3SHBA

Crystal structure of phd domain of uhrf1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Crystal structure of PHD domain of UHRF1 and insights into recognition of unmodified histone H3 arginine residue 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/nuclear protein
total genus 11
structure length 67
sequence length 67
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3shbA00
1LDJB 2YU4A 2LRIC 5FB0A 2Y1NA 1T1HA 5JG6A 2KFTA 2MA6A 5D1MB 4WA6A 1WGMA 3N9OA 4FJCA 5B77A 2KE1A 2MA5A 2PNXA 2XB1A 2YUCA 5DINA 2ECJA 3C6WA 2IDAA 1ZBDB 4YAXA 3NG2A 2ECIA 3HCUA 4WZ2A 2HDPA 4FK5A 2MUMA 4YATA 2MD8C 1XWHA 4I7DA 2BAYA 2K16A 5EYAF 3L1ZB 5KH7A 2F42A 2M85A 5G04B 3DPLR 5TDRA 2M6MA 2KR4A 2EA6A 4L58A 2MNYA 4ZDTA 2LGKA 1WESA 3FL2A 2MD7B 4QF2A 2YQLA 1WEWA 2YT5A 4YABA 1WFKA 1Z2QA 3ZTGA 5B8DA 3ZPVE 3N9PA 3EB6A 2LXHC 3GV4A 3L11A 2VP7A 1WEOA 3SOXA 1F62A 4A4CA 5C13A 5D1LB 4IC2A 3ZYQA 4XI1A 2LQ6A 3U5MA 4LKAA 2L80A 5H1VA 3KV6A 5B78A 2VPEA 2F6NA 1X4UA 3U5PA 4LADB 4ZUXU 4AYCA 2MT5A 2LGVA 4MSXA 4V3KC 2ECNA 4N4FA 3ZVYA 2L43A 1K2FA 3MHHA 2L75A 3QZVA 2NAAA 3EB5A 3LQHA 4YADA 1WEUA 1RMDA 3N9NA 3O37A 3ZVZB 4NN2A 1N87A 1CHCA 4BBQA 2FSAA 3HCSA 2C2VS 2QIZA 4LK9A 4B86C 4FO9A 3SOWA 2F6JA 4CA1A 1V87A 2CT2A 1JOCA 4LJNA 4YBMA 2UZGA 2AN6A 4UP0A 3O34A 2KGGA 2JMJA 2CSYA 2LXPC 2YYRA 3O70A 4V3LC 2KWKA 2YQMA 2YREA 1WILA 2KYUA 2ECWA 2PUYA 2G6QA 5LKZA 3LQJA 2RI7A 2QJ0A 2XEUA 3ZNIA 4AYCB 2VPGA 1BORA 3KV5A 5H9MA 2EGPA 4P5OB 4R8PK 2E6RA 1FP0A 4AVXA 2CSZA 5C11A 5LKXA 3N9MA 2VJFA 4GNDA 3IHPA 3RTRB 4GB0A 2JMIA 2LGGA 4YBTA 3MHSA 4O64A 1X4IA 2VJEB 4YBSA 4N3WA 4TKPB 2E6SA 2M1RA 2MNZA 2QICA 3O7AA 2Y43A 3T6RA 4F52B 1IYMA 2L0BA 4Q6FA 2LV9A 5B75A 4I7CA 5KH3A 5I3LA 2ZETC 2YHNA 3LQIA 4QF3A 4C9ZA 1HYIA 5D1KB 4S3OB 4FIPA 2H0DA 2G45A 2JRJA 2OXQC 2YSMA 2ECTA 2YURA 3V43A 4W4UA 3U5OA 5FEYA 2VJFB 3I2DA 4WZ3B 2K4DA 2KWJA 1FBVA 1WIMA 2K17A 2MIQA 2KIZA 1WEMA 2KWOA 3RPGB 5TRBA 2VJEA 3O35A 4I7BA 4PTBA 3T7LA 1WEQA 4BHWA 2G43A 2I50A 3GL6A 4GNFA 2VPDA 2RSDA 5LCWB 1G25A 2LN0A 4PPEA 2K1JA 4A4BA 2Y1MA 4X3GA 1HYJA 2DX8A 2YSJA 3M63A 4R2YA 1DVPA 3PHDA 2YW8A 1WEVA 2C2LA 4ZQLA 5DKAA 2H0DB 2YHOA 4B7YC 5AIUA 5B79A 1VFYA 3M99A 2CKLA 2FUUA 5TBNA 3VK6A 4IC3A 2EODA 4YC9A 5J3XA 3O33A 2VPBA 3HCTA 3ASLA 4AUQB 3PURA 5H1UA 4GNGA 3N9LA 1JM7A 2KREA 5FB1A 2KU3A 3KQIA 5B76A 4L7XA 5G05B 5KH9A 2ECGA 2KGIA 4AP4A 2D8SA 4CCGX 4S3OC 1MM2A 3SHBA 5AITA 5TDWA 1Z6UA 2LGLA 2HYED 3LRQA 4WZ0A 3C5KA 4UP5A 2M3HA 2VNFA 1VYXA 4LLBA 3KNVA 2L5UA 3PUQA 4MVTA 3HTKC 4A49A 5LKUA 2CKLB 4UI9B 5G0FA 1Z60A 1WEPA 2ECVA 3RPGC 1MM3A 1WEEA 1WE9A 3U5NA 3DQVR 1JM7B 1WENA 2FUIA 2KWNA 2LDRA 1U6GB 3O36A 5TABA 3SOUA 3L1XA 5FERA 1LDKC 1X4JA 5LKTA 3N9QA 4A0CD 4GNEA 1VD4A 3M62A 2JMDA 1E4UA 3ZPV1 4R7EA 5H1TA
chains in the Genus database with same CATH superfamily
1LDJB 2YU4A 2B0OE 2LRIC 5FB0A 2Y1NA 1T1HA 5JG6A 2KFTA 2MA6A 2L7PA 4WA6A 1WGMA 5D1MB 3N9OA 4FJCA 5B77A 2KE1A 2MA5A 2KKYA 2PNXA 2XB1A 2YUCA 5DINA 2ECJA 3C6WA 2IDAA 1ZBDB 4YAXA 3NG2A 2FFWA 2ECIA 3HCUA 4WZ2A 2HDPA 4FK5A 2MUMA 4YATA 2MD8C 1XWHA 4I7DA 2P57A 2BAYA 2K16A 5EYAF 3MDBC 3L1ZB 5KH7A 2F42A 2M85A 3Q1DA 5G04B 3E2DA 3DPLR 5TDRA 2M6MA 2KR4A 2EA6A 4L58A 2MNYA 3SUBA 4ZDTA 2MKEA 2LGKA 1WESA 3M7KA 5SVIB 3FL2A 3LJUX 2MD7B 4QF2A 2YQLA 1WEWA 2YT5A 4YABA 1WFKA 2LAUA 1Z2QA 3ZTGA 5B8DA 3ZPVE 3N9PA 3EB6A 2LXHC 3GV4A 3L11A 2VP7A 1WEOA 3SOXA 1F62A 4A4CA 5C13A 2CSVA 5D1LB 4IC2A 3ZYQA 4XI1A 2LQ6A 3U5MA 4LKAA 2L80A 5H1VA 3KV6A 5B78A 2VPEA 2F6NA 1X4UA 3U5PA 4LADB 4ZUXU 4AYCA 2MT5A 2LGVA 4MSXA 2XOZA 4V3KC 2ECNA 4N4FA 3ZVYA 2L43A 1K2FA 2JM3A 3MHHA 2CRWA 2L75A 2CONA 3T9KA 2XOYA 3QZVA 2NAAA 3EB5A 3LQHA 4YADA 1WEUA 1RMDA 3N9NA 5SVIA 2XP0A 3O37A 3ZVZB 4NN2A 1N87A 1CHCA 4BBQA 2FSAA 3HCSA 2C2VS 2QIZA 4LK9A 4B86C 4FO9A 3SOWA 2F6JA 4CA1A 1V87A 2CT2A 1JOCA 4LJNA 4YBMA 2UZGA 2AN6A 4UP0A 2RR4A 3O34A 2KGGA 2JMJA 2CSYA 2LXPC 2YYRA 3O70A 5K3QA 4V3LC 2KWKA 2YQMA 2YREA 1WILA 2KYUA 2ECWA 2PUYA 2G6QA 5SVYA 5LKZA 3LQJA 2RI7A 2QJ0A 2XEUA 3ZNIA 4AYCB 2VPGA 1BORA 3KV5A 3FAOA 2EGPA 4P5OB 5H9MA 4R8PK 2E6RA 1FP0A 4AVXA 2CSZA 1DCQA 3LVQE 4OGEA 5C11A 5LKXA 3N9MA 4QQ4A 2VJFA 4GNDA 3IHPA 3RTRB 4GB0A 2JMIA 2LGGA 4YBTA 3MHSA 4O64A 1X4IA 2VJEB 4YBSA 4N3WA 3DWDA 3FEHA 4TKPB 2E6SA 2M1RA 2MNZA 2QICA 3O7AA 2Y43A 3H7HA 3T6RA 4F52B 1IYMA 2L0BA 4Q6FA 2LV9A 2IQJA 5B75A 4I7CA 5KH3A 5I3LA 2YVRA 2ZETC 2YHNA 3LQIA 4QF3A 4C9ZA 1HYIA 5D1KB 4S3OB 4FIPA 2H0DA 2G45A 2JRJA 2OXQC 2YSMA 2ECTA 2YURA 3V43A 4W4UA 3LVRE 1MBMA 3U5OA 5FEYA 2VJFB 3I2DA 4WZ3B 2KKXA 2K4DA 2KWJA 1FBVA 2XOCA 1WIMA 2K17A 2MIQA 2KIZA 1WEMA 2KWOA 3RPGB 5TRBA 2VJEA 3O35A 4I7BA 4PTBA 3T7LA 1WEQA 4BHWA 2G43A 2I50A 3GL6A 2DSMA 4GNFA 2VPDA 2RSDA 5LCWB 5SVXA 1G25A 2LN0A 4PPEA 2K1JA 4A4BA 2Y1MA 4X3GA 1HYJA 2DX8A 2YSJA 4Z0RA 2EXUA 3M63A 4R2YA 1DVPA 2M13A 3PHDA 2YW8A 1WEVA 2DJAA 2C2LA 4ZQLA 5DKAA 2H0DB 2YHOA 4B7YC 3KDEC 5AIUA 5B79A 1VFYA 3M99A 3PLWA 2CKLA 2FUUA 5TBNA 3VK6A 4IC3A 2EODA 4F1PA 4YC9A 5J3XA 4O62A 3O33A 2VPBA 2FD4A 3HCTA 3ASLA 4AUQB 3PURA 5H1UA 4GNGA 3N9LA 1JM7A 2KREA 5FB1A 2KU3A 3KQIA 5B76A 3O47A 4L7XA 5G05B 3FJUB 5KH9A 2ECGA 3FANA 2KGIA 4AP4A 2D8SA 4CCGX 4S3OC 1MM2A 3SHBA 5AITA 5TDWA 1Z6UA 2LGLA 2JUNA 2HYED 3LRQA 2CRRA 4WZ0A 3C5KA 4Z0OA 4OGCA 4UP5A 2E61A 2M3HA 2VNFA 1VYXA 4LLBA 3KNVA 2L5UA 3PUQA 4MVTA 3HTKC 4A49A 5LKUA 2CKLB 4UI9B 4H9DA 3LDYA 5G0FA 1Z60A 1WEPA 2ECVA 3RPGC 2EGMA 1MM3A 3FM8C 2OWAA 1WEEA 1WE9A 2D8UA 3U5NA 3DQVR 1JM7B 1WENA 2FUIA 2KWNA 2LDRA 1U6GB 3JUEA 3O36A 3DDTA 5TABA 3SOUA 3L1XA 5FERA 1LDKC 1X4JA 5LKTA 3N9QA 4A0CD 4GNEA 1VD4A 3M62A 2JMDA 1E4UA 3ZPV1 4R7EA 5H1TA
chains in the Genus database with same CATH topology
1LDJB 2YU4A 2LRIC 5FB0A 2Y1NA 1T1HA 5JG6A 2KFTA 2MA6A 5D1MB 4WA6A 1WGMA 3N9OA 4FJCA 5B77A 2KE1A 2MA5A 2PNXA 2XB1A 2YUCA 5DINA 2ECJA 3C6WA 2IDAA 1ZBDB 4YAXA 3NG2A 2ECIA 3HCUA 4WZ2A 2HDPA 4FK5A 2MUMA 4YATA 2MD8C 1XWHA 4I7DA 2BAYA 2K16A 5EYAF 3L1ZB 5KH7A 2F42A 2M85A 5G04B 3DPLR 5TDRA 2M6MA 2KR4A 2EA6A 4L58A 2MNYA 4ZDTA 2LGKA 1WESA 3FL2A 2MD7B 4QF2A 2YQLA 1WEWA 2YT5A 4YABA 1WFKA 1Z2QA 3ZTGA 5B8DA 3ZPVE 3N9PA 3EB6A 2LXHC 3GV4A 3L11A 2VP7A 1WEOA 3SOXA 1F62A 4A4CA 5C13A 5D1LB 4IC2A 3ZYQA 4XI1A 2LQ6A 3U5MA 4LKAA 2L80A 5H1VA 3KV6A 5B78A 2VPEA 2F6NA 1X4UA 3U5PA 4LADB 4ZUXU 4AYCA 2MT5A 2LGVA 4MSXA 4V3KC 2ECNA 4N4FA 3ZVYA 2L43A 1K2FA 3MHHA 2L75A 3QZVA 2NAAA 3EB5A 3LQHA 4YADA 1WEUA 1RMDA 3N9NA 3O37A 3ZVZB 4NN2A 1N87A 1CHCA 4BBQA 2FSAA 3HCSA 2C2VS 2QIZA 4LK9A 4B86C 4FO9A 3SOWA 2F6JA 4CA1A 1V87A 2CT2A 1JOCA 4LJNA 4YBMA 2UZGA 2AN6A 4UP0A 3O34A 2KGGA 2JMJA 2CSYA 2LXPC 2YYRA 3O70A 4V3LC 2KWKA 2YQMA 2YREA 1WILA 2KYUA 2ECWA 2PUYA 2G6QA 5LKZA 3LQJA 2RI7A 2QJ0A 2XEUA 3ZNIA 4AYCB 2VPGA 1BORA 3KV5A 5H9MA 2EGPA 4P5OB 4R8PK 2E6RA 1FP0A 4AVXA 2CSZA 5C11A 5LKXA 3N9MA 2VJFA 4GNDA 3IHPA 3RTRB 4GB0A 2JMIA 2LGGA 4YBTA 3MHSA 4O64A 1X4IA 2VJEB 4YBSA 4N3WA 4TKPB 2E6SA 2M1RA 2MNZA 2QICA 3O7AA 2Y43A 3T6RA 4F52B 1IYMA 2L0BA 4Q6FA 2LV9A 5B75A 4I7CA 5KH3A 5I3LA 2ZETC 2YHNA 3LQIA 4QF3A 4C9ZA 1HYIA 5D1KB 4S3OB 4FIPA 2H0DA 2G45A 2JRJA 2OXQC 2YSMA 2ECTA 2YURA 3V43A 4W4UA 3U5OA 5FEYA 2VJFB 3I2DA 4WZ3B 2K4DA 2KWJA 1FBVA 1WIMA 2K17A 2MIQA 2KIZA 1WEMA 2KWOA 3RPGB 5TRBA 2VJEA 3O35A 4I7BA 4PTBA 3T7LA 1WEQA 4BHWA 2G43A 2I50A 3GL6A 4GNFA 2VPDA 2RSDA 5LCWB 1G25A 2LN0A 4PPEA 2K1JA 4A4BA 2Y1MA 4X3GA 1HYJA 2DX8A 2YSJA 3M63A 4R2YA 1DVPA 3PHDA 2YW8A 1WEVA 2C2LA 4ZQLA 5DKAA 2H0DB 2YHOA 4B7YC 5AIUA 5B79A 1VFYA 3M99A 2CKLA 2FUUA 5TBNA 3VK6A 4IC3A 2EODA 4YC9A 5J3XA 3O33A 2VPBA 3HCTA 3ASLA 4AUQB 3PURA 5H1UA 4GNGA 3N9LA 1JM7A 2KREA 5FB1A 2KU3A 3KQIA 5B76A 4L7XA 5G05B 5KH9A 2ECGA 2KGIA 4AP4A 2D8SA 4CCGX 4S3OC 1MM2A 3SHBA 5AITA 5TDWA 1Z6UA 2LGLA 2HYED 3LRQA 4WZ0A 3C5KA 4UP5A 2M3HA 2VNFA 1VYXA 4LLBA 3KNVA 2L5UA 3PUQA 4MVTA 3HTKC 4A49A 5LKUA 2CKLB 4UI9B 5G0FA 1Z60A 1WEPA 2ECVA 3RPGC 1MM3A 1WEEA 1WE9A 3U5NA 3DQVR 1JM7B 1WENA 2FUIA 2KWNA 2LDRA 1U6GB 3O36A 5TABA 3SOUA 3L1XA 5FERA 1LDKC 1X4JA 5LKTA 3N9QA 4A0CD 4GNEA 1VD4A 3M62A 2JMDA 1E4UA 3ZPV1 4R7EA 5H1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDJ B;  2YU4 A;  2LRI C;  5FB0 A;  2Y1N A;  1T1H A;  5JG6 A;  2KFT A;  2MA6 A;  5D1M B;  4WA6 A;  1WGM A;  3N9O A;  4FJC A;  5B77 A;  2KE1 A;  2MA5 A;  2PNX A;  2XB1 A;  2YUC A;  5DIN A;  2ECJ A;  3C6W A;  2IDA A;  1ZBD B;  4YAX A;  3NG2 A;  2ECI A;  3HCU A;  4WZ2 A;  2HDP A;  4FK5 A;  2MUM A;  4YAT A;  2MD8 C;  1XWH A;  4I7D A;  2BAY A;  2K16 A;  5EYA F;  3L1Z B;  5KH7 A;  2F42 A;  2M85 A;  5G04 B;  3DPL R;  5TDR A;  2M6M A;  2KR4 A;  2EA6 A;  4L58 A;  2MNY A;  4ZDT A;  2LGK A;  1WES A;  3FL2 A;  2MD7 B;  4QF2 A;  2YQL A;  1WEW A;  2YT5 A;  4YAB A;  1WFK A;  1Z2Q A;  3ZTG A;  5B8D A;  3ZPV E;  3N9P A;  3EB6 A;  2LXH C;  3GV4 A;  3L11 A;  2VP7 A;  1WEO A;  3SOX A;  1F62 A;  4A4C A;  5C13 A;  5D1L B;  4IC2 A;  3ZYQ A;  4XI1 A;  2LQ6 A;  3U5M A;  4LKA A;  2L80 A;  5H1V A;  3KV6 A;  5B78 A;  2VPE A;  2F6N A;  1X4U A;  3U5P A;  4LAD B;  4ZUX U;  4AYC A;  2MT5 A;  2LGV A;  4MSX A;  4V3K C;  2ECN A;  4N4F A;  3ZVY A;  2L43 A;  1K2F A;  3MHH A;  2L75 A;  3QZV A;  2NAA A;  3EB5 A;  3LQH A;  4YAD A;  1WEU A;  1RMD A;  3N9N A;  3O37 A;  3ZVZ B;  4NN2 A;  1N87 A;  1CHC A;  4BBQ A;  2FSA A;  3HCS A;  2C2V S;  2QIZ A;  4LK9 A;  4B86 C;  4FO9 A;  3SOW A;  2F6J A;  4CA1 A;  1V87 A;  2CT2 A;  1JOC A;  4LJN A;  4YBM A;  2UZG A;  2AN6 A;  4UP0 A;  3O34 A;  2KGG A;  2JMJ A;  2CSY A;  2LXP C;  2YYR A;  3O70 A;  4V3L C;  2KWK A;  2YQM A;  2YRE A;  1WIL A;  2KYU A;  2ECW A;  2PUY A;  2G6Q A;  5LKZ A;  3LQJ A;  2RI7 A;  2QJ0 A;  2XEU A;  3ZNI A;  4AYC B;  2VPG A;  1BOR A;  3KV5 A;  5H9M A;  2EGP A;  4P5O B;  4R8P K;  2E6R A;  1FP0 A;  4AVX A;  2CSZ A;  5C11 A;  5LKX A;  3N9M A;  2VJF A;  4GND A;  3IHP A;  3RTR B;  4GB0 A;  2JMI A;  2LGG A;  4YBT A;  3MHS A;  4O64 A;  1X4I A;  2VJE B;  4YBS A;  4N3W A;  4TKP B;  2E6S A;  2M1R A;  2MNZ A;  2QIC A;  3O7A A;  2Y43 A;  3T6R A;  4F52 B;  1IYM A;  2L0B A;  4Q6F A;  2LV9 A;  5B75 A;  4I7C A;  5KH3 A;  5I3L A;  2ZET C;  2YHN A;  3LQI A;  4QF3 A;  4C9Z A;  1HYI A;  5D1K B;  4S3O B;  4FIP A;  2H0D A;  2G45 A;  2JRJ A;  2OXQ C;  2YSM A;  2ECT A;  2YUR A;  3V43 A;  4W4U A;  3U5O A;  5FEY A;  2VJF B;  3I2D A;  4WZ3 B;  2K4D A;  2KWJ A;  1FBV A;  1WIM A;  2K17 A;  2MIQ A;  2KIZ A;  1WEM A;  2KWO A;  3RPG B;  5TRB A;  2VJE A;  3O35 A;  4I7B A;  4PTB A;  3T7L A;  1WEQ A;  4BHW A;  2G43 A;  2I50 A;  3GL6 A;  4GNF A;  2VPD A;  2RSD A;  5LCW B;  1G25 A;  2LN0 A;  4PPE A;  2K1J A;  4A4B A;  2Y1M A;  4X3G A;  1HYJ A;  2DX8 A;  2YSJ A;  3M63 A;  4R2Y A;  1DVP A;  3PHD A;  2YW8 A;  1WEV A;  2C2L A;  4ZQL A;  5DKA A;  2H0D B;  2YHO A;  4B7Y C;  5AIU A;  5B79 A;  1VFY A;  3M99 A;  2CKL A;  2FUU A;  5TBN A;  3VK6 A;  4IC3 A;  2EOD A;  4YC9 A;  5J3X A;  3O33 A;  2VPB A;  3HCT A;  3ASL A;  4AUQ B;  3PUR A;  5H1U A;  4GNG A;  3N9L A;  1JM7 A;  2KRE A;  5FB1 A;  2KU3 A;  3KQI A;  5B76 A;  4L7X A;  5G05 B;  5KH9 A;  2ECG A;  2KGI A;  4AP4 A;  2D8S A;  4CCG X;  4S3O C;  1MM2 A;  3SHB A;  5AIT A;  5TDW A;  1Z6U A;  2LGL A;  2HYE D;  3LRQ A;  4WZ0 A;  3C5K A;  4UP5 A;  2M3H A;  2VNF A;  1VYX A;  4LLB A;  3KNV A;  2L5U A;  3PUQ A;  4MVT A;  3HTK C;  4A49 A;  5LKU A;  2CKL B;  4UI9 B;  5G0F A;  1Z60 A;  1WEP A;  2ECV A;  3RPG C;  1MM3 A;  1WEE A;  1WE9 A;  3U5N A;  3DQV R;  1JM7 B;  1WEN A;  2FUI A;  2KWN A;  2LDR A;  1U6G B;  3O36 A;  5TAB A;  3SOU A;  3L1X A;  5FER A;  1LDK C;  1X4J A;  5LKT A;  3N9Q A;  4A0C D;  4GNE A;  1VD4 A;  3M62 A;  2JMD A;  1E4U A;  3ZPV 1;  4R7E A;  5H1T A; 
#chains in the Genus database with same CATH topology
 1LDJ B;  2YU4 A;  2B0O E;  2LRI C;  5FB0 A;  2Y1N A;  1T1H A;  5JG6 A;  2KFT A;  2MA6 A;  2L7P A;  4WA6 A;  1WGM A;  5D1M B;  3N9O A;  4FJC A;  5B77 A;  2KE1 A;  2MA5 A;  2KKY A;  2PNX A;  2XB1 A;  2YUC A;  5DIN A;  2ECJ A;  3C6W A;  2IDA A;  1ZBD B;  4YAX A;  3NG2 A;  2FFW A;  2ECI A;  3HCU A;  4WZ2 A;  2HDP A;  4FK5 A;  2MUM A;  4YAT A;  2MD8 C;  1XWH A;  4I7D A;  2P57 A;  2BAY A;  2K16 A;  5EYA F;  3MDB C;  3L1Z B;  5KH7 A;  2F42 A;  2M85 A;  3Q1D A;  5G04 B;  3E2D A;  3DPL R;  5TDR A;  2M6M A;  2KR4 A;  2EA6 A;  4L58 A;  2MNY A;  3SUB A;  4ZDT A;  2MKE A;  2LGK A;  1WES A;  3M7K A;  5SVI B;  3FL2 A;  3LJU X;  2MD7 B;  4QF2 A;  2YQL A;  1WEW A;  2YT5 A;  4YAB A;  1WFK A;  2LAU A;  1Z2Q A;  3ZTG A;  5B8D A;  3ZPV E;  3N9P A;  3EB6 A;  2LXH C;  3GV4 A;  3L11 A;  2VP7 A;  1WEO A;  3SOX A;  1F62 A;  4A4C A;  5C13 A;  2CSV A;  5D1L B;  4IC2 A;  3ZYQ A;  4XI1 A;  2LQ6 A;  3U5M A;  4LKA A;  2L80 A;  5H1V A;  3KV6 A;  5B78 A;  2VPE A;  2F6N A;  1X4U A;  3U5P A;  4LAD B;  4ZUX U;  4AYC A;  2MT5 A;  2LGV A;  4MSX A;  2XOZ A;  4V3K C;  2ECN A;  4N4F A;  3ZVY A;  2L43 A;  1K2F A;  2JM3 A;  3MHH A;  2CRW A;  2L75 A;  2CON A;  3T9K A;  2XOY A;  3QZV A;  2NAA A;  3EB5 A;  3LQH A;  4YAD A;  1WEU A;  1RMD A;  3N9N A;  5SVI A;  2XP0 A;  3O37 A;  3ZVZ B;  4NN2 A;  1N87 A;  1CHC A;  4BBQ A;  2FSA A;  3HCS A;  2C2V S;  2QIZ A;  4LK9 A;  4B86 C;  4FO9 A;  3SOW A;  2F6J A;  4CA1 A;  1V87 A;  2CT2 A;  1JOC A;  4LJN A;  4YBM A;  2UZG A;  2AN6 A;  4UP0 A;  2RR4 A;  3O34 A;  2KGG A;  2JMJ A;  2CSY A;  2LXP C;  2YYR A;  3O70 A;  5K3Q A;  4V3L C;  2KWK A;  2YQM A;  2YRE A;  1WIL A;  2KYU A;  2ECW A;  2PUY A;  2G6Q A;  5SVY A;  5LKZ A;  3LQJ A;  2RI7 A;  2QJ0 A;  2XEU A;  3ZNI A;  4AYC B;  2VPG A;  1BOR A;  3KV5 A;  3FAO A;  2EGP A;  4P5O B;  5H9M A;  4R8P K;  2E6R A;  1FP0 A;  4AVX A;  2CSZ A;  1DCQ A;  3LVQ E;  4OGE A;  5C11 A;  5LKX A;  3N9M A;  4QQ4 A;  2VJF A;  4GND A;  3IHP A;  3RTR B;  4GB0 A;  2JMI A;  2LGG A;  4YBT A;  3MHS A;  4O64 A;  1X4I A;  2VJE B;  4YBS A;  4N3W A;  3DWD A;  3FEH A;  4TKP B;  2E6S A;  2M1R A;  2MNZ A;  2QIC A;  3O7A A;  2Y43 A;  3H7H A;  3T6R A;  4F52 B;  1IYM A;  2L0B A;  4Q6F A;  2LV9 A;  2IQJ A;  5B75 A;  4I7C A;  5KH3 A;  5I3L A;  2YVR A;  2ZET C;  2YHN A;  3LQI A;  4QF3 A;  4C9Z A;  1HYI A;  5D1K B;  4S3O B;  4FIP A;  2H0D A;  2G45 A;  2JRJ A;  2OXQ C;  2YSM A;  2ECT A;  2YUR A;  3V43 A;  4W4U A;  3LVR E;  1MBM A;  3U5O A;  5FEY A;  2VJF B;  3I2D A;  4WZ3 B;  2KKX A;  2K4D A;  2KWJ A;  1FBV A;  2XOC A;  1WIM A;  2K17 A;  2MIQ A;  2KIZ A;  1WEM A;  2KWO A;  3RPG B;  5TRB A;  2VJE A;  3O35 A;  4I7B A;  4PTB A;  3T7L A;  1WEQ A;  4BHW A;  2G43 A;  2I50 A;  3GL6 A;  2DSM A;  4GNF A;  2VPD A;  2RSD A;  5LCW B;  5SVX A;  1G25 A;  2LN0 A;  4PPE A;  2K1J A;  4A4B A;  2Y1M A;  4X3G A;  1HYJ A;  2DX8 A;  2YSJ A;  4Z0R A;  2EXU A;  3M63 A;  4R2Y A;  1DVP A;  2M13 A;  3PHD A;  2YW8 A;  1WEV A;  2DJA A;  2C2L A;  4ZQL A;  5DKA A;  2H0D B;  2YHO A;  4B7Y C;  3KDE C;  5AIU A;  5B79 A;  1VFY A;  3M99 A;  3PLW A;  2CKL A;  2FUU A;  5TBN A;  3VK6 A;  4IC3 A;  2EOD A;  4F1P A;  4YC9 A;  5J3X A;  4O62 A;  3O33 A;  2VPB A;  2FD4 A;  3HCT A;  3ASL A;  4AUQ B;  3PUR A;  5H1U A;  4GNG A;  3N9L A;  1JM7 A;  2KRE A;  5FB1 A;  2KU3 A;  3KQI A;  5B76 A;  3O47 A;  4L7X A;  5G05 B;  3FJU B;  5KH9 A;  2ECG A;  3FAN A;  2KGI A;  4AP4 A;  2D8S A;  4CCG X;  4S3O C;  1MM2 A;  3SHB A;  5AIT A;  5TDW A;  1Z6U A;  2LGL A;  2JUN A;  2HYE D;  3LRQ A;  2CRR A;  4WZ0 A;  3C5K A;  4Z0O A;  4OGC A;  4UP5 A;  2E61 A;  2M3H A;  2VNF A;  1VYX A;  4LLB A;  3KNV A;  2L5U A;  3PUQ A;  4MVT A;  3HTK C;  4A49 A;  5LKU A;  2CKL B;  4UI9 B;  4H9D A;  3LDY A;  5G0F A;  1Z60 A;  1WEP A;  2ECV A;  3RPG C;  2EGM A;  1MM3 A;  3FM8 C;  2OWA A;  1WEE A;  1WE9 A;  2D8U A;  3U5N A;  3DQV R;  1JM7 B;  1WEN A;  2FUI A;  2KWN A;  2LDR A;  1U6G B;  3JUE A;  3O36 A;  3DDT A;  5TAB A;  3SOU A;  3L1X A;  5FER A;  1LDK C;  1X4J A;  5LKT A;  3N9Q A;  4A0C D;  4GNE A;  1VD4 A;  3M62 A;  2JMD A;  1E4U A;  3ZPV 1;  4R7E A;  5H1T A; 
#chains in the Genus database with same CATH homology
 1LDJ B;  2YU4 A;  2LRI C;  5FB0 A;  2Y1N A;  1T1H A;  5JG6 A;  2KFT A;  2MA6 A;  5D1M B;  4WA6 A;  1WGM A;  3N9O A;  4FJC A;  5B77 A;  2KE1 A;  2MA5 A;  2PNX A;  2XB1 A;  2YUC A;  5DIN A;  2ECJ A;  3C6W A;  2IDA A;  1ZBD B;  4YAX A;  3NG2 A;  2ECI A;  3HCU A;  4WZ2 A;  2HDP A;  4FK5 A;  2MUM A;  4YAT A;  2MD8 C;  1XWH A;  4I7D A;  2BAY A;  2K16 A;  5EYA F;  3L1Z B;  5KH7 A;  2F42 A;  2M85 A;  5G04 B;  3DPL R;  5TDR A;  2M6M A;  2KR4 A;  2EA6 A;  4L58 A;  2MNY A;  4ZDT A;  2LGK A;  1WES A;  3FL2 A;  2MD7 B;  4QF2 A;  2YQL A;  1WEW A;  2YT5 A;  4YAB A;  1WFK A;  1Z2Q A;  3ZTG A;  5B8D A;  3ZPV E;  3N9P A;  3EB6 A;  2LXH C;  3GV4 A;  3L11 A;  2VP7 A;  1WEO A;  3SOX A;  1F62 A;  4A4C A;  5C13 A;  5D1L B;  4IC2 A;  3ZYQ A;  4XI1 A;  2LQ6 A;  3U5M A;  4LKA A;  2L80 A;  5H1V A;  3KV6 A;  5B78 A;  2VPE A;  2F6N A;  1X4U A;  3U5P A;  4LAD B;  4ZUX U;  4AYC A;  2MT5 A;  2LGV A;  4MSX A;  4V3K C;  2ECN A;  4N4F A;  3ZVY A;  2L43 A;  1K2F A;  3MHH A;  2L75 A;  3QZV A;  2NAA A;  3EB5 A;  3LQH A;  4YAD A;  1WEU A;  1RMD A;  3N9N A;  3O37 A;  3ZVZ B;  4NN2 A;  1N87 A;  1CHC A;  4BBQ A;  2FSA A;  3HCS A;  2C2V S;  2QIZ A;  4LK9 A;  4B86 C;  4FO9 A;  3SOW A;  2F6J A;  4CA1 A;  1V87 A;  2CT2 A;  1JOC A;  4LJN A;  4YBM A;  2UZG A;  2AN6 A;  4UP0 A;  3O34 A;  2KGG A;  2JMJ A;  2CSY A;  2LXP C;  2YYR A;  3O70 A;  4V3L C;  2KWK A;  2YQM A;  2YRE A;  1WIL A;  2KYU A;  2ECW A;  2PUY A;  2G6Q A;  5LKZ A;  3LQJ A;  2RI7 A;  2QJ0 A;  2XEU A;  3ZNI A;  4AYC B;  2VPG A;  1BOR A;  3KV5 A;  5H9M A;  2EGP A;  4P5O B;  4R8P K;  2E6R A;  1FP0 A;  4AVX A;  2CSZ A;  5C11 A;  5LKX A;  3N9M A;  2VJF A;  4GND A;  3IHP A;  3RTR B;  4GB0 A;  2JMI A;  2LGG A;  4YBT A;  3MHS A;  4O64 A;  1X4I A;  2VJE B;  4YBS A;  4N3W A;  4TKP B;  2E6S A;  2M1R A;  2MNZ A;  2QIC A;  3O7A A;  2Y43 A;  3T6R A;  4F52 B;  1IYM A;  2L0B A;  4Q6F A;  2LV9 A;  5B75 A;  4I7C A;  5KH3 A;  5I3L A;  2ZET C;  2YHN A;  3LQI A;  4QF3 A;  4C9Z A;  1HYI A;  5D1K B;  4S3O B;  4FIP A;  2H0D A;  2G45 A;  2JRJ A;  2OXQ C;  2YSM A;  2ECT A;  2YUR A;  3V43 A;  4W4U A;  3U5O A;  5FEY A;  2VJF B;  3I2D A;  4WZ3 B;  2K4D A;  2KWJ A;  1FBV A;  1WIM A;  2K17 A;  2MIQ A;  2KIZ A;  1WEM A;  2KWO A;  3RPG B;  5TRB A;  2VJE A;  3O35 A;  4I7B A;  4PTB A;  3T7L A;  1WEQ A;  4BHW A;  2G43 A;  2I50 A;  3GL6 A;  4GNF A;  2VPD A;  2RSD A;  5LCW B;  1G25 A;  2LN0 A;  4PPE A;  2K1J A;  4A4B A;  2Y1M A;  4X3G A;  1HYJ A;  2DX8 A;  2YSJ A;  3M63 A;  4R2Y A;  1DVP A;  3PHD A;  2YW8 A;  1WEV A;  2C2L A;  4ZQL A;  5DKA A;  2H0D B;  2YHO A;  4B7Y C;  5AIU A;  5B79 A;  1VFY A;  3M99 A;  2CKL A;  2FUU A;  5TBN A;  3VK6 A;  4IC3 A;  2EOD A;  4YC9 A;  5J3X A;  3O33 A;  2VPB A;  3HCT A;  3ASL A;  4AUQ B;  3PUR A;  5H1U A;  4GNG A;  3N9L A;  1JM7 A;  2KRE A;  5FB1 A;  2KU3 A;  3KQI A;  5B76 A;  4L7X A;  5G05 B;  5KH9 A;  2ECG A;  2KGI A;  4AP4 A;  2D8S A;  4CCG X;  4S3O C;  1MM2 A;  3SHB A;  5AIT A;  5TDW A;  1Z6U A;  2LGL A;  2HYE D;  3LRQ A;  4WZ0 A;  3C5K A;  4UP5 A;  2M3H A;  2VNF A;  1VYX A;  4LLB A;  3KNV A;  2L5U A;  3PUQ A;  4MVT A;  3HTK C;  4A49 A;  5LKU A;  2CKL B;  4UI9 B;  5G0F A;  1Z60 A;  1WEP A;  2ECV A;  3RPG C;  1MM3 A;  1WEE A;  1WE9 A;  3U5N A;  3DQV R;  1JM7 B;  1WEN A;  2FUI A;  2KWN A;  2LDR A;  1U6G B;  3O36 A;  5TAB A;  3SOU A;  3L1X A;  5FER A;  1LDK C;  1X4J A;  5LKT A;  3N9Q A;  4A0C D;  4GNE A;  1VD4 A;  3M62 A;  2JMD A;  1E4U A;  3ZPV 1;  4R7E A;  5H1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...