PLWA 1FP0A 2FD4A 4YABA 4X3GA 2QJ0A 4PPEA 5DKAA 3ZVZB 3PHDA 4WZ3B 4FIPA 4C9ZA 3O36A 4LJNA 2LXHC 4GNFA 3FAOA 2E6RA 2FUIA 2B0OE 1WEUA 3O47A 3V43A 5C13A 2KIZA 1DCQA 3MHHA 2MD8C 2MNZA 3O34A 1HYIA 2ECVA 2ECGA 2G43A 4WZ0A 5SVIA 2Y43A 3LQHA 2IQJA 2LN0A 2LAUA 2AN6A 1XWHA 3ZTGA 1X4JA 2L5UA 1FBVA 2YHOA 5LKZA 5G04B 1N87A 2LGGA 3KNVA 3U5MA 3SUBA 4QQ4A 2LRIC 4LLBA 4AVXA 5I3LA 2FSAA 2C2LA 2YSJA 1WE9A 2CSYA 4LKAA 5AIUA 2C2VS 5KH3A 1Z2QA 1IYMA 4R8PK 3KV6A 4OGCA 2L75A 4F1PA 4IC3A 3N9QA 2HDPA 2ZETC 5K3QA 4MVTA 3T6RA 2M6MA 5LKTA 4F52B 4BBQA 1WFKA 2YU4A 2M3HA 5FB0A 2VP7A 2XOZA 4I7CA 2M1RA 3KDEC 3LVQE 3RTRB 2VPBA 4YC9A 2FFWA 1HYJA 3H7HA 2LQ6A 2DJAA 5B78A 4UI9B 4PTBA 2EODA 1WIMA 2PUYA 3KV5A 1Z6UA 5B75A 4S3OC 2VNFA 4NN2A 2XP0A 4A0CD 4R7EA 4QF2A 2YYRA 2VJEA 5H1TA 3M99A 4W4UA 2F6JA 5AITA 2CSVA 1LDJB 3LJUX 1MM3A 4OGEA 1RMDA 4GNDA 4YATA 3QZVA 3LQJA 4V3LC 2BAYA 2KE1A 4N3WA 5LKUA 2MD7B 4ZQLA 3RPGB 2VJFA 2L43A 4GNEA 5EYAF 1WEEA 2VJEB 3GL6A 2K4DA 2E6SA 5FB1A 4YBSA 2KYUA 3L1XA 2CSZA 3ZYQA 5D1KB 3FM8C 3N9MA 1WEPA 2KWNA 3LDYA 2ECWA 4AP4A 3U5NA 3ZVYA 2JMDA 3ZPV1 2IDAA 3O35A 2H0DA 3HCSA 5JG6A 2KGGA 3O70A 2DSMA 5TDRA 1X4UA 2MT5A 1K2FA 1DVPA 5G0FA 2YHNA 4O62A 2KKYA 3DPLR 5KH7A 5TDWA 4AYCB 3KQIA 2KREA 3ZNIA 2KKXA 3EB5A 2JUNA 3DWDA 5D1MB 4YBMA 2I50A 2D8UA 2H0DB 2OXQC 2VJFB 3M62A 3I2DA 3O37A 2KGIA 3MHSA 3N9LA 4BHWA 2DX8A 2ECJA 4AYCA 2YW8A 4IC2A 1CHCA 3C6WA 2LV9A 2JMJA 2YSMA 1WESA 1F62A 2VPEA 2EA6A 2MIQA 3NG2A 1G25A 3L1ZB 5SVXA 2Y1MA 2HYED 2VPGA 4CCGX 4WZ2A 1VFYA 2CONA 1T1HA 1WEQA 4B7YC 3HCTA 2ECNA 2CRWA 5DINA 2MKEA 4Q6FA 2EGPA 1JM7A 3DQVR 1WGMA 1WEWA 5B77A 2ECIA 3JUEA 5TABA 4O64A 4ZDTA 4UP5A 4YADA 2K17A 1E4UA 2M85A 5FERA 4XI1A 4FO9A 3N9NA 4FJCA 2KWKA 1Z60A 2CKLA 3HCUA 4AUQB 2QIZA 4A49A 3HTKC 4N4FA 2LGKA 1X4IA 2KWJA 5B8DA 4ZUXU 2G45A 2MA6A 5G05B 2ECTA 3FJUB 1VYXA 2KR4A 3Q1DA 1JM7B 3LVRE 1LDKC 3VK6A 4Z0RA 3RPGC 1MBMA
chains in the Genus database with same CATH topology
4A4CA 2MUMA 3LRQA 2NAAA 2JRJA 2YUCA 3U5OA 1MM2A 2RSDA 2CKLB 2L0BA 2YURA 1WENA 1U6GB 2YT5A 4GNGA 3FL2A 5TBNA 3U5PA 3IHPA 3PUQA 2F42A 3SHBA 3SOXA 3M63A 4I7BA 4A4BA 2XB1A 4MSXA 1ZBDB 3L11A 3C5KA 2PNXA 2L80A 1WEVA 2K16A 2RI7A 2F6NA 4CA1A 1BORA 4LADB 4LK9A 5H9MA 2UZGA 1WEMA 5KH9A 2Y1NA 4R2YA 2MA5A 2KWOA 1WILA 1WEOA 4P5OB 2D8SA 5LKXA 2VPDA 2YREA 2LGVA 1JOCA 2FUUA 4FK5A 4L58A 3EB6A 5TRBA 4TKPB 3ZPVE 3SOUA 5D1LB 5B79A 4S3OB 1VD4A 2K1JA 4UP0A 3SOWA 2YQLA 4WA6A 3GV4A 4B86C 1V87A 3ASLA 4QF3A 3LQIA 2LDRA 2QICA 2LGLA 2YQMA 2KFTA 4I7DA 4GB0A 2G6QA 2KU3A 2JMIA 4V3KC 5J3XA 5LCWB 5H1VA 4YBTA 5H1UA 4YAXA 5B76A 3N9OA 4L7XA 2LXPC 3N9PA 5FEYA 3PURA 2MNYA 2XEUA 2CT2A 3T7LA 3O7AA 5C11A 3O33A 1FP0A 4YABA 4X3GA 2QJ0A 4PPEA 5DKAA 3ZVZB 3PHDA 4WZ3B 4FIPA 4C9ZA 3O36A 4LJNA 2LXHC 4GNFA 2E6RA 2FUIA 1WEUA 3V43A 5C13A 2KIZA 3MHHA 2MD8C 2MNZA 3O34A 1HYIA 2ECVA 2ECGA 2G43A 4WZ0A 2Y43A 3LQHA 2LN0A 2AN6A 1XWHA 3ZTGA 1X4JA 2L5UA 1FBVA 2YHOA 5LKZA 5G04B 1N87A 2LGGA 3KNVA 3U5MA 4AVXA 2LRIC 4LLBA 5I3LA 2FSAA 2C2LA 2YSJA 1WE9A 2CSYA 4LKAA 5AIUA 2C2VS 5KH3A 1Z2QA 1IYMA 4R8PK 3KV6A 2L75A 4IC3A 3N9QA 2HDPA 2ZETC 4MVTA 3T6RA 2M6MA 5LKTA 4F52B 4BBQA 1WFKA 2YU4A 2M3HA 5FB0A 2VP7A 4I7CA 2M1RA 3RTRB 2VPBA 4YC9A 1HYJA 2LQ6A 5B78A 4UI9B 4PTBA 2EODA 1WIMA 2PUYA 3KV5A 1Z6UA 5B75A 4S3OC 2VNFA 4NN2A 4A0CD 4R7EA 4QF2A 2YYRA 2VJEA 5H1TA 3M99A 4W4UA 2F6JA 5AITA 1LDJB 1MM3A 1RMDA 4GNDA 4YATA 3QZVA 3LQJA 4V3LC 2BAYA 2KE1A 4N3WA 5LKUA 2MD7B 4ZQLA 3RPGB 2VJFA 2L43A 4GNEA 5EYAF 1WEEA 2VJEB 3GL6A 2K4DA 2E6SA 5FB1A 4YBSA 2KYUA 3L1XA 2CSZA 3ZYQA 5D1KB 3N9MA 1WEPA 2KWNA 2ECWA 4AP4A 3U5NA 3ZVYA 2JMDA 3ZPV1 2IDAA 3O35A 2H0DA 3HCSA 5JG6A 2KGGA 3O70A 5TDRA 1X4UA 2MT5A 1K2FA 1DVPA 5G0FA 2YHNA 3DPLR 5KH7A 5TDWA 4AYCB 3KQIA 2KREA 3ZNIA 3EB5A 5D1MB 4YBMA 2I50A 2H0DB 2OXQC 2VJFB 3M62A 3I2DA 3O37A 2KGIA 3MHSA 3N9LA 4BHWA 2DX8A 2ECJA 4AYCA 2YW8A 4IC2A 1CHCA 3C6WA 2LV9A 2JMJA 2YSMA 1WESA 1F62A 2VPEA 2EA6A 2MIQA 3NG2A 1G25A 3L1ZB 2Y1MA 2HYED 2VPGA 4CCGX 4WZ2A 1VFYA 1T1HA 1WEQA 4B7YC 3HCTA 2ECNA 5DINA 4Q6FA 2EGPA 1JM7A 3DQVR 1WGMA 1WEWA 5B77A 2ECIA 5TABA 4O64A 4ZDTA 4UP5A 4YADA 2K17A 1E4UA 2M85A 5FERA 4XI1A 4FO9A 3N9NA 4FJCA 2KWKA 1Z60A 2CKLA 3HCUA 4AUQB 2QIZA 4A49A 3HTKC 4N4FA 2LGKA 1X4IA 2KWJA 5B8DA 4ZUXU 2G45A 2MA6A 5G05B 2ECTA 1VYXA 2KR4A 1JM7B 1LDKC 3VK6A 3RPGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  2MUM A;  3LRQ A;  2NAA A;  2JRJ A;  2YUC A;  3U5O A;  1MM2 A;  2RSD A;  2CKL B;  2L0B A;  2YUR A;  1WEN A;  1U6G B;  2YT5 A;  4GNG A;  3FL2 A;  5TBN A;  3U5P A;  3IHP A;  3PUQ A;  2F42 A;  3SHB A;  3SOX A;  3M63 A;  4I7B A;  4A4B A;  2XB1 A;  4MSX A;  1ZBD B;  3L11 A;  3C5K A;  2PNX A;  2L80 A;  1WEV A;  2K16 A;  2RI7 A;  2F6N A;  4CA1 A;  1BOR A;  4LAD B;  4LK9 A;  5H9M A;  2UZG A;  1WEM A;  5KH9 A;  2Y1N A;  4R2Y A;  2MA5 A;  2KWO A;  1WIL A;  1WEO A;  4P5O B;  2D8S A;  5LKX A;  2VPD A;  2YRE A;  2LGV A;  1JOC A;  2FUU A;  4FK5 A;  4L58 A;  3EB6 A;  5TRB A;  4TKP B;  3ZPV E;  3SOU A;  5D1L B;  5B79 A;  4S3O B;  1VD4 A;  2K1J A;  4UP0 A;  3SOW A;  2YQL A;  4WA6 A;  3GV4 A;  4B86 C;  1V87 A;  3ASL A;  4QF3 A;  3LQI A;  2LDR A;  2QIC A;  2LGL A;  2YQM A;  2KFT A;  4I7D A;  4GB0 A;  2G6Q A;  2KU3 A;  2JMI A;  4V3K C;  5J3X A;  5LCW B;  5H1V A;  4YBT A;  5H1U A;  4YAX A;  5B76 A;  3N9O A;  4L7X A;  2LXP C;  3N9P A;  5FEY A;  3PUR A;  2MNY A;  2XEU A;  2CT2 A;  3T7L A;  3O7A A;  5C11 A;  3O33 A;  1FP0 A;  4YAB A;  4X3G A;  2QJ0 A;  4PPE A;  5DKA A;  3ZVZ B;  3PHD A;  4WZ3 B;  4FIP A;  4C9Z A;  3O36 A;  4LJN A;  2LXH C;  4GNF A;  2E6R A;  2FUI A;  1WEU A;  3V43 A;  5C13 A;  2KIZ A;  3MHH A;  2MD8 C;  2MNZ A;  3O34 A;  1HYI A;  2ECV A;  2ECG A;  2G43 A;  4WZ0 A;  2Y43 A;  3LQH A;  2LN0 A;  2AN6 A;  1XWH A;  3ZTG A;  1X4J A;  2L5U A;  1FBV A;  2YHO A;  5LKZ A;  5G04 B;  1N87 A;  2LGG A;  3KNV A;  3U5M A;  4AVX A;  2LRI C;  4LLB A;  5I3L A;  2FSA A;  2C2L A;  2YSJ A;  1WE9 A;  2CSY A;  4LKA A;  5AIU A;  2C2V S;  5KH3 A;  1Z2Q A;  1IYM A;  4R8P K;  3KV6 A;  2L75 A;  4IC3 A;  3N9Q A;  2HDP A;  2ZET C;  4MVT A;  3T6R A;  2M6M A;  5LKT A;  4F52 B;  4BBQ A;  1WFK A;  2YU4 A;  2M3H A;  5FB0 A;  2VP7 A;  4I7C A;  2M1R A;  3RTR B;  2VPB A;  4YC9 A;  1HYJ A;  2LQ6 A;  5B78 A;  4UI9 B;  4PTB A;  2EOD A;  1WIM A;  2PUY A;  3KV5 A;  1Z6U A;  5B75 A;  4S3O C;  2VNF A;  4NN2 A;  4A0C D;  4R7E A;  4QF2 A;  2YYR A;  2VJE A;  5H1T A;  3M99 A;  4W4U A;  2F6J A;  5AIT A;  1LDJ B;  1MM3 A;  1RMD A;  4GND A;  4YAT A;  3QZV A;  3LQJ A;  4V3L C;  2BAY A;  2KE1 A;  4N3W A;  5LKU A;  2MD7 B;  4ZQL A;  3RPG B;  2VJF A;  2L43 A;  4GNE A;  5EYA F;  1WEE A;  2VJE B;  3GL6 A;  2K4D A;  2E6S A;  5FB1 A;  4YBS A;  2KYU A;  3L1X A;  2CSZ A;  3ZYQ A;  5D1K B;  3N9M A;  1WEP A;  2KWN A;  2ECW A;  4AP4 A;  3U5N A;  3ZVY A;  2JMD A;  3ZPV 1;  2IDA A;  3O35 A;  2H0D A;  3HCS A;  5JG6 A;  2KGG A;  3O70 A;  5TDR A;  1X4U A;  2MT5 A;  1K2F A;  1DVP A;  5G0F A;  2YHN A;  3DPL R;  5KH7 A;  5TDW A;  4AYC B;  3KQI A;  2KRE A;  3ZNI A;  3EB5 A;  5D1M B;  4YBM A;  2I50 A;  2H0D B;  2OXQ C;  2VJF B;  3M62 A;  3I2D A;  3O37 A;  2KGI A;  3MHS A;  3N9L A;  4BHW A;  2DX8 A;  2ECJ A;  4AYC A;  2YW8 A;  4IC2 A;  1CHC A;  3C6W A;  2LV9 A;  2JMJ A;  2YSM A;  1WES A;  1F62 A;  2VPE A;  2EA6 A;  2MIQ A;  3NG2 A;  1G25 A;  3L1Z B;  2Y1M A;  2HYE D;  2VPG A;  4CCG X;  4WZ2 A;  1VFY A;  1T1H A;  1WEQ A;  4B7Y C;  3HCT A;  2ECN A;  5DIN A;  4Q6F A;  2EGP A;  1JM7 A;  3DQV R;  1WGM A;  1WEW A;  5B77 A;  2ECI A;  5TAB A;  4O64 A;  4ZDT A;  4UP5 A;  4YAD A;  2K17 A;  1E4U A;  2M85 A;  5FER A;  4XI1 A;  4FO9 A;  3N9N A;  4FJC A;  2KWK A;  1Z60 A;  2CKL A;  3HCU A;  4AUQ B;  2QIZ A;  4A49 A;  3HTK C;  4N4F A;  2LGK A;  1X4I A;  2KWJ A;  5B8D A;  4ZUX U;  2G45 A;  2MA6 A;  5G05 B;  2ECT A;  1VYX A;  2KR4 A;  1JM7 B;  1LDK C;  3VK6 A;  3RPG C; 
#chains in the Genus database with same CATH topology
 3FEH A;  4A4C A;  2MUM A;  3LRQ A;  2M13 A;  2NAA A;  5SVY A;  2JRJ A;  2RR4 A;  2YUC A;  2P57 A;  3U5O A;  1MM2 A;  3T9K A;  2RSD A;  2YVR A;  2CKL B;  2OWA A;  2L0B A;  2YUR A;  1WEN A;  2EGM A;  1U6G B;  2YT5 A;  4GNG A;  3FL2 A;  5TBN A;  3U5P A;  3IHP A;  2E61 A;  3PUQ A;  4Z0O A;  2F42 A;  3SHB A;  3SOX A;  3M63 A;  4I7B A;  4A4B A;  2XB1 A;  4MSX A;  1ZBD B;  3L11 A;  3C5K A;  2PNX A;  2L80 A;  1WEV A;  2K16 A;  2RI7 A;  2F6N A;  4H9D A;  4CA1 A;  1BOR A;  2EXU A;  4LAD B;  4LK9 A;  5H9M A;  2UZG A;  1WEM A;  5KH9 A;  2Y1N A;  4R2Y A;  3FAN A;  2MA5 A;  2KWO A;  1WIL A;  1WEO A;  4P5O B;  2CRR A;  2XOC A;  2D8S A;  5LKX A;  2VPD A;  2YRE A;  2LGV A;  1JOC A;  2FUU A;  4FK5 A;  4L58 A;  3EB6 A;  5TRB A;  4TKP B;  3ZPV E;  2L7P A;  3SOU A;  5D1L B;  5B79 A;  4S3O B;  1VD4 A;  2K1J A;  4UP0 A;  3SOW A;  3DDT A;  2YQL A;  4WA6 A;  3GV4 A;  4B86 C;  1V87 A;  3ASL A;  4QF3 A;  3LQI A;  2LDR A;  2QIC A;  2JM3 A;  2LGL A;  2YQM A;  2KFT A;  4I7D A;  4GB0 A;  2G6Q A;  2KU3 A;  3MDB C;  2JMI A;  4V3K C;  5J3X A;  5LCW B;  5SVI B;  5H1V A;  4YBT A;  2XOY A;  5H1U A;  4YAX A;  5B76 A;  3N9O A;  4L7X A;  2LXP C;  3N9P A;  5FEY A;  3PUR A;  2MNY A;  2XEU A;  3M7K A;  2CT2 A;  3T7L A;  3O7A A;  5C11 A;  3E2D A;  3O33 A;  3PLW A;  1FP0 A;  2FD4 A;  4YAB A;  4X3G A;  2QJ0 A;  4PPE A;  5DKA A;  3ZVZ B;  3PHD A;  4WZ3 B;  4FIP A;  4C9Z A;  3O36 A;  4LJN A;  2LXH C;  4GNF A;  3FAO A;  2E6R A;  2FUI A;  2B0O E;  1WEU A;  3O47 A;  3V43 A;  5C13 A;  2KIZ A;  1DCQ A;  3MHH A;  2MD8 C;  2MNZ A;  3O34 A;  1HYI A;  2ECV A;  2ECG A;  2G43 A;  4WZ0 A;  5SVI A;  2Y43 A;  3LQH A;  2IQJ A;  2LN0 A;  2LAU A;  2AN6 A;  1XWH A;  3ZTG A;  1X4J A;  2L5U A;  1FBV A;  2YHO A;  5LKZ A;  5G04 B;  1N87 A;  2LGG A;  3KNV A;  3U5M A;  3SUB A;  4QQ4 A;  2LRI C;  4LLB A;  4AVX A;  5I3L A;  2FSA A;  2C2L A;  2YSJ A;  1WE9 A;  2CSY A;  4LKA A;  5AIU A;  2C2V S;  5KH3 A;  1Z2Q A;  1IYM A;  4R8P K;  3KV6 A;  4OGC A;  2L75 A;  4F1P A;  4IC3 A;  3N9Q A;  2HDP A;  2ZET C;  5K3Q A;  4MVT A;  3T6R A;  2M6M A;  5LKT A;  4F52 B;  4BBQ A;  1WFK A;  2YU4 A;  2M3H A;  5FB0 A;  2VP7 A;  2XOZ A;  4I7C A;  2M1R A;  3KDE C;  3LVQ E;  3RTR B;  2VPB A;  4YC9 A;  2FFW A;  1HYJ A;  3H7H A;  2LQ6 A;  2DJA A;  5B78 A;  4UI9 B;  4PTB A;  2EOD A;  1WIM A;  2PUY A;  3KV5 A;  1Z6U A;  5B75 A;  4S3O C;  2VNF A;  4NN2 A;  2XP0 A;  4A0C D;  4R7E A;  4QF2 A;  2YYR A;  2VJE A;  5H1T A;  3M99 A;  4W4U A;  2F6J A;  5AIT A;  2CSV A;  1LDJ B;  3LJU X;  1MM3 A;  4OGE A;  1RMD A;  4GND A;  4YAT A;  3QZV A;  3LQJ A;  4V3L C;  2BAY A;  2KE1 A;  4N3W A;  5LKU A;  2MD7 B;  4ZQL A;  3RPG B;  2VJF A;  2L43 A;  4GNE A;  5EYA F;  1WEE A;  2VJE B;  3GL6 A;  2K4D A;  2E6S A;  5FB1 A;  4YBS A;  2KYU A;  3L1X A;  2CSZ A;  3ZYQ A;  5D1K B;  3FM8 C;  3N9M A;  1WEP A;  2KWN A;  3LDY A;  2ECW A;  4AP4 A;  3U5N A;  3ZVY A;  2JMD A;  3ZPV 1;  2IDA A;  3O35 A;  2H0D A;  3HCS A;  5JG6 A;  2KGG A;  3O70 A;  2DSM A;  5TDR A;  1X4U A;  2MT5 A;  1K2F A;  1DVP A;  5G0F A;  2YHN A;  4O62 A;  2KKY A;  3DPL R;  5KH7 A;  5TDW A;  4AYC B;  3KQI A;  2KRE A;  3ZNI A;  2KKX A;  3EB5 A;  2JUN A;  3DWD A;  5D1M B;  4YBM A;  2I50 A;  2D8U A;  2H0D B;  2OXQ C;  2VJF B;  3M62 A;  3I2D A;  3O37 A;  2KGI A;  3MHS A;  3N9L A;  4BHW A;  2DX8 A;  2ECJ A;  4AYC A;  2YW8 A;  4IC2 A;  1CHC A;  3C6W A;  2LV9 A;  2JMJ A;  2YSM A;  1WES A;  1F62 A;  2VPE A;  2EA6 A;  2MIQ A;  3NG2 A;  1G25 A;  3L1Z B;  5SVX A;  2Y1M A;  2HYE D;  2VPG A;  4CCG X;  4WZ2 A;  1VFY A;  2CON A;  1T1H A;  1WEQ A;  4B7Y C;  3HCT A;  2ECN A;  2CRW A;  5DIN A;  2MKE A;  4Q6F A;  2EGP A;  1JM7 A;  3DQV R;  1WGM A;  1WEW A;  5B77 A;  2ECI A;  3JUE A;  5TAB A;  4O64 A;  4ZDT A;  4UP5 A;  4YAD A;  2K17 A;  1E4U A;  2M85 A;  5FER A;  4XI1 A;  4FO9 A;  3N9N A;  4FJC A;  2KWK A;  1Z60 A;  2CKL A;  3HCU A;  4AUQ B;  2QIZ A;  4A49 A;  3HTK C;  4N4F A;  2LGK A;  1X4I A;  2KWJ A;  5B8D A;  4ZUX U;  2G45 A;  2MA6 A;  5G05 B;  2ECT A;  3FJU B;  1VYX A;  2KR4 A;  3Q1D A;  1JM7 B;  3LVR E;  1LDK C;  3VK6 A;  4Z0R A;  3RPG C;  1MBM A; 
#chains in the Genus database with same CATH homology
 4A4C A;  2MUM A;  3LRQ A;  2NAA A;  2JRJ A;  2YUC A;  3U5O A;  1MM2 A;  2RSD A;  2CKL B;  2L0B A;  2YUR A;  1WEN A;  1U6G B;  2YT5 A;  4GNG A;  3FL2 A;  5TBN A;  3U5P A;  3IHP A;  3PUQ A;  2F42 A;  3SHB A;  3SOX A;  3M63 A;  4I7B A;  4A4B A;  2XB1 A;  4MSX A;  1ZBD B;  3L11 A;  3C5K A;  2PNX A;  2L80 A;  1WEV A;  2K16 A;  2RI7 A;  2F6N A;  4CA1 A;  1BOR A;  4LAD B;  4LK9 A;  5H9M A;  2UZG A;  1WEM A;  5KH9 A;  2Y1N A;  4R2Y A;  2MA5 A;  2KWO A;  1WIL A;  1WEO A;  4P5O B;  2D8S A;  5LKX A;  2VPD A;  2YRE A;  2LGV A;  1JOC A;  2FUU A;  4FK5 A;  4L58 A;  3EB6 A;  5TRB A;  4TKP B;  3ZPV E;  3SOU A;  5D1L B;  5B79 A;  4S3O B;  1VD4 A;  2K1J A;  4UP0 A;  3SOW A;  2YQL A;  4WA6 A;  3GV4 A;  4B86 C;  1V87 A;  3ASL A;  4QF3 A;  3LQI A;  2LDR A;  2QIC A;  2LGL A;  2YQM A;  2KFT A;  4I7D A;  4GB0 A;  2G6Q A;  2KU3 A;  2JMI A;  4V3K C;  5J3X A;  5LCW B;  5H1V A;  4YBT A;  5H1U A;  4YAX A;  5B76 A;  3N9O A;  4L7X A;  2LXP C;  3N9P A;  5FEY A;  3PUR A;  2MNY A;  2XEU A;  2CT2 A;  3T7L A;  3O7A A;  5C11 A;  3O33 A;  1FP0 A;  4YAB A;  4X3G A;  2QJ0 A;  4PPE A;  5DKA A;  3ZVZ B;  3PHD A;  4WZ3 B;  4FIP A;  4C9Z A;  3O36 A;  4LJN A;  2LXH C;  4GNF A;  2E6R A;  2FUI A;  1WEU A;  3V43 A;  5C13 A;  2KIZ A;  3MHH A;  2MD8 C;  2MNZ A;  3O34 A;  1HYI A;  2ECV A;  2ECG A;  2G43 A;  4WZ0 A;  2Y43 A;  3LQH A;  2LN0 A;  2AN6 A;  1XWH A;  3ZTG A;  1X4J A;  2L5U A;  1FBV A;  2YHO A;  5LKZ A;  5G04 B;  1N87 A;  2LGG A;  3KNV A;  3U5M A;  4AVX A;  2LRI C;  4LLB A;  5I3L A;  2FSA A;  2C2L A;  2YSJ A;  1WE9 A;  2CSY A;  4LKA A;  5AIU A;  2C2V S;  5KH3 A;  1Z2Q A;  1IYM A;  4R8P K;  3KV6 A;  2L75 A;  4IC3 A;  3N9Q A;  2HDP A;  2ZET C;  4MVT A;  3T6R A;  2M6M A;  5LKT A;  4F52 B;  4BBQ A;  1WFK A;  2YU4 A;  2M3H A;  5FB0 A;  2VP7 A;  4I7C A;  2M1R A;  3RTR B;  2VPB A;  4YC9 A;  1HYJ A;  2LQ6 A;  5B78 A;  4UI9 B;  4PTB A;  2EOD A;  1WIM A;  2PUY A;  3KV5 A;  1Z6U A;  5B75 A;  4S3O C;  2VNF A;  4NN2 A;  4A0C D;  4R7E A;  4QF2 A;  2YYR A;  2VJE A;  5H1T A;  3M99 A;  4W4U A;  2F6J A;  5AIT A;  1LDJ B;  1MM3 A;  1RMD A;  4GND A;  4YAT A;  3QZV A;  3LQJ A;  4V3L C;  2BAY A;  2KE1 A;  4N3W A;  5LKU A;  2MD7 B;  4ZQL A;  3RPG B;  2VJF A;  2L43 A;  4GNE A;  5EYA F;  1WEE A;  2VJE B;  3GL6 A;  2K4D A;  2E6S A;  5FB1 A;  4YBS A;  2KYU A;  3L1X A;  2CSZ A;  3ZYQ A;  5D1K B;  3N9M A;  1WEP A;  2KWN A;  2ECW A;  4AP4 A;  3U5N A;  3ZVY A;  2JMD A;  3ZPV 1;  2IDA A;  3O35 A;  2H0D A;  3HCS A;  5JG6 A;  2KGG A;  3O70 A;  5TDR A;  1X4U A;  2MT5 A;  1K2F A;  1DVP A;  5G0F A;  2YHN A;  3DPL R;  5KH7 A;  5TDW A;  4AYC B;  3KQI A;  2KRE A;  3ZNI A;  3EB5 A;  5D1M B;  4YBM A;  2I50 A;  2H0D B;  2OXQ C;  2VJF B;  3M62 A;  3I2D A;  3O37 A;  2KGI A;  3MHS A;  3N9L A;  4BHW A;  2DX8 A;  2ECJ A;  4AYC A;  2YW8 A;  4IC2 A;  1CHC A;  3C6W A;  2LV9 A;  2JMJ A;  2YSM A;  1WES A;  1F62 A;  2VPE A;  2EA6 A;  2MIQ A;  3NG2 A;  1G25 A;  3L1Z B;  2Y1M A;  2HYE D;  2VPG A;  4CCG X;  4WZ2 A;  1VFY A;  1T1H A;  1WEQ A;  4B7Y C;  3HCT A;  2ECN A;  5DIN A;  4Q6F A;  2EGP A;  1JM7 A;  3DQV R;  1WGM A;  1WEW A;  5B77 A;  2ECI A;  5TAB A;  4O64 A;  4ZDT A;  4UP5 A;  4YAD A;  2K17 A;  1E4U A;  2M85 A;  5FER A;  4XI1 A;  4FO9 A;  3N9N A;  4FJC A;  2KWK A;  1Z60 A;  2CKL A;  3HCU A;  4AUQ B;  2QIZ A;  4A49 A;  3HTK C;  4N4F A;  2LGK A;  1X4I A;  2KWJ A;  5B8D A;  4ZUX U;  2G45 A;  2MA6 A;  5G05 B;  2ECT A;  1VYX A;  2KR4 A;  1JM7 B;  1LDK C;  3VK6 A;  3RPG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...