1VFYA

Phosphatidylinositol-3-phosphate binding fyve domain of vps27p protein from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
DWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFEDYEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-3-PHOSPHATE BINDING FYVE DOMAIN OF PROT
publication title Crystal structure of a phosphatidylinositol 3-phosphate-specific membrane-targeting motif, the FYVE domain of Vps27p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vfyA00
4GNGA 1WEOA 3NG2A 2MT5A 4YC9A 2G6QA 5TDRA 4YBMA 2KWNA 3O7AA 4YBSA 4AVXA 1JM7B 5H1TA 3U5NA 3ZNIA 1WEVA 4IC2A 4Q6FA 4V3LC 2LGKA 5J3XA 4A49A 5AIUA 4AYCB 2MNZA 5LKUA 1JM7A 2LV9A 1Z2QA 4N4FA 5FB1A 3KV6A 5B78A 3MHHA 2M3HA 4UP0A 4AYCA 2F6JA 4ZQLA 2CSZA 4MVTA 3N9OA 3ASLA 3VK6A 4TKPB 3L1ZB 4PTBA 1MM2A 3L1XA 4YBTA 4I7DA 4QF3A 3U5OA 2ECWA 2PNXA 2YQMA 4WZ0A 1LDJB 1CHCA 2LGGA 5D1MB 3RPGB 2D8SA 2C2VS 3ZVYA 4GNFA 2IDAA 2VPDA 3EB5A 1FP0A 2C2LA 3FL2A 4LKAA 4YABA 2KIZA 2LRIC 2LXHC 5G0FA 2Y43A 4BBQA 4A0CD 1Z6UA 1XWHA 5TABA 4N3WA 3LRQA 3O70A 4LADB 1WFKA 2Y1NA 3O37A 1X4JA 5C11A 4F52B 4R8PK 3GV4A 2K16A 2EGPA 2OXQC 5EYAF 3RPGC 3HCTA 2MD8C 2MIQA 2LQ6A 1ZBDB 2KGIA 1WILA 2M1RA 2NAAA 4FO9A 4UP5A 2L43A 3U5MA 5B8DA 4X3GA 4LJNA 2HYED 2G43A 3HCSA 2YW8A 2YREA 2KR4A 4CA1A 4A4CA 5LCWB 5DINA 3O35A 4I7CA 3QZVA 2K1JA 3SOWA 1U6GB 2FUUA 2L5UA 1WESA 1LDKC 5LKZA 2PUYA 4L58A 4P5OB 3LQHA 2VPGA 2FUIA 2LGLA 2JMDA 2ZETC 2KGGA 3EB6A 5G05B 4PPEA 4WZ2A 2YU4A 4AUQB 3KV5A 2RSDA 3N9PA 3KNVA 2KWKA 5AITA 1VD4A 1K2FA 2MA6A 4GNDA 1E4UA 1JOCA 1G25A 3DPLR 3T6RA 2EA6A 2H0DA 2QICA 1F62A 5TDWA 2CT2A 5B79A 2I50A 2KU3A 5TRBA 1WGMA 3SOXA 2YSJA 1X4UA 2F6NA 2XB1A 1WEMA 4ZDTA 3T7LA 2VJEB 2KE1A 5I3LA 2K4DA 2M6MA 2ECTA 2KREA 2KYUA 3ZPV1 5JG6A 3N9LA 5H1VA 3KQIA 3LQJA 2VJEA 3O36A 2YYRA 1IYMA 3GL6A 1WEPA 1N87A 5FEYA 5KH9A 4NN2A 4LK9A 1FBVA 5G04B 5B76A 4UI9B 2K17A 5H9MA 5D1LB 4FJCA 2JMIA 4FIPA 3I2DA 2LDRA 4I7BA 2YSMA 1MM3A 1T1HA 4R2YA 2YHOA 2VPBA 3PHDA 2AN6A 2CSYA 1HYJA 3O34A 4QF2A 2ECJA 2VJFB 4R7EA 2ECVA 3ZPVE 2CKLB 5B75A 4FK5A 4WZ3B 2FSAA 3M63A 4BHWA 3ZVZB 2VJFA 1WE9A 1HYIA 5KH3A 3HCUA 1WEQA 3DQVR 4O64A 2CKLA 5B77A 3SHBA 3V43A 2ECIA 2UZGA 5FB0A 2LN0A 5LKTA 3LQIA 3RTRB 2JRJA 2RI7A 2YUCA 2YT5A 4S3OB 2QIZA 4YAXA 2MD7B 2H0DB 2MA5A 5KH7A 1WEWA 1WENA 2VPEA 2MUMA 1V87A 4IC3A 2ECNA 2F42A 3MHSA 2HDPA 3L11A 4L7XA 3C6WA 3M62A 1X4IA 2KWJA 2ECGA 4AP4A 2L75A 2QJ0A 4GNEA 4WA6A 4S3OC 1WEEA 3ZTGA 2KWOA 4B7YC 4YADA 2LGVA 4ZUXU 4CCGX 2DX8A 2YQLA 5FERA 2M85A 1Z60A 5LKXA 4W4UA 2E6RA 4A4BA 2VNFA 2YHNA 2EODA 5DKAA 3ZYQA 5TBNA 1WEUA 3N9MA 2YURA 3C5KA 2E6SA 3PUQA 1BORA 4MSXA 2BAYA 2MNYA 3PURA 3M99A 2VP7A 1DVPA 1WIMA 3N9QA 2JMJA 4V3KC 1VFYA 4LLBA 2LXPC 3N9NA 1VYXA 2KFTA 2XEUA 4C9ZA 4B86C 4YATA 2L0BA 5D1KB 4GB0A 3IHPA 3SOUA 3U5PA 2G45A 4XI1A 5H1UA 3HTKC 2L80A 2Y1MA 1RMDA 3O33A 5C13A
chains in the Genus database with same CATH superfamily
4GNGA 1WEOA 4Z0RA 3NG2A 2MT5A 4YC9A 2G6QA 5SVXA 5TDRA 4YBMA 4Z0OA 2KWNA 3O7AA 4YBSA 4AVXA 1JM7B 2M13A 2L7PA 5H1TA 3U5NA 3ZNIA 1WEVA 4IC2A 4Q6FA 4V3LC 2LGKA 3LJUX 5J3XA 3FAOA 4A49A 5AIUA 3LVQE 2XP0A 4AYCB 2MNZA 5LKUA 1JM7A 2LV9A 1Z2QA 4N4FA 5FB1A 3KV6A 4O62A 5B78A 3MHHA 2M3HA 4UP0A 4AYCA 2F6JA 4ZQLA 2CSZA 4MVTA 3N9OA 3ASLA 3VK6A 4TKPB 3L1ZB 4PTBA 1MM2A 3L1XA 4YBTA 4I7DA 4QQ4A 4QF3A 3U5OA 2ECWA 2PNXA 2YQMA 3FJUB 4WZ0A 2E61A 1LDJB 1CHCA 2LGGA 5D1MB 3RPGB 2D8SA 2C2VS 3ZVYA 2B0OE 4GNFA 2IDAA 2VPDA 3EB5A 1FP0A 2C2LA 3FL2A 4LKAA 4YABA 2KIZA 2LRIC 2LXHC 2XOCA 5G0FA 2Y43A 4BBQA 4A0CD 1Z6UA 1XWHA 5TABA 4N3WA 3LRQA 3O70A 4LADB 1WFKA 2Y1NA 3O37A 1X4JA 5C11A 2XOZA 4F52B 4R8PK 3GV4A 3DDTA 2K16A 2EGPA 2OXQC 5EYAF 3RPGC 5SVIB 3HCTA 2MD8C 2MIQA 2DSMA 2LQ6A 1ZBDB 2KGIA 1WILA 2M1RA 3FANA 3H7HA 2NAAA 4FO9A 4UP5A 2L43A 5SVIA 3U5MA 5B8DA 4X3GA 4LJNA 2HYED 2G43A 3HCSA 2YW8A 2YREA 2KR4A 4CA1A 4A4CA 5LCWB 5DINA 3Q1DA 3LVRE 3O35A 4I7CA 3QZVA 2K1JA 3SOWA 1U6GB 2FUUA 2L5UA 1WESA 1LDKC 5LKZA 2PUYA 4L58A 3PLWA 4OGEA 2YVRA 4P5OB 3LQHA 2VPGA 2FUIA 2LGLA 2JMDA 2ZETC 4H9DA 2FFWA 2XOYA 2KGGA 3EB6A 5G05B 4OGCA 2EXUA 4PPEA 4WZ2A 2YU4A 4AUQB 3KV5A 2D8UA 2RSDA 3DWDA 2FD4A 3N9PA 3KNVA 2KWKA 5AITA 1VD4A 1K2FA 2MA6A 4GNDA 1E4UA 1JOCA 1G25A 2DJAA 3DPLR 3T6RA 2EA6A 2CSVA 2H0DA 2QICA 1F62A 5TDWA 2CT2A 5B79A 2I50A 2KU3A 5TRBA 1WGMA 3SOXA 2YSJA 3JUEA 1X4UA 2F6NA 2XB1A 1WEMA 4ZDTA 3T7LA 2VJEB 2KE1A 5I3LA 2K4DA 2M6MA 2ECTA 2KREA 2KYUA 3ZPV1 2CRRA 5JG6A 3N9LA 5H1VA 3KQIA 3LQJA 3LDYA 2VJEA 2CRWA 2YYRA 3O36A 1IYMA 3GL6A 1WEPA 1N87A 5FEYA 5KH9A 4NN2A 4LK9A 1FBVA 5G04B 5B76A 4UI9B 2K17A 5H9MA 5D1LB 4FJCA 4F1PA 2JMIA 4FIPA 3O47A 3I2DA 2LDRA 3FEHA 4I7BA 2IQJA 2YSMA 1MM3A 1T1HA 2P57A 4R2YA 2YHOA 2VPBA 3PHDA 2AN6A 2CSYA 1HYJA 3E2DA 3O34A 4QF2A 2ECJA 2VJFB 4R7EA 3FM8C 2ECVA 3ZPVE 2OWAA 2CKLB 5B75A 4FK5A 4WZ3B 2FSAA 3M63A 4BHWA 3MDBC 3ZVZB 2VJFA 1WE9A 1HYIA 5KH3A 3HCUA 1WEQA 3DQVR 4O64A 2CKLA 5B77A 3SHBA 3V43A 5K3QA 2ECIA 2UZGA 5FB0A 2RR4A 2LN0A 5LKTA 3LQIA 2JUNA 3RTRB 2JRJA 2RI7A 2YUCA 2YT5A 4S3OB 2QIZA 4YAXA 2MD7B 2H0DB 2MA5A 5KH7A 1WEWA 1WENA 2VPEA 2MUMA 1V87A 3SUBA 4IC3A 2ECNA 2F42A 3MHSA 2HDPA 3L11A 4L7XA 2LAUA 3C6WA 3M62A 1X4IA 2KWJA 2ECGA 4AP4A 2L75A 2QJ0A 4GNEA 4WA6A 4S3OC 1WEEA 3ZTGA 2KWOA 4B7YC 4YADA 2LGVA 4ZUXU 4CCGX 2DX8A 1DCQA 2YQLA 5FERA 2M85A 1Z60A 5LKXA 4W4UA 2E6RA 2MKEA 4A4BA 2VNFA 2YHNA 2EODA 5DKAA 3ZYQA 5TBNA 2EGMA 1WEUA 3N9MA 2YURA 3M7KA 3C5KA 2E6SA 3T9KA 3PUQA 1BORA 2KKYA 4MSXA 2BAYA 2MNYA 3PURA 3M99A 2VP7A 1DVPA 1WIMA 3N9QA 2JMJA 4V3KC 1VFYA 4LLBA 2LXPC 3N9NA 1VYXA 2KFTA 2XEUA 4C9ZA 4B86C 4YATA 2L0BA 5D1KB 4GB0A 5SVYA 3IHPA 3SOUA 2CONA 3U5PA 2G45A 2JM3A 4XI1A 5H1UA 1MBMA 3HTKC 2L80A 2Y1MA 1RMDA 2KKXA 3O33A 3KDEC 5C13A
chains in the Genus database with same CATH topology
4GNGA 1WEOA 3NG2A 2MT5A 4YC9A 2G6QA 5TDRA 4YBMA 2KWNA 3O7AA 4YBSA 4AVXA 1JM7B 5H1TA 3U5NA 3ZNIA 1WEVA 4IC2A 4Q6FA 4V3LC 2LGKA 5J3XA 4A49A 5AIUA 4AYCB 2MNZA 5LKUA 1JM7A 2LV9A 1Z2QA 4N4FA 5FB1A 3KV6A 5B78A 3MHHA 2M3HA 4UP0A 4AYCA 2F6JA 4ZQLA 2CSZA 4MVTA 3N9OA 3ASLA 3VK6A 4TKPB 3L1ZB 4PTBA 1MM2A 3L1XA 4YBTA 4I7DA 4QF3A 3U5OA 2ECWA 2PNXA 2YQMA 4WZ0A 1LDJB 1CHCA 2LGGA 5D1MB 3RPGB 2D8SA 2C2VS 3ZVYA 4GNFA 2IDAA 2VPDA 3EB5A 1FP0A 2C2LA 3FL2A 4LKAA 4YABA 2KIZA 2LRIC 2LXHC 5G0FA 2Y43A 4BBQA 4A0CD 1Z6UA 1XWHA 5TABA 4N3WA 3LRQA 3O70A 4LADB 1WFKA 2Y1NA 3O37A 1X4JA 5C11A 4F52B 4R8PK 3GV4A 2K16A 2EGPA 2OXQC 5EYAF 3RPGC 3HCTA 2MD8C 2MIQA 2LQ6A 1ZBDB 2KGIA 1WILA 2M1RA 2NAAA 4FO9A 4UP5A 2L43A 3U5MA 5B8DA 4X3GA 4LJNA 2HYED 2G43A 3HCSA 2YW8A 2YREA 2KR4A 4CA1A 4A4CA 5LCWB 5DINA 3O35A 4I7CA 3QZVA 2K1JA 3SOWA 1U6GB 2FUUA 2L5UA 1WESA 1LDKC 5LKZA 2PUYA 4L58A 4P5OB 3LQHA 2VPGA 2FUIA 2LGLA 2JMDA 2ZETC 2KGGA 3EB6A 5G05B 4PPEA 4WZ2A 2YU4A 4AUQB 3KV5A 2RSDA 3N9PA 3KNVA 2KWKA 5AITA 1VD4A 1K2FA 2MA6A 4GNDA 1E4UA 1JOCA 1G25A 3DPLR 3T6RA 2EA6A 2H0DA 2QICA 1F62A 5TDWA 2CT2A 5B79A 2I50A 2KU3A 5TRBA 1WGMA 3SOXA 2YSJA 1X4UA 2F6NA 2XB1A 1WEMA 4ZDTA 3T7LA 2VJEB 2KE1A 5I3LA 2K4DA 2M6MA 2ECTA 2KREA 2KYUA 3ZPV1 5JG6A 3N9LA 5H1VA 3KQIA 3LQJA 2VJEA 3O36A 2YYRA 1IYMA 3GL6A 1WEPA 1N87A 5FEYA 5KH9A 4NN2A 4LK9A 1FBVA 5G04B 5B76A 4UI9B 2K17A 5H9MA 5D1LB 4FJCA 2JMIA 4FIPA 3I2DA 2LDRA 4I7BA 2YSMA 1MM3A 1T1HA 4R2YA 2YHOA 2VPBA 3PHDA 2AN6A 2CSYA 1HYJA 3O34A 4QF2A 2ECJA 2VJFB 4R7EA 2ECVA 3ZPVE 2CKLB 5B75A 4FK5A 4WZ3B 2FSAA 3M63A 4BHWA 3ZVZB 2VJFA 1WE9A 1HYIA 5KH3A 3HCUA 1WEQA 3DQVR 4O64A 2CKLA 5B77A 3SHBA 3V43A 2ECIA 2UZGA 5FB0A 2LN0A 5LKTA 3LQIA 3RTRB 2JRJA 2RI7A 2YUCA 2YT5A 4S3OB 2QIZA 4YAXA 2MD7B 2H0DB 2MA5A 5KH7A 1WEWA 1WENA 2VPEA 2MUMA 1V87A 4IC3A 2ECNA 2F42A 3MHSA 2HDPA 3L11A 4L7XA 3C6WA 3M62A 1X4IA 2KWJA 2ECGA 4AP4A 2L75A 2QJ0A 4GNEA 4WA6A 4S3OC 1WEEA 3ZTGA 2KWOA 4B7YC 4YADA 2LGVA 4ZUXU 4CCGX 2DX8A 2YQLA 5FERA 2M85A 1Z60A 5LKXA 4W4UA 2E6RA 4A4BA 2VNFA 2YHNA 2EODA 5DKAA 3ZYQA 5TBNA 1WEUA 3N9MA 2YURA 3C5KA 2E6SA 3PUQA 1BORA 4MSXA 2BAYA 2MNYA 3PURA 3M99A 2VP7A 1DVPA 1WIMA 3N9QA 2JMJA 4V3KC 1VFYA 4LLBA 2LXPC 3N9NA 1VYXA 2KFTA 2XEUA 4C9ZA 4B86C 4YATA 2L0BA 5D1KB 4GB0A 3IHPA 3SOUA 3U5PA 2G45A 4XI1A 5H1UA 3HTKC 2L80A 2Y1MA 1RMDA 3O33A 5C13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNG A;  1WEO A;  3NG2 A;  2MT5 A;  4YC9 A;  2G6Q A;  5TDR A;  4YBM A;  2KWN A;  3O7A A;  4YBS A;  4AVX A;  1JM7 B;  5H1T A;  3U5N A;  3ZNI A;  1WEV A;  4IC2 A;  4Q6F A;  4V3L C;  2LGK A;  5J3X A;  4A49 A;  5AIU A;  4AYC B;  2MNZ A;  5LKU A;  1JM7 A;  2LV9 A;  1Z2Q A;  4N4F A;  5FB1 A;  3KV6 A;  5B78 A;  3MHH A;  2M3H A;  4UP0 A;  4AYC A;  2F6J A;  4ZQL A;  2CSZ A;  4MVT A;  3N9O A;  3ASL A;  3VK6 A;  4TKP B;  3L1Z B;  4PTB A;  1MM2 A;  3L1X A;  4YBT A;  4I7D A;  4QF3 A;  3U5O A;  2ECW A;  2PNX A;  2YQM A;  4WZ0 A;  1LDJ B;  1CHC A;  2LGG A;  5D1M B;  3RPG B;  2D8S A;  2C2V S;  3ZVY A;  4GNF A;  2IDA A;  2VPD A;  3EB5 A;  1FP0 A;  2C2L A;  3FL2 A;  4LKA A;  4YAB A;  2KIZ A;  2LRI C;  2LXH C;  5G0F A;  2Y43 A;  4BBQ A;  4A0C D;  1Z6U A;  1XWH A;  5TAB A;  4N3W A;  3LRQ A;  3O70 A;  4LAD B;  1WFK A;  2Y1N A;  3O37 A;  1X4J A;  5C11 A;  4F52 B;  4R8P K;  3GV4 A;  2K16 A;  2EGP A;  2OXQ C;  5EYA F;  3RPG C;  3HCT A;  2MD8 C;  2MIQ A;  2LQ6 A;  1ZBD B;  2KGI A;  1WIL A;  2M1R A;  2NAA A;  4FO9 A;  4UP5 A;  2L43 A;  3U5M A;  5B8D A;  4X3G A;  4LJN A;  2HYE D;  2G43 A;  3HCS A;  2YW8 A;  2YRE A;  2KR4 A;  4CA1 A;  4A4C A;  5LCW B;  5DIN A;  3O35 A;  4I7C A;  3QZV A;  2K1J A;  3SOW A;  1U6G B;  2FUU A;  2L5U A;  1WES A;  1LDK C;  5LKZ A;  2PUY A;  4L58 A;  4P5O B;  3LQH A;  2VPG A;  2FUI A;  2LGL A;  2JMD A;  2ZET C;  2KGG A;  3EB6 A;  5G05 B;  4PPE A;  4WZ2 A;  2YU4 A;  4AUQ B;  3KV5 A;  2RSD A;  3N9P A;  3KNV A;  2KWK A;  5AIT A;  1VD4 A;  1K2F A;  2MA6 A;  4GND A;  1E4U A;  1JOC A;  1G25 A;  3DPL R;  3T6R A;  2EA6 A;  2H0D A;  2QIC A;  1F62 A;  5TDW A;  2CT2 A;  5B79 A;  2I50 A;  2KU3 A;  5TRB A;  1WGM A;  3SOX A;  2YSJ A;  1X4U A;  2F6N A;  2XB1 A;  1WEM A;  4ZDT A;  3T7L A;  2VJE B;  2KE1 A;  5I3L A;  2K4D A;  2M6M A;  2ECT A;  2KRE A;  2KYU A;  3ZPV 1;  5JG6 A;  3N9L A;  5H1V A;  3KQI A;  3LQJ A;  2VJE A;  3O36 A;  2YYR A;  1IYM A;  3GL6 A;  1WEP A;  1N87 A;  5FEY A;  5KH9 A;  4NN2 A;  4LK9 A;  1FBV A;  5G04 B;  5B76 A;  4UI9 B;  2K17 A;  5H9M A;  5D1L B;  4FJC A;  2JMI A;  4FIP A;  3I2D A;  2LDR A;  4I7B A;  2YSM A;  1MM3 A;  1T1H A;  4R2Y A;  2YHO A;  2VPB A;  3PHD A;  2AN6 A;  2CSY A;  1HYJ A;  3O34 A;  4QF2 A;  2ECJ A;  2VJF B;  4R7E A;  2ECV A;  3ZPV E;  2CKL B;  5B75 A;  4FK5 A;  4WZ3 B;  2FSA A;  3M63 A;  4BHW A;  3ZVZ B;  2VJF A;  1WE9 A;  1HYI A;  5KH3 A;  3HCU A;  1WEQ A;  3DQV R;  4O64 A;  2CKL A;  5B77 A;  3SHB A;  3V43 A;  2ECI A;  2UZG A;  5FB0 A;  2LN0 A;  5LKT A;  3LQI A;  3RTR B;  2JRJ A;  2RI7 A;  2YUC A;  2YT5 A;  4S3O B;  2QIZ A;  4YAX A;  2MD7 B;  2H0D B;  2MA5 A;  5KH7 A;  1WEW A;  1WEN A;  2VPE A;  2MUM A;  1V87 A;  4IC3 A;  2ECN A;  2F42 A;  3MHS A;  2HDP A;  3L11 A;  4L7X A;  3C6W A;  3M62 A;  1X4I A;  2KWJ A;  2ECG A;  4AP4 A;  2L75 A;  2QJ0 A;  4GNE A;  4WA6 A;  4S3O C;  1WEE A;  3ZTG A;  2KWO A;  4B7Y C;  4YAD A;  2LGV A;  4ZUX U;  4CCG X;  2DX8 A;  2YQL A;  5FER A;  2M85 A;  1Z60 A;  5LKX A;  4W4U A;  2E6R A;  4A4B A;  2VNF A;  2YHN A;  2EOD A;  5DKA A;  3ZYQ A;  5TBN A;  1WEU A;  3N9M A;  2YUR A;  3C5K A;  2E6S A;  3PUQ A;  1BOR A;  4MSX A;  2BAY A;  2MNY A;  3PUR A;  3M99 A;  2VP7 A;  1DVP A;  1WIM A;  3N9Q A;  2JMJ A;  4V3K C;  1VFY A;  4LLB A;  2LXP C;  3N9N A;  1VYX A;  2KFT A;  2XEU A;  4C9Z A;  4B86 C;  4YAT A;  2L0B A;  5D1K B;  4GB0 A;  3IHP A;  3SOU A;  3U5P A;  2G45 A;  4XI1 A;  5H1U A;  3HTK C;  2L80 A;  2Y1M A;  1RMD A;  3O33 A;  5C13 A; 
#chains in the Genus database with same CATH topology
 4GNG A;  1WEO A;  4Z0R A;  3NG2 A;  2MT5 A;  4YC9 A;  2G6Q A;  5SVX A;  5TDR A;  4YBM A;  4Z0O A;  2KWN A;  3O7A A;  4YBS A;  4AVX A;  1JM7 B;  2M13 A;  2L7P A;  5H1T A;  3U5N A;  3ZNI A;  1WEV A;  4IC2 A;  4Q6F A;  4V3L C;  2LGK A;  3LJU X;  5J3X A;  3FAO A;  4A49 A;  5AIU A;  3LVQ E;  2XP0 A;  4AYC B;  2MNZ A;  5LKU A;  1JM7 A;  2LV9 A;  1Z2Q A;  4N4F A;  5FB1 A;  3KV6 A;  4O62 A;  5B78 A;  3MHH A;  2M3H A;  4UP0 A;  4AYC A;  2F6J A;  4ZQL A;  2CSZ A;  4MVT A;  3N9O A;  3ASL A;  3VK6 A;  4TKP B;  3L1Z B;  4PTB A;  1MM2 A;  3L1X A;  4YBT A;  4I7D A;  4QQ4 A;  4QF3 A;  3U5O A;  2ECW A;  2PNX A;  2YQM A;  3FJU B;  4WZ0 A;  2E61 A;  1LDJ B;  1CHC A;  2LGG A;  5D1M B;  3RPG B;  2D8S A;  2C2V S;  3ZVY A;  2B0O E;  4GNF A;  2IDA A;  2VPD A;  3EB5 A;  1FP0 A;  2C2L A;  3FL2 A;  4LKA A;  4YAB A;  2KIZ A;  2LRI C;  2LXH C;  2XOC A;  5G0F A;  2Y43 A;  4BBQ A;  4A0C D;  1Z6U A;  1XWH A;  5TAB A;  4N3W A;  3LRQ A;  3O70 A;  4LAD B;  1WFK A;  2Y1N A;  3O37 A;  1X4J A;  5C11 A;  2XOZ A;  4F52 B;  4R8P K;  3GV4 A;  3DDT A;  2K16 A;  2EGP A;  2OXQ C;  5EYA F;  3RPG C;  5SVI B;  3HCT A;  2MD8 C;  2MIQ A;  2DSM A;  2LQ6 A;  1ZBD B;  2KGI A;  1WIL A;  2M1R A;  3FAN A;  3H7H A;  2NAA A;  4FO9 A;  4UP5 A;  2L43 A;  5SVI A;  3U5M A;  5B8D A;  4X3G A;  4LJN A;  2HYE D;  2G43 A;  3HCS A;  2YW8 A;  2YRE A;  2KR4 A;  4CA1 A;  4A4C A;  5LCW B;  5DIN A;  3Q1D A;  3LVR E;  3O35 A;  4I7C A;  3QZV A;  2K1J A;  3SOW A;  1U6G B;  2FUU A;  2L5U A;  1WES A;  1LDK C;  5LKZ A;  2PUY A;  4L58 A;  3PLW A;  4OGE A;  2YVR A;  4P5O B;  3LQH A;  2VPG A;  2FUI A;  2LGL A;  2JMD A;  2ZET C;  4H9D A;  2FFW A;  2XOY A;  2KGG A;  3EB6 A;  5G05 B;  4OGC A;  2EXU A;  4PPE A;  4WZ2 A;  2YU4 A;  4AUQ B;  3KV5 A;  2D8U A;  2RSD A;  3DWD A;  2FD4 A;  3N9P A;  3KNV A;  2KWK A;  5AIT A;  1VD4 A;  1K2F A;  2MA6 A;  4GND A;  1E4U A;  1JOC A;  1G25 A;  2DJA A;  3DPL R;  3T6R A;  2EA6 A;  2CSV A;  2H0D A;  2QIC A;  1F62 A;  5TDW A;  2CT2 A;  5B79 A;  2I50 A;  2KU3 A;  5TRB A;  1WGM A;  3SOX A;  2YSJ A;  3JUE A;  1X4U A;  2F6N A;  2XB1 A;  1WEM A;  4ZDT A;  3T7L A;  2VJE B;  2KE1 A;  5I3L A;  2K4D A;  2M6M A;  2ECT A;  2KRE A;  2KYU A;  3ZPV 1;  2CRR A;  5JG6 A;  3N9L A;  5H1V A;  3KQI A;  3LQJ A;  3LDY A;  2VJE A;  2CRW A;  2YYR A;  3O36 A;  1IYM A;  3GL6 A;  1WEP A;  1N87 A;  5FEY A;  5KH9 A;  4NN2 A;  4LK9 A;  1FBV A;  5G04 B;  5B76 A;  4UI9 B;  2K17 A;  5H9M A;  5D1L B;  4FJC A;  4F1P A;  2JMI A;  4FIP A;  3O47 A;  3I2D A;  2LDR A;  3FEH A;  4I7B A;  2IQJ A;  2YSM A;  1MM3 A;  1T1H A;  2P57 A;  4R2Y A;  2YHO A;  2VPB A;  3PHD A;  2AN6 A;  2CSY A;  1HYJ A;  3E2D A;  3O34 A;  4QF2 A;  2ECJ A;  2VJF B;  4R7E A;  3FM8 C;  2ECV A;  3ZPV E;  2OWA A;  2CKL B;  5B75 A;  4FK5 A;  4WZ3 B;  2FSA A;  3M63 A;  4BHW A;  3MDB C;  3ZVZ B;  2VJF A;  1WE9 A;  1HYI A;  5KH3 A;  3HCU A;  1WEQ A;  3DQV R;  4O64 A;  2CKL A;  5B77 A;  3SHB A;  3V43 A;  5K3Q A;  2ECI A;  2UZG A;  5FB0 A;  2RR4 A;  2LN0 A;  5LKT A;  3LQI A;  2JUN A;  3RTR B;  2JRJ A;  2RI7 A;  2YUC A;  2YT5 A;  4S3O B;  2QIZ A;  4YAX A;  2MD7 B;  2H0D B;  2MA5 A;  5KH7 A;  1WEW A;  1WEN A;  2VPE A;  2MUM A;  1V87 A;  3SUB A;  4IC3 A;  2ECN A;  2F42 A;  3MHS A;  2HDP A;  3L11 A;  4L7X A;  2LAU A;  3C6W A;  3M62 A;  1X4I A;  2KWJ A;  2ECG A;  4AP4 A;  2L75 A;  2QJ0 A;  4GNE A;  4WA6 A;  4S3O C;  1WEE A;  3ZTG A;  2KWO A;  4B7Y C;  4YAD A;  2LGV A;  4ZUX U;  4CCG X;  2DX8 A;  1DCQ A;  2YQL A;  5FER A;  2M85 A;  1Z60 A;  5LKX A;  4W4U A;  2E6R A;  2MKE A;  4A4B A;  2VNF A;  2YHN A;  2EOD A;  5DKA A;  3ZYQ A;  5TBN A;  2EGM A;  1WEU A;  3N9M A;  2YUR A;  3M7K A;  3C5K A;  2E6S A;  3T9K A;  3PUQ A;  1BOR A;  2KKY A;  4MSX A;  2BAY A;  2MNY A;  3PUR A;  3M99 A;  2VP7 A;  1DVP A;  1WIM A;  3N9Q A;  2JMJ A;  4V3K C;  1VFY A;  4LLB A;  2LXP C;  3N9N A;  1VYX A;  2KFT A;  2XEU A;  4C9Z A;  4B86 C;  4YAT A;  2L0B A;  5D1K B;  4GB0 A;  5SVY A;  3IHP A;  3SOU A;  2CON A;  3U5P A;  2G45 A;  2JM3 A;  4XI1 A;  5H1U A;  1MBM A;  3HTK C;  2L80 A;  2Y1M A;  1RMD A;  2KKX A;  3O33 A;  3KDE C;  5C13 A; 
#chains in the Genus database with same CATH homology
 4GNG A;  1WEO A;  3NG2 A;  2MT5 A;  4YC9 A;  2G6Q A;  5TDR A;  4YBM A;  2KWN A;  3O7A A;  4YBS A;  4AVX A;  1JM7 B;  5H1T A;  3U5N A;  3ZNI A;  1WEV A;  4IC2 A;  4Q6F A;  4V3L C;  2LGK A;  5J3X A;  4A49 A;  5AIU A;  4AYC B;  2MNZ A;  5LKU A;  1JM7 A;  2LV9 A;  1Z2Q A;  4N4F A;  5FB1 A;  3KV6 A;  5B78 A;  3MHH A;  2M3H A;  4UP0 A;  4AYC A;  2F6J A;  4ZQL A;  2CSZ A;  4MVT A;  3N9O A;  3ASL A;  3VK6 A;  4TKP B;  3L1Z B;  4PTB A;  1MM2 A;  3L1X A;  4YBT A;  4I7D A;  4QF3 A;  3U5O A;  2ECW A;  2PNX A;  2YQM A;  4WZ0 A;  1LDJ B;  1CHC A;  2LGG A;  5D1M B;  3RPG B;  2D8S A;  2C2V S;  3ZVY A;  4GNF A;  2IDA A;  2VPD A;  3EB5 A;  1FP0 A;  2C2L A;  3FL2 A;  4LKA A;  4YAB A;  2KIZ A;  2LRI C;  2LXH C;  5G0F A;  2Y43 A;  4BBQ A;  4A0C D;  1Z6U A;  1XWH A;  5TAB A;  4N3W A;  3LRQ A;  3O70 A;  4LAD B;  1WFK A;  2Y1N A;  3O37 A;  1X4J A;  5C11 A;  4F52 B;  4R8P K;  3GV4 A;  2K16 A;  2EGP A;  2OXQ C;  5EYA F;  3RPG C;  3HCT A;  2MD8 C;  2MIQ A;  2LQ6 A;  1ZBD B;  2KGI A;  1WIL A;  2M1R A;  2NAA A;  4FO9 A;  4UP5 A;  2L43 A;  3U5M A;  5B8D A;  4X3G A;  4LJN A;  2HYE D;  2G43 A;  3HCS A;  2YW8 A;  2YRE A;  2KR4 A;  4CA1 A;  4A4C A;  5LCW B;  5DIN A;  3O35 A;  4I7C A;  3QZV A;  2K1J A;  3SOW A;  1U6G B;  2FUU A;  2L5U A;  1WES A;  1LDK C;  5LKZ A;  2PUY A;  4L58 A;  4P5O B;  3LQH A;  2VPG A;  2FUI A;  2LGL A;  2JMD A;  2ZET C;  2KGG A;  3EB6 A;  5G05 B;  4PPE A;  4WZ2 A;  2YU4 A;  4AUQ B;  3KV5 A;  2RSD A;  3N9P A;  3KNV A;  2KWK A;  5AIT A;  1VD4 A;  1K2F A;  2MA6 A;  4GND A;  1E4U A;  1JOC A;  1G25 A;  3DPL R;  3T6R A;  2EA6 A;  2H0D A;  2QIC A;  1F62 A;  5TDW A;  2CT2 A;  5B79 A;  2I50 A;  2KU3 A;  5TRB A;  1WGM A;  3SOX A;  2YSJ A;  1X4U A;  2F6N A;  2XB1 A;  1WEM A;  4ZDT A;  3T7L A;  2VJE B;  2KE1 A;  5I3L A;  2K4D A;  2M6M A;  2ECT A;  2KRE A;  2KYU A;  3ZPV 1;  5JG6 A;  3N9L A;  5H1V A;  3KQI A;  3LQJ A;  2VJE A;  3O36 A;  2YYR A;  1IYM A;  3GL6 A;  1WEP A;  1N87 A;  5FEY A;  5KH9 A;  4NN2 A;  4LK9 A;  1FBV A;  5G04 B;  5B76 A;  4UI9 B;  2K17 A;  5H9M A;  5D1L B;  4FJC A;  2JMI A;  4FIP A;  3I2D A;  2LDR A;  4I7B A;  2YSM A;  1MM3 A;  1T1H A;  4R2Y A;  2YHO A;  2VPB A;  3PHD A;  2AN6 A;  2CSY A;  1HYJ A;  3O34 A;  4QF2 A;  2ECJ A;  2VJF B;  4R7E A;  2ECV A;  3ZPV E;  2CKL B;  5B75 A;  4FK5 A;  4WZ3 B;  2FSA A;  3M63 A;  4BHW A;  3ZVZ B;  2VJF A;  1WE9 A;  1HYI A;  5KH3 A;  3HCU A;  1WEQ A;  3DQV R;  4O64 A;  2CKL A;  5B77 A;  3SHB A;  3V43 A;  2ECI A;  2UZG A;  5FB0 A;  2LN0 A;  5LKT A;  3LQI A;  3RTR B;  2JRJ A;  2RI7 A;  2YUC A;  2YT5 A;  4S3O B;  2QIZ A;  4YAX A;  2MD7 B;  2H0D B;  2MA5 A;  5KH7 A;  1WEW A;  1WEN A;  2VPE A;  2MUM A;  1V87 A;  4IC3 A;  2ECN A;  2F42 A;  3MHS A;  2HDP A;  3L11 A;  4L7X A;  3C6W A;  3M62 A;  1X4I A;  2KWJ A;  2ECG A;  4AP4 A;  2L75 A;  2QJ0 A;  4GNE A;  4WA6 A;  4S3O C;  1WEE A;  3ZTG A;  2KWO A;  4B7Y C;  4YAD A;  2LGV A;  4ZUX U;  4CCG X;  2DX8 A;  2YQL A;  5FER A;  2M85 A;  1Z60 A;  5LKX A;  4W4U A;  2E6R A;  4A4B A;  2VNF A;  2YHN A;  2EOD A;  5DKA A;  3ZYQ A;  5TBN A;  1WEU A;  3N9M A;  2YUR A;  3C5K A;  2E6S A;  3PUQ A;  1BOR A;  4MSX A;  2BAY A;  2MNY A;  3PUR A;  3M99 A;  2VP7 A;  1DVP A;  1WIM A;  3N9Q A;  2JMJ A;  4V3K C;  1VFY A;  4LLB A;  2LXP C;  3N9N A;  1VYX A;  2KFT A;  2XEU A;  4C9Z A;  4B86 C;  4YAT A;  2L0B A;  5D1K B;  4GB0 A;  3IHP A;  3SOU A;  3U5P A;  2G45 A;  4XI1 A;  5H1U A;  3HTK C;  2L80 A;  2Y1M A;  1RMD A;  3O33 A;  5C13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...