1VFYA

Phosphatidylinositol-3-phosphate binding fyve domain of vps27p protein from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
DWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFEDYEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords PHOSPHATIDYLINOSITOL-3-PHOSPHATE BINDING FYVE DOMAIN OF PROT
publication title Crystal structure of a phosphatidylinositol 3-phosphate-specific membrane-targeting motif, the FYVE domain of Vps27p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1999-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vfyA00
1WEEA 4LADB 3RPGB 3O37A 2C2LA 3M99A 4R8PK 4O64A 3C6WA 2XB1A 5AIUA 1WESA 1JM7B 4YC9A 3L1ZB 4TKPB 2ZETC 3M62A 4A4CA 1MM2A 5B76A 2ECGA 2CKLA 1WEQA 4AUQB 5B78A 2VPDA 2YHNA 4YBMA 1WFKA 3U5PA 3LQHA 3ZPV1 4I7BA 3V43A 4C9ZA 2YQMA 3PHDA 2MIQA 5LKXA 5G0FA 2VJEB 1G25A 3O70A 2ECTA 2CSZA 4QF3A 5H1VA 3I2DA 2KYUA 3N9OA 3ZNIA 4L58A 3L1XA 2LGKA 1E4UA 3O36A 2C2VS 2KFTA 3M63A 2M85A 1Z6UA 3GL6A 4WZ0A 1K2FA 3GV4A 3N9LA 4FO9A 5LKZA 3RPGC 2PNXA 2KREA 3C5KA 4A0CD 2NAAA 4I7CA 5TABA 4BHWA 5H1UA 2RSDA 4W4UA 2VPGA 2Y1MA 4YATA 3U5OA 4GNGA 3KV5A 2F6NA 3LQJA 4GB0A 1X4UA 4LK9A 5KH9A 4UI9B 2L5UA 4GNFA 2VJEA 4N3WA 2LXHC 2E6RA 2LXPC 2LN0A 2K4DA 1N87A 4LKAA 3NG2A 3VK6A 2YUCA 3HCSA 3QZVA 2JRJA 3PURA 1CHCA 4AVXA 3LRQA 4S3OC 2JMJA 4MVTA 4CA1A 3N9PA 1WEOA 2G6QA 1BORA 4NN2A 5FB1A 2FUUA 2L80A 2G43A 2DX8A 3PUQA 2YHOA 5C11A 2OXQC 4I7DA 2F6JA 5B79A 5DINA 2ECWA 3SHBA 3SOXA 1F62A 1Z60A 3U5MA 2IDAA 2LDRA 2YQLA 2RI7A 2EGPA 4A4BA 1X4JA 2FSAA 4S3OB 2LGGA 3EB5A 3HTKC 2K17A 1WEUA 2BAYA 1HYJA 1T1HA 5H9MA 4R2YA 2MNYA 2QJ0A 1WILA 3O7AA 5H1TA 4BBQA 2CT2A 1RMDA 5C13A 3DPLR 3LQIA 3N9QA 4A49A 4CCGX 2HDPA 5AITA 3DQVR 2VP7A 2EA6A 4UP0A 1WGMA 2AN6A 2KR4A 5G05B 5LKTA 2XEUA 2YSMA 1V87A 3HCUA 3HCTA 5I3LA 1VYXA 5JG6A 1VD4A 3ZYQA 1XWHA 1X4IA 2HYED 2YSJA 2I50A 4V3LC 2LV9A 2Y1NA 2MT5A 2LGLA 2EODA 2QIZA 2D8SA 4LJNA 2YURA 1WE9A 4ZUXU 4YAXA 5TDRA 4ZQLA 5TBNA 5KH3A 2L75A 1FBVA 4FK5A 1FP0A 2JMIA 2LQ6A 4F52B 2KIZA 3O33A 2ECVA 5FERA 1VFYA 3T7LA 5TRBA 1ZBDB 4P5OB 4QF2A 1WENA 1IYMA 2MA6A 2MNZA 2K1JA 4GNDA 4YBTA 4IC2A 5J3XA 3L11A 5KH7A 4WZ3B 1LDKC 3KV6A 5D1KB 2LRIC 5B75A 3T6RA 4IC3A 2ECIA 2KWKA 3KNVA 1WIMA 4X3GA 2FUIA 4L7XA 3FL2A 5FB0A 2QICA 3EB6A 4FJCA 2VJFB 3U5NA 4B86C 3ZVYA 2UZGA 2E6SA 3O35A 4AYCB 1HYIA 4UP5A 2KWJA 1WEMA 4YBSA 5D1LB 2VPEA 2M6MA 2LGVA 4MSXA 4N4FA 4FIPA 1WEWA 3MHHA 3IHPA 3SOWA 2KE1A 4Q6FA 4XI1A 3ASLA 2MD8C 1MM3A 2H0DB 2YU4A 1Z2QA 2G45A 4B7YC 1U6GB 2F42A 4WA6A 2ECJA 2KGIA 2K16A 2M1RA 4WZ2A 2KGGA 2MD7B 1JOCA 2YYRA 5LCWB 3SOUA 5LKUA 2ECNA 3ZPVE 4ZDTA 3O34A 4PPEA 1JM7A 2PUYA 2KWNA 5DKAA 4YADA 2VNFA 2VJFA 2L0BA 4GNEA 2MA5A 2L43A 2CSYA 4AYCA 2KU3A 4YABA 4LLBA 3RTRB 5FEYA 3ZVZB 1WEPA 2CKLB 2YT5A 3N9MA 3KQIA 5B77A 4V3KC 1WEVA 5G04B 2KWOA 4PTBA 2MUMA 3MHSA 2H0DA 1DVPA 2YREA 2VPBA 5D1MB 1LDJB 4AP4A 5B8DA 2YW8A 3N9NA 3ZTGA 5EYAF 2M3HA 2Y43A 5TDWA 4R7EA 2JMDA
chains in the Genus database with same CATH superfamily
1WEEA 4LADB 3RPGB 3O37A 2C2LA 3M99A 2EXUA 4R8PK 4O64A 3DDTA 3C6WA 2XB1A 5AIUA 1WESA 1JM7B 4YC9A 3L1ZB 4TKPB 2ZETC 3M62A 4A4CA 1MM2A 5B76A 2ECGA 2CKLA 1WEQA 4AUQB 5B78A 2VPDA 2YHNA 2JUNA 4YBMA 1WFKA 3U5PA 3LQHA 3ZPV1 4I7BA 3V43A 1DCQA 4C9ZA 3MDBC 2M13A 2XOZA 2YQMA 3PHDA 2MIQA 5LKXA 5G0FA 2FFWA 2VJEB 1G25A 3O70A 2ECTA 2CSZA 4QF3A 5H1VA 3I2DA 2KYUA 3N9OA 3ZNIA 4L58A 3L1XA 2DSMA 2LGKA 1E4UA 3O36A 2C2VS 2KFTA 3Q1DA 3M63A 2M85A 1Z6UA 3GL6A 4WZ0A 1K2FA 3GV4A 3N9LA 3E2DA 4FO9A 4O62A 5LKZA 3RPGC 2PNXA 2KREA 3C5KA 4A0CD 2NAAA 4I7CA 5TABA 4BHWA 5H1UA 2RSDA 4W4UA 2VPGA 2Y1MA 2RR4A 4YATA 3U5OA 4GNGA 3KV5A 2F6NA 3LQJA 4GB0A 1X4UA 4LK9A 5KH9A 4UI9B 2L5UA 4GNFA 2VJEA 4N3WA 2LXHC 2E6RA 2LXPC 2LN0A 4OGCA 2KKYA 2K4DA 1N87A 4LKAA 3DWDA 3NG2A 3VK6A 5SVXA 3JUEA 2YUCA 3HCSA 3QZVA 2JRJA 3PURA 1CHCA 4AVXA 2XOCA 3LRQA 2D8UA 4S3OC 3FEHA 2JMJA 4MVTA 3FANA 4CA1A 3N9PA 1WEOA 2G6QA 1BORA 4NN2A 5FB1A 2FUUA 2L80A 2G43A 2DX8A 3PUQA 2YHOA 2DJAA 2OWAA 5C11A 4OGEA 2OXQC 4I7DA 2F6JA 5B79A 5DINA 2ECWA 3SHBA 3SOXA 1F62A 1Z60A 2IQJA 3U5MA 2CRWA 2IDAA 2LDRA 2YQLA 3LVRE 2CRRA 2RI7A 2EGPA 4A4BA 1X4JA 2FSAA 4S3OB 2LGGA 3EB5A 1MBMA 3HTKC 2K17A 1WEUA 2BAYA 1HYJA 1T1HA 4R2YA 5H9MA 2MNYA 2QJ0A 1WILA 3O7AA 5H1TA 4BBQA 2CT2A 2YVRA 1RMDA 5C13A 3DPLR 3LQIA 3N9QA 4A49A 4CCGX 2HDPA 5AITA 3DQVR 3FM8C 2VP7A 2EA6A 4UP0A 1WGMA 2AN6A 2KR4A 5G05B 3KDEC 5LKTA 2XEUA 2YSMA 1V87A 3HCUA 3HCTA 4F1PA 5I3LA 5SVIB 1VYXA 5JG6A 1VD4A 3ZYQA 1XWHA 1X4IA 2HYED 2YSJA 2I50A 3LVQE 4V3LC 2LV9A 2Y1NA 2MT5A 2LGLA 2EODA 2QIZA 2D8SA 4LJNA 2YURA 1WE9A 4Z0OA 4ZUXU 4YAXA 5TDRA 4ZQLA 5TBNA 5KH3A 2L75A 1FBVA 3LDYA 4FK5A 3H7HA 1FP0A 2JMIA 2LQ6A 4F52B 2KIZA 3O33A 2ECVA 2XP0A 5FERA 3FAOA 4QQ4A 3FJUB 1VFYA 3T7LA 5TRBA 1ZBDB 4P5OB 4QF2A 1WENA 2CONA 2MA6A 2MNZA 1IYMA 2K1JA 4GNDA 4YBTA 4IC2A 5J3XA 3L11A 5KH7A 4WZ3B 1LDKC 3KV6A 5D1KB 2LRIC 3LJUX 5B75A 5SVIA 3T6RA 3M7KA 3SUBA 4IC3A 2ECIA 2KWKA 3KNVA 1WIMA 2E61A 4X3GA 2FUIA 4L7XA 3FL2A 2JM3A 5FB0A 2QICA 3EB6A 4FJCA 2EGMA 2VJFB 3U5NA 4B86C 3ZVYA 2UZGA 2E6SA 3O35A 4AYCB 1HYIA 4UP5A 5K3QA 2L7PA 2KWJA 1WEMA 2MKEA 4YBSA 5D1LB 2VPEA 2M6MA 2LGVA 4MSXA 4N4FA 4FIPA 1WEWA 3MHHA 3IHPA 3SOWA 2KE1A 4Q6FA 4XI1A 3ASLA 2MD8C 1MM3A 2H0DB 2YU4A 1Z2QA 2G45A 4B7YC 5SVYA 1U6GB 4H9DA 2F42A 4WA6A 2ECJA 2KGIA 2K16A 2M1RA 4WZ2A 2KGGA 2MD7B 1JOCA 2YYRA 5LCWB 3SOUA 5LKUA 2ECNA 3ZPVE 4ZDTA 3PLWA 3O34A 4PPEA 1JM7A 2PUYA 2KWNA 5DKAA 4YADA 2VNFA 2VJFA 2XOYA 2L0BA 4GNEA 2B0OE 2MA5A 2L43A 2CSYA 3O47A 4Z0RA 4AYCA 2KU3A 4YABA 4LLBA 3RTRB 5FEYA 3ZVZB 1WEPA 2CKLB 2LAUA 2YT5A 3N9MA 3KQIA 5B77A 4V3KC 1WEVA 5G04B 2KWOA 2CSVA 4PTBA 2MUMA 2KKXA 3MHSA 2H0DA 1DVPA 2YREA 2VPBA 5D1MB 1LDJB 3T9KA 4AP4A 5B8DA 2YW8A 3N9NA 3ZTGA 5EYAF 2M3HA 2P57A 2Y43A 5TDWA 2FD4A 4R7EA 2JMDA
chains in the Genus database with same CATH topology
1WEEA 4LADB 3RPGB 3O37A 2C2LA 3M99A 4R8PK 4O64A 3C6WA 2XB1A 5AIUA 1WESA 1JM7B 4YC9A 3L1ZB 4TKPB 2ZETC 3M62A 4A4CA 1MM2A 5B76A 2ECGA 2CKLA 1WEQA 4AUQB 5B78A 2VPDA 2YHNA 4YBMA 1WFKA 3U5PA 3LQHA 3ZPV1 4I7BA 3V43A 4C9ZA 2YQMA 3PHDA 2MIQA 5LKXA 5G0FA 2VJEB 1G25A 3O70A 2ECTA 2CSZA 4QF3A 5H1VA 3I2DA 2KYUA 3N9OA 3ZNIA 4L58A 3L1XA 2LGKA 1E4UA 3O36A 2C2VS 2KFTA 3M63A 2M85A 1Z6UA 3GL6A 4WZ0A 1K2FA 3GV4A 3N9LA 4FO9A 5LKZA 3RPGC 2PNXA 2KREA 3C5KA 4A0CD 2NAAA 4I7CA 5TABA 4BHWA 5H1UA 2RSDA 4W4UA 2VPGA 2Y1MA 4YATA 3U5OA 4GNGA 3KV5A 2F6NA 3LQJA 4GB0A 1X4UA 4LK9A 5KH9A 4UI9B 2L5UA 4GNFA 2VJEA 4N3WA 2LXHC 2E6RA 2LXPC 2LN0A 2K4DA 1N87A 4LKAA 3NG2A 3VK6A 2YUCA 3HCSA 3QZVA 2JRJA 3PURA 1CHCA 4AVXA 3LRQA 4S3OC 2JMJA 4MVTA 4CA1A 3N9PA 1WEOA 2G6QA 1BORA 4NN2A 5FB1A 2FUUA 2L80A 2G43A 2DX8A 3PUQA 2YHOA 5C11A 2OXQC 4I7DA 2F6JA 5B79A 5DINA 2ECWA 3SHBA 3SOXA 1F62A 1Z60A 3U5MA 2IDAA 2LDRA 2YQLA 2RI7A 2EGPA 4A4BA 1X4JA 2FSAA 4S3OB 2LGGA 3EB5A 3HTKC 2K17A 1WEUA 2BAYA 1HYJA 1T1HA 5H9MA 4R2YA 2MNYA 2QJ0A 1WILA 3O7AA 5H1TA 4BBQA 2CT2A 1RMDA 5C13A 3DPLR 3LQIA 3N9QA 4A49A 4CCGX 2HDPA 5AITA 3DQVR 2VP7A 2EA6A 4UP0A 1WGMA 2AN6A 2KR4A 5G05B 5LKTA 2XEUA 2YSMA 1V87A 3HCUA 3HCTA 5I3LA 1VYXA 5JG6A 1VD4A 3ZYQA 1XWHA 1X4IA 2HYED 2YSJA 2I50A 4V3LC 2LV9A 2Y1NA 2MT5A 2LGLA 2EODA 2QIZA 2D8SA 4LJNA 2YURA 1WE9A 4ZUXU 4YAXA 5TDRA 4ZQLA 5TBNA 5KH3A 2L75A 1FBVA 4FK5A 1FP0A 2JMIA 2LQ6A 4F52B 2KIZA 3O33A 2ECVA 5FERA 1VFYA 3T7LA 5TRBA 1ZBDB 4P5OB 4QF2A 1WENA 1IYMA 2MA6A 2MNZA 2K1JA 4GNDA 4YBTA 4IC2A 5J3XA 3L11A 5KH7A 4WZ3B 1LDKC 3KV6A 5D1KB 2LRIC 5B75A 3T6RA 4IC3A 2ECIA 2KWKA 3KNVA 1WIMA 4X3GA 2FUIA 4L7XA 3FL2A 5FB0A 2QICA 3EB6A 4FJCA 2VJFB 3U5NA 4B86C 3ZVYA 2UZGA 2E6SA 3O35A 4AYCB 1HYIA 4UP5A 2KWJA 1WEMA 4YBSA 5D1LB 2VPEA 2M6MA 2LGVA 4MSXA 4N4FA 4FIPA 1WEWA 3MHHA 3IHPA 3SOWA 2KE1A 4Q6FA 4XI1A 3ASLA 2MD8C 1MM3A 2H0DB 2YU4A 1Z2QA 2G45A 4B7YC 1U6GB 2F42A 4WA6A 2ECJA 2KGIA 2K16A 2M1RA 4WZ2A 2KGGA 2MD7B 1JOCA 2YYRA 5LCWB 3SOUA 5LKUA 2ECNA 3ZPVE 4ZDTA 3O34A 4PPEA 1JM7A 2PUYA 2KWNA 5DKAA 4YADA 2VNFA 2VJFA 2L0BA 4GNEA 2MA5A 2L43A 2CSYA 4AYCA 2KU3A 4YABA 4LLBA 3RTRB 5FEYA 3ZVZB 1WEPA 2CKLB 2YT5A 3N9MA 3KQIA 5B77A 4V3KC 1WEVA 5G04B 2KWOA 4PTBA 2MUMA 3MHSA 2H0DA 1DVPA 2YREA 2VPBA 5D1MB 1LDJB 4AP4A 5B8DA 2YW8A 3N9NA 3ZTGA 5EYAF 2M3HA 2Y43A 5TDWA 4R7EA 2JMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEE A;  4LAD B;  3RPG B;  3O37 A;  2C2L A;  3M99 A;  4R8P K;  4O64 A;  3C6W A;  2XB1 A;  5AIU A;  1WES A;  1JM7 B;  4YC9 A;  3L1Z B;  4TKP B;  2ZET C;  3M62 A;  4A4C A;  1MM2 A;  5B76 A;  2ECG A;  2CKL A;  1WEQ A;  4AUQ B;  5B78 A;  2VPD A;  2YHN A;  4YBM A;  1WFK A;  3U5P A;  3LQH A;  3ZPV 1;  4I7B A;  3V43 A;  4C9Z A;  2YQM A;  3PHD A;  2MIQ A;  5LKX A;  5G0F A;  2VJE B;  1G25 A;  3O70 A;  2ECT A;  2CSZ A;  4QF3 A;  5H1V A;  3I2D A;  2KYU A;  3N9O A;  3ZNI A;  4L58 A;  3L1X A;  2LGK A;  1E4U A;  3O36 A;  2C2V S;  2KFT A;  3M63 A;  2M85 A;  1Z6U A;  3GL6 A;  4WZ0 A;  1K2F A;  3GV4 A;  3N9L A;  4FO9 A;  5LKZ A;  3RPG C;  2PNX A;  2KRE A;  3C5K A;  4A0C D;  2NAA A;  4I7C A;  5TAB A;  4BHW A;  5H1U A;  2RSD A;  4W4U A;  2VPG A;  2Y1M A;  4YAT A;  3U5O A;  4GNG A;  3KV5 A;  2F6N A;  3LQJ A;  4GB0 A;  1X4U A;  4LK9 A;  5KH9 A;  4UI9 B;  2L5U A;  4GNF A;  2VJE A;  4N3W A;  2LXH C;  2E6R A;  2LXP C;  2LN0 A;  2K4D A;  1N87 A;  4LKA A;  3NG2 A;  3VK6 A;  2YUC A;  3HCS A;  3QZV A;  2JRJ A;  3PUR A;  1CHC A;  4AVX A;  3LRQ A;  4S3O C;  2JMJ A;  4MVT A;  4CA1 A;  3N9P A;  1WEO A;  2G6Q A;  1BOR A;  4NN2 A;  5FB1 A;  2FUU A;  2L80 A;  2G43 A;  2DX8 A;  3PUQ A;  2YHO A;  5C11 A;  2OXQ C;  4I7D A;  2F6J A;  5B79 A;  5DIN A;  2ECW A;  3SHB A;  3SOX A;  1F62 A;  1Z60 A;  3U5M A;  2IDA A;  2LDR A;  2YQL A;  2RI7 A;  2EGP A;  4A4B A;  1X4J A;  2FSA A;  4S3O B;  2LGG A;  3EB5 A;  3HTK C;  2K17 A;  1WEU A;  2BAY A;  1HYJ A;  1T1H A;  5H9M A;  4R2Y A;  2MNY A;  2QJ0 A;  1WIL A;  3O7A A;  5H1T A;  4BBQ A;  2CT2 A;  1RMD A;  5C13 A;  3DPL R;  3LQI A;  3N9Q A;  4A49 A;  4CCG X;  2HDP A;  5AIT A;  3DQV R;  2VP7 A;  2EA6 A;  4UP0 A;  1WGM A;  2AN6 A;  2KR4 A;  5G05 B;  5LKT A;  2XEU A;  2YSM A;  1V87 A;  3HCU A;  3HCT A;  5I3L A;  1VYX A;  5JG6 A;  1VD4 A;  3ZYQ A;  1XWH A;  1X4I A;  2HYE D;  2YSJ A;  2I50 A;  4V3L C;  2LV9 A;  2Y1N A;  2MT5 A;  2LGL A;  2EOD A;  2QIZ A;  2D8S A;  4LJN A;  2YUR A;  1WE9 A;  4ZUX U;  4YAX A;  5TDR A;  4ZQL A;  5TBN A;  5KH3 A;  2L75 A;  1FBV A;  4FK5 A;  1FP0 A;  2JMI A;  2LQ6 A;  4F52 B;  2KIZ A;  3O33 A;  2ECV A;  5FER A;  1VFY A;  3T7L A;  5TRB A;  1ZBD B;  4P5O B;  4QF2 A;  1WEN A;  1IYM A;  2MA6 A;  2MNZ A;  2K1J A;  4GND A;  4YBT A;  4IC2 A;  5J3X A;  3L11 A;  5KH7 A;  4WZ3 B;  1LDK C;  3KV6 A;  5D1K B;  2LRI C;  5B75 A;  3T6R A;  4IC3 A;  2ECI A;  2KWK A;  3KNV A;  1WIM A;  4X3G A;  2FUI A;  4L7X A;  3FL2 A;  5FB0 A;  2QIC A;  3EB6 A;  4FJC A;  2VJF B;  3U5N A;  4B86 C;  3ZVY A;  2UZG A;  2E6S A;  3O35 A;  4AYC B;  1HYI A;  4UP5 A;  2KWJ A;  1WEM A;  4YBS A;  5D1L B;  2VPE A;  2M6M A;  2LGV A;  4MSX A;  4N4F A;  4FIP A;  1WEW A;  3MHH A;  3IHP A;  3SOW A;  2KE1 A;  4Q6F A;  4XI1 A;  3ASL A;  2MD8 C;  1MM3 A;  2H0D B;  2YU4 A;  1Z2Q A;  2G45 A;  4B7Y C;  1U6G B;  2F42 A;  4WA6 A;  2ECJ A;  2KGI A;  2K16 A;  2M1R A;  4WZ2 A;  2KGG A;  2MD7 B;  1JOC A;  2YYR A;  5LCW B;  3SOU A;  5LKU A;  2ECN A;  3ZPV E;  4ZDT A;  3O34 A;  4PPE A;  1JM7 A;  2PUY A;  2KWN A;  5DKA A;  4YAD A;  2VNF A;  2VJF A;  2L0B A;  4GNE A;  2MA5 A;  2L43 A;  2CSY A;  4AYC A;  2KU3 A;  4YAB A;  4LLB A;  3RTR B;  5FEY A;  3ZVZ B;  1WEP A;  2CKL B;  2YT5 A;  3N9M A;  3KQI A;  5B77 A;  4V3K C;  1WEV A;  5G04 B;  2KWO A;  4PTB A;  2MUM A;  3MHS A;  2H0D A;  1DVP A;  2YRE A;  2VPB A;  5D1M B;  1LDJ B;  4AP4 A;  5B8D A;  2YW8 A;  3N9N A;  3ZTG A;  5EYA F;  2M3H A;  2Y43 A;  5TDW A;  4R7E A;  2JMD A; 
#chains in the Genus database with same CATH topology
 1WEE A;  4LAD B;  3RPG B;  3O37 A;  2C2L A;  3M99 A;  2EXU A;  4R8P K;  4O64 A;  3DDT A;  3C6W A;  2XB1 A;  5AIU A;  1WES A;  1JM7 B;  4YC9 A;  3L1Z B;  4TKP B;  2ZET C;  3M62 A;  4A4C A;  1MM2 A;  5B76 A;  2ECG A;  2CKL A;  1WEQ A;  4AUQ B;  5B78 A;  2VPD A;  2YHN A;  2JUN A;  4YBM A;  1WFK A;  3U5P A;  3LQH A;  3ZPV 1;  4I7B A;  3V43 A;  1DCQ A;  4C9Z A;  3MDB C;  2M13 A;  2XOZ A;  2YQM A;  3PHD A;  2MIQ A;  5LKX A;  5G0F A;  2FFW A;  2VJE B;  1G25 A;  3O70 A;  2ECT A;  2CSZ A;  4QF3 A;  5H1V A;  3I2D A;  2KYU A;  3N9O A;  3ZNI A;  4L58 A;  3L1X A;  2DSM A;  2LGK A;  1E4U A;  3O36 A;  2C2V S;  2KFT A;  3Q1D A;  3M63 A;  2M85 A;  1Z6U A;  3GL6 A;  4WZ0 A;  1K2F A;  3GV4 A;  3N9L A;  3E2D A;  4FO9 A;  4O62 A;  5LKZ A;  3RPG C;  2PNX A;  2KRE A;  3C5K A;  4A0C D;  2NAA A;  4I7C A;  5TAB A;  4BHW A;  5H1U A;  2RSD A;  4W4U A;  2VPG A;  2Y1M A;  2RR4 A;  4YAT A;  3U5O A;  4GNG A;  3KV5 A;  2F6N A;  3LQJ A;  4GB0 A;  1X4U A;  4LK9 A;  5KH9 A;  4UI9 B;  2L5U A;  4GNF A;  2VJE A;  4N3W A;  2LXH C;  2E6R A;  2LXP C;  2LN0 A;  4OGC A;  2KKY A;  2K4D A;  1N87 A;  4LKA A;  3DWD A;  3NG2 A;  3VK6 A;  5SVX A;  3JUE A;  2YUC A;  3HCS A;  3QZV A;  2JRJ A;  3PUR A;  1CHC A;  4AVX A;  2XOC A;  3LRQ A;  2D8U A;  4S3O C;  3FEH A;  2JMJ A;  4MVT A;  3FAN A;  4CA1 A;  3N9P A;  1WEO A;  2G6Q A;  1BOR A;  4NN2 A;  5FB1 A;  2FUU A;  2L80 A;  2G43 A;  2DX8 A;  3PUQ A;  2YHO A;  2DJA A;  2OWA A;  5C11 A;  4OGE A;  2OXQ C;  4I7D A;  2F6J A;  5B79 A;  5DIN A;  2ECW A;  3SHB A;  3SOX A;  1F62 A;  1Z60 A;  2IQJ A;  3U5M A;  2CRW A;  2IDA A;  2LDR A;  2YQL A;  3LVR E;  2CRR A;  2RI7 A;  2EGP A;  4A4B A;  1X4J A;  2FSA A;  4S3O B;  2LGG A;  3EB5 A;  1MBM A;  3HTK C;  2K17 A;  1WEU A;  2BAY A;  1HYJ A;  1T1H A;  4R2Y A;  5H9M A;  2MNY A;  2QJ0 A;  1WIL A;  3O7A A;  5H1T A;  4BBQ A;  2CT2 A;  2YVR A;  1RMD A;  5C13 A;  3DPL R;  3LQI A;  3N9Q A;  4A49 A;  4CCG X;  2HDP A;  5AIT A;  3DQV R;  3FM8 C;  2VP7 A;  2EA6 A;  4UP0 A;  1WGM A;  2AN6 A;  2KR4 A;  5G05 B;  3KDE C;  5LKT A;  2XEU A;  2YSM A;  1V87 A;  3HCU A;  3HCT A;  4F1P A;  5I3L A;  5SVI B;  1VYX A;  5JG6 A;  1VD4 A;  3ZYQ A;  1XWH A;  1X4I A;  2HYE D;  2YSJ A;  2I50 A;  3LVQ E;  4V3L C;  2LV9 A;  2Y1N A;  2MT5 A;  2LGL A;  2EOD A;  2QIZ A;  2D8S A;  4LJN A;  2YUR A;  1WE9 A;  4Z0O A;  4ZUX U;  4YAX A;  5TDR A;  4ZQL A;  5TBN A;  5KH3 A;  2L75 A;  1FBV A;  3LDY A;  4FK5 A;  3H7H A;  1FP0 A;  2JMI A;  2LQ6 A;  4F52 B;  2KIZ A;  3O33 A;  2ECV A;  2XP0 A;  5FER A;  3FAO A;  4QQ4 A;  3FJU B;  1VFY A;  3T7L A;  5TRB A;  1ZBD B;  4P5O B;  4QF2 A;  1WEN A;  2CON A;  2MA6 A;  2MNZ A;  1IYM A;  2K1J A;  4GND A;  4YBT A;  4IC2 A;  5J3X A;  3L11 A;  5KH7 A;  4WZ3 B;  1LDK C;  3KV6 A;  5D1K B;  2LRI C;  3LJU X;  5B75 A;  5SVI A;  3T6R A;  3M7K A;  3SUB A;  4IC3 A;  2ECI A;  2KWK A;  3KNV A;  1WIM A;  2E61 A;  4X3G A;  2FUI A;  4L7X A;  3FL2 A;  2JM3 A;  5FB0 A;  2QIC A;  3EB6 A;  4FJC A;  2EGM A;  2VJF B;  3U5N A;  4B86 C;  3ZVY A;  2UZG A;  2E6S A;  3O35 A;  4AYC B;  1HYI A;  4UP5 A;  5K3Q A;  2L7P A;  2KWJ A;  1WEM A;  2MKE A;  4YBS A;  5D1L B;  2VPE A;  2M6M A;  2LGV A;  4MSX A;  4N4F A;  4FIP A;  1WEW A;  3MHH A;  3IHP A;  3SOW A;  2KE1 A;  4Q6F A;  4XI1 A;  3ASL A;  2MD8 C;  1MM3 A;  2H0D B;  2YU4 A;  1Z2Q A;  2G45 A;  4B7Y C;  5SVY A;  1U6G B;  4H9D A;  2F42 A;  4WA6 A;  2ECJ A;  2KGI A;  2K16 A;  2M1R A;  4WZ2 A;  2KGG A;  2MD7 B;  1JOC A;  2YYR A;  5LCW B;  3SOU A;  5LKU A;  2ECN A;  3ZPV E;  4ZDT A;  3PLW A;  3O34 A;  4PPE A;  1JM7 A;  2PUY A;  2KWN A;  5DKA A;  4YAD A;  2VNF A;  2VJF A;  2XOY A;  2L0B A;  4GNE A;  2B0O E;  2MA5 A;  2L43 A;  2CSY A;  3O47 A;  4Z0R A;  4AYC A;  2KU3 A;  4YAB A;  4LLB A;  3RTR B;  5FEY A;  3ZVZ B;  1WEP A;  2CKL B;  2LAU A;  2YT5 A;  3N9M A;  3KQI A;  5B77 A;  4V3K C;  1WEV A;  5G04 B;  2KWO A;  2CSV A;  4PTB A;  2MUM A;  2KKX A;  3MHS A;  2H0D A;  1DVP A;  2YRE A;  2VPB A;  5D1M B;  1LDJ B;  3T9K A;  4AP4 A;  5B8D A;  2YW8 A;  3N9N A;  3ZTG A;  5EYA F;  2M3H A;  2P57 A;  2Y43 A;  5TDW A;  2FD4 A;  4R7E A;  2JMD A; 
#chains in the Genus database with same CATH homology
 1WEE A;  4LAD B;  3RPG B;  3O37 A;  2C2L A;  3M99 A;  4R8P K;  4O64 A;  3C6W A;  2XB1 A;  5AIU A;  1WES A;  1JM7 B;  4YC9 A;  3L1Z B;  4TKP B;  2ZET C;  3M62 A;  4A4C A;  1MM2 A;  5B76 A;  2ECG A;  2CKL A;  1WEQ A;  4AUQ B;  5B78 A;  2VPD A;  2YHN A;  4YBM A;  1WFK A;  3U5P A;  3LQH A;  3ZPV 1;  4I7B A;  3V43 A;  4C9Z A;  2YQM A;  3PHD A;  2MIQ A;  5LKX A;  5G0F A;  2VJE B;  1G25 A;  3O70 A;  2ECT A;  2CSZ A;  4QF3 A;  5H1V A;  3I2D A;  2KYU A;  3N9O A;  3ZNI A;  4L58 A;  3L1X A;  2LGK A;  1E4U A;  3O36 A;  2C2V S;  2KFT A;  3M63 A;  2M85 A;  1Z6U A;  3GL6 A;  4WZ0 A;  1K2F A;  3GV4 A;  3N9L A;  4FO9 A;  5LKZ A;  3RPG C;  2PNX A;  2KRE A;  3C5K A;  4A0C D;  2NAA A;  4I7C A;  5TAB A;  4BHW A;  5H1U A;  2RSD A;  4W4U A;  2VPG A;  2Y1M A;  4YAT A;  3U5O A;  4GNG A;  3KV5 A;  2F6N A;  3LQJ A;  4GB0 A;  1X4U A;  4LK9 A;  5KH9 A;  4UI9 B;  2L5U A;  4GNF A;  2VJE A;  4N3W A;  2LXH C;  2E6R A;  2LXP C;  2LN0 A;  2K4D A;  1N87 A;  4LKA A;  3NG2 A;  3VK6 A;  2YUC A;  3HCS A;  3QZV A;  2JRJ A;  3PUR A;  1CHC A;  4AVX A;  3LRQ A;  4S3O C;  2JMJ A;  4MVT A;  4CA1 A;  3N9P A;  1WEO A;  2G6Q A;  1BOR A;  4NN2 A;  5FB1 A;  2FUU A;  2L80 A;  2G43 A;  2DX8 A;  3PUQ A;  2YHO A;  5C11 A;  2OXQ C;  4I7D A;  2F6J A;  5B79 A;  5DIN A;  2ECW A;  3SHB A;  3SOX A;  1F62 A;  1Z60 A;  3U5M A;  2IDA A;  2LDR A;  2YQL A;  2RI7 A;  2EGP A;  4A4B A;  1X4J A;  2FSA A;  4S3O B;  2LGG A;  3EB5 A;  3HTK C;  2K17 A;  1WEU A;  2BAY A;  1HYJ A;  1T1H A;  5H9M A;  4R2Y A;  2MNY A;  2QJ0 A;  1WIL A;  3O7A A;  5H1T A;  4BBQ A;  2CT2 A;  1RMD A;  5C13 A;  3DPL R;  3LQI A;  3N9Q A;  4A49 A;  4CCG X;  2HDP A;  5AIT A;  3DQV R;  2VP7 A;  2EA6 A;  4UP0 A;  1WGM A;  2AN6 A;  2KR4 A;  5G05 B;  5LKT A;  2XEU A;  2YSM A;  1V87 A;  3HCU A;  3HCT A;  5I3L A;  1VYX A;  5JG6 A;  1VD4 A;  3ZYQ A;  1XWH A;  1X4I A;  2HYE D;  2YSJ A;  2I50 A;  4V3L C;  2LV9 A;  2Y1N A;  2MT5 A;  2LGL A;  2EOD A;  2QIZ A;  2D8S A;  4LJN A;  2YUR A;  1WE9 A;  4ZUX U;  4YAX A;  5TDR A;  4ZQL A;  5TBN A;  5KH3 A;  2L75 A;  1FBV A;  4FK5 A;  1FP0 A;  2JMI A;  2LQ6 A;  4F52 B;  2KIZ A;  3O33 A;  2ECV A;  5FER A;  1VFY A;  3T7L A;  5TRB A;  1ZBD B;  4P5O B;  4QF2 A;  1WEN A;  1IYM A;  2MA6 A;  2MNZ A;  2K1J A;  4GND A;  4YBT A;  4IC2 A;  5J3X A;  3L11 A;  5KH7 A;  4WZ3 B;  1LDK C;  3KV6 A;  5D1K B;  2LRI C;  5B75 A;  3T6R A;  4IC3 A;  2ECI A;  2KWK A;  3KNV A;  1WIM A;  4X3G A;  2FUI A;  4L7X A;  3FL2 A;  5FB0 A;  2QIC A;  3EB6 A;  4FJC A;  2VJF B;  3U5N A;  4B86 C;  3ZVY A;  2UZG A;  2E6S A;  3O35 A;  4AYC B;  1HYI A;  4UP5 A;  2KWJ A;  1WEM A;  4YBS A;  5D1L B;  2VPE A;  2M6M A;  2LGV A;  4MSX A;  4N4F A;  4FIP A;  1WEW A;  3MHH A;  3IHP A;  3SOW A;  2KE1 A;  4Q6F A;  4XI1 A;  3ASL A;  2MD8 C;  1MM3 A;  2H0D B;  2YU4 A;  1Z2Q A;  2G45 A;  4B7Y C;  1U6G B;  2F42 A;  4WA6 A;  2ECJ A;  2KGI A;  2K16 A;  2M1R A;  4WZ2 A;  2KGG A;  2MD7 B;  1JOC A;  2YYR A;  5LCW B;  3SOU A;  5LKU A;  2ECN A;  3ZPV E;  4ZDT A;  3O34 A;  4PPE A;  1JM7 A;  2PUY A;  2KWN A;  5DKA A;  4YAD A;  2VNF A;  2VJF A;  2L0B A;  4GNE A;  2MA5 A;  2L43 A;  2CSY A;  4AYC A;  2KU3 A;  4YAB A;  4LLB A;  3RTR B;  5FEY A;  3ZVZ B;  1WEP A;  2CKL B;  2YT5 A;  3N9M A;  3KQI A;  5B77 A;  4V3K C;  1WEV A;  5G04 B;  2KWO A;  4PTB A;  2MUM A;  3MHS A;  2H0D A;  1DVP A;  2YRE A;  2VPB A;  5D1M B;  1LDJ B;  4AP4 A;  5B8D A;  2YW8 A;  3N9N A;  3ZTG A;  5EYA F;  2M3H A;  2Y43 A;  5TDW A;  4R7E A;  2JMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...