2LGKA

Nmr structure of uhrf1 phd domains in a complex with histone h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/dna binding protein
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgkA00
2ECNA 2KREA 4IC3A 2YU4A 2VJFB 3NG2A 2LDRA 5G04B 2YSJA 1FP0A 5AIUA 1MM2A 2Y1NA 2K1JA 2H0DB 2L43A 1Z2QA 2KWJA 5J3XA 1XWHA 3L1XA 2KWKA 3M63A 2LQ6A 3SOXA 2PUYA 2EA6A 5LKZA 3O33A 4AVXA 2YURA 2K4DA 1IYMA 3KQIA 2L75A 5KH7A 3ZNIA 4BHWA 1WENA 1WGMA 5D1MB 1Z60A 3LQJA 2MA6A 2CKLA 4CA1A 5B76A 2JMIA 3N9NA 4GNDA 3ZVYA 3M99A 5AITA 3EB6A 2KIZA 2LGGA 5B8DA 2E6RA 3GV4A 2HYED 2JMDA 1K2FA 2MIQA 1WEVA 3SOWA 5H9MA 3KV6A 2ECWA 1WFKA 3ZVZB 3T7LA 3V43A 3O70A 1HYIA 2MUMA 4QF3A 4YBMA 5TBNA 3HCSA 3L11A 3FL2A 2ECIA 2LGKA 3C6WA 2G43A 3PHDA 2VP7A 4S3OB 5C11A 2LN0A 2M85A 2EGPA 4WA6A 4W4UA 4X3GA 2VPGA 3ASLA 2XEUA 2MNZA 4UP5A 2E6SA 3HCTA 4A4CA 4YBSA 2MT5A 3ZPV1 4ZDTA 2KFTA 3O37A 4NN2A 1WEUA 5FEYA 4WZ3B 2L5UA 5TDWA 3U5OA 2KYUA 5LKXA 3N9MA 4R2YA 5G05B 3LQIA 4IC2A 4I7CA 4WZ0A 4PTBA 2KWNA 5C13A 2UZGA 4CCGX 1JM7A 4N4FA 2K17A 4YATA 2Y1MA 4Q6FA 3LQHA 4TKPB 2I50A 1JOCA 2QICA 5B77A 1CHCA 3SHBA 3L1ZB 2KE1A 4AP4A 5D1LB 1WESA 4V3LC 4B7YC 5EYAF 2M6MA 2LGLA 2Y43A 3M62A 4A49A 2FSAA 3VK6A 2YT5A 4UI9B 5I3LA 3PURA 2YSMA 2YYRA 5LKTA 3U5NA 2QIZA 3KV5A 4PPEA 2RI7A 5B79A 4I7DA 4GNEA 4C9ZA 4QF2A 1BORA 5KH3A 3RPGB 3N9LA 1T1HA 2D8SA 3C5KA 4LADB 5D1KB 2CKLB 2YQLA 1LDKC 2XB1A 3HCUA 3O35A 1X4JA 2VNFA 3DPLR 2MA5A 1WE9A 2YW8A 3O36A 5DKAA 2KR4A 1WEMA 4L58A 4B86C 2DX8A 4MVTA 4XI1A 2ECGA 1VYXA 2MNYA 4GB0A 2FUUA 5LCWB 2KWOA 5FERA 1U6GB 4AUQB 1HYJA 1E4UA 4P5OB 2ZETC 3EB5A 4YBTA 1X4IA 2PNXA 5B75A 1VFYA 4LKAA 2MD7B 3N9OA 5G0FA 2VPBA 3KNVA 2MD8C 3T6RA 2KU3A 3N9QA 1V87A 1FBVA 2CSYA 3O34A 2LV9A 2H0DA 5LKUA 2LXPC 2JRJA 2FUIA 3SOUA 5H1VA 3U5PA 1WEOA 2ECTA 4AYCA 3MHHA 3GL6A 4FK5A 2YUCA 3U5MA 4R7EA 3ZYQA 4I7BA 1G25A 1F62A 4ZUXU 3HTKC 1WEQA 2QJ0A 4BBQA 3I2DA 5JG6A 1ZBDB 2CSZA 3ZTGA 1WIMA 4YABA 1JM7B 2RSDA 4LJNA 4AYCB 1Z6UA 3RPGC 1LDJB 1DVPA 1WEEA 4A0CD 1WILA 4R8PK 4GNFA 4YADA 1VD4A 2HDPA 2YHOA 5H1UA 3DQVR 5DINA 3QZVA 2M1RA 2M3HA 4YAXA 4YC9A 2ECVA 2ECJA 2L80A 2KGGA 4FO9A 4WZ2A 2JMJA 3ZPVE 2KGIA 3O7AA 2VJEA 2G45A 4ZQLA 1RMDA 4LLBA 2YREA 4S3OC 1X4UA 2G6QA 2LRIC 3N9PA 2BAYA 4FIPA 5KH9A 5H1TA 4MSXA 2C2VS 3RTRB 4GNGA 2VJEB 2AN6A 2K16A 5FB0A 3LRQA 4FJCA 2IDAA 4UP0A 2CT2A 4F52B 2YHNA 4N3WA 3MHSA 4L7XA 5TABA 4A4BA 1N87A 2F42A 2NAAA 2VPDA 1WEWA 2OXQC 5FB1A 2LXHC 1MM3A 2YQMA 5TDRA 5TRBA 2EODA 2C2LA 4LK9A 2VPEA 4O64A 1WEPA 2L0BA 2VJFA 2F6NA 2F6JA 3PUQA 4V3KC 3IHPA 5B78A 2LGVA
chains in the Genus database with same CATH superfamily
2ECNA 2KREA 4IC3A 2YU4A 2EGMA 2VJFB 3NG2A 2LDRA 5G04B 2YSJA 1FP0A 5AIUA 1MM2A 2Y1NA 2K1JA 2H0DB 2L43A 2B0OE 1Z2QA 2KWJA 5J3XA 1XWHA 3L1XA 2KWKA 3M63A 5SVIA 2LQ6A 3SOXA 2PUYA 4OGEA 2EA6A 5LKZA 3O33A 4AVXA 2LAUA 2YURA 2K4DA 1IYMA 3KQIA 2L75A 5KH7A 3ZNIA 4BHWA 1WENA 1WGMA 5D1MB 1Z60A 2FFWA 3LQJA 2MA6A 2CSVA 2CKLA 4CA1A 5B76A 2JMIA 3N9NA 4GNDA 3ZVYA 2RR4A 3FEHA 5K3QA 3M99A 5AITA 3EB6A 4H9DA 2KIZA 2LGGA 5B8DA 2E6RA 3GV4A 2HYED 2JMDA 3FANA 1K2FA 2MIQA 1WEVA 3SOWA 5H9MA 3KV6A 2ECWA 1WFKA 3ZVZB 2EXUA 3T7LA 3V43A 3O70A 1HYIA 2MUMA 2JM3A 4QF3A 4YBMA 5TBNA 3HCSA 3L11A 3FL2A 2ECIA 2LGKA 3C6WA 2G43A 3PHDA 3LVQE 2VP7A 2IQJA 4S3OB 5C11A 2LN0A 2M85A 2EGPA 4WA6A 4W4UA 4X3GA 4F1PA 5SVXA 2VPGA 3ASLA 2XEUA 2MNZA 4UP5A 2E6SA 3HCTA 4A4CA 4YBSA 2MT5A 3ZPV1 4Z0RA 4ZDTA 2KFTA 4NN2A 3O37A 1WEUA 5FEYA 4WZ3B 2L5UA 5TDWA 3U5OA 2KYUA 5LKXA 3N9MA 4R2YA 3SUBA 5G05B 3LQIA 4IC2A 4I7CA 4PTBA 4WZ0A 2KWNA 2KKXA 5C13A 2UZGA 4CCGX 1JM7A 4N4FA 2K17A 4YATA 2CRWA 2Y1MA 4Q6FA 3LQHA 4TKPB 2I50A 1JOCA 2QICA 5B77A 1CHCA 3SHBA 2XP0A 3L1ZB 4O62A 2KE1A 4AP4A 5D1LB 1WESA 2XOYA 4V3LC 4B7YC 5EYAF 3MDBC 3LDYA 3M7KA 2M6MA 2LGLA 2JUNA 2Y43A 5SVIB 3M62A 4A49A 2FSAA 3VK6A 2KKYA 2YT5A 4UI9B 5I3LA 3DDTA 3PURA 2YYRA 2YSMA 5LKTA 3U5NA 2QIZA 3KV5A 4PPEA 2RI7A 3JUEA 5B79A 4I7DA 4GNEA 4C9ZA 4QF2A 1BORA 3LVRE 5KH3A 3RPGB 3N9LA 2DJAA 1T1HA 2D8SA 3C5KA 4LADB 5D1KB 2CKLB 2YQLA 1LDKC 2E61A 2XB1A 3HCUA 3O35A 1X4JA 2VNFA 3DPLR 2MA5A 1WE9A 2M13A 2YW8A 4OGCA 3O36A 5DKAA 2KR4A 1WEMA 3Q1DA 4L58A 2FD4A 2DX8A 4MVTA 4B86C 2YVRA 4XI1A 2ECGA 1VYXA 2MNYA 4GB0A 3FAOA 3FJUB 2FUUA 5LCWB 2KWOA 5FERA 1U6GB 4AUQB 2P57A 3H7HA 2MKEA 1HYJA 1E4UA 4P5OB 2ZETC 3EB5A 4YBTA 1DCQA 1X4IA 2PNXA 5B75A 2L7PA 1VFYA 4LKAA 2MD7B 3N9OA 5G0FA 2VPBA 3KNVA 2MD8C 3T6RA 2KU3A 3N9QA 1V87A 1FBVA 2CSYA 3O34A 2LV9A 2H0DA 5LKUA 2LXPC 2JRJA 3FM8C 2FUIA 2DSMA 3SOUA 5H1VA 3U5PA 1WEOA 2ECTA 3KDEC 4AYCA 3MHHA 5SVYA 3GL6A 3PLWA 4FK5A 2YUCA 3U5MA 4R7EA 3ZYQA 4I7BA 1G25A 1F62A 4ZUXU 3HTKC 1WEQA 2QJ0A 2CRRA 4BBQA 3I2DA 5JG6A 1ZBDB 2CSZA 1MBMA 3ZTGA 1WIMA 2OWAA 4YABA 1JM7B 2RSDA 4LJNA 4AYCB 2CONA 1Z6UA 3RPGC 1LDJB 1DVPA 1WEEA 4A0CD 1WILA 3LJUX 4R8PK 4GNFA 4YADA 1VD4A 2HDPA 2YHOA 5H1UA 3DQVR 2XOCA 4QQ4A 5DINA 3QZVA 2M1RA 2M3HA 4YAXA 4YC9A 3E2DA 2ECVA 2ECJA 2L80A 2KGGA 4FO9A 4WZ2A 2JMJA 3ZPVE 2KGIA 3O7AA 3DWDA 2VJEA 3O47A 2G45A 4ZQLA 1RMDA 4LLBA 2YREA 4S3OC 1X4UA 2G6QA 2LRIC 2XOZA 2BAYA 3N9PA 4FIPA 5KH9A 5H1TA 4MSXA 2C2VS 3RTRB 4GNGA 2VJEB 2AN6A 2K16A 5FB0A 3LRQA 4FJCA 2IDAA 4UP0A 2CT2A 4F52B 2YHNA 4N3WA 3MHSA 4L7XA 5TABA 4A4BA 1N87A 2D8UA 2F42A 3T9KA 2NAAA 2VPDA 1WEWA 2OXQC 5FB1A 2LXHC 1MM3A 2YQMA 5TDRA 5TRBA 2EODA 2C2LA 4LK9A 2VPEA 4O64A 1WEPA 2L0BA 2VJFA 4Z0OA 2F6NA 2F6JA 3PUQA 4V3KC 3IHPA 5B78A 2LGVA
chains in the Genus database with same CATH topology
2ECNA 2KREA 4IC3A 2YU4A 2VJFB 3NG2A 2LDRA 5G04B 2YSJA 1FP0A 5AIUA 1MM2A 2Y1NA 2K1JA 2H0DB 2L43A 1Z2QA 2KWJA 5J3XA 1XWHA 3L1XA 2KWKA 3M63A 2LQ6A 3SOXA 2PUYA 2EA6A 5LKZA 3O33A 4AVXA 2YURA 2K4DA 1IYMA 3KQIA 2L75A 5KH7A 3ZNIA 4BHWA 1WENA 1WGMA 5D1MB 1Z60A 3LQJA 2MA6A 2CKLA 4CA1A 5B76A 2JMIA 3N9NA 4GNDA 3ZVYA 3M99A 5AITA 3EB6A 2KIZA 2LGGA 5B8DA 2E6RA 3GV4A 2HYED 2JMDA 1K2FA 2MIQA 1WEVA 3SOWA 5H9MA 3KV6A 2ECWA 1WFKA 3ZVZB 3T7LA 3V43A 3O70A 1HYIA 2MUMA 4QF3A 4YBMA 5TBNA 3HCSA 3L11A 3FL2A 2ECIA 2LGKA 3C6WA 2G43A 3PHDA 2VP7A 4S3OB 5C11A 2LN0A 2M85A 2EGPA 4WA6A 4W4UA 4X3GA 2VPGA 3ASLA 2XEUA 2MNZA 4UP5A 2E6SA 3HCTA 4A4CA 4YBSA 2MT5A 3ZPV1 4ZDTA 2KFTA 3O37A 4NN2A 1WEUA 5FEYA 4WZ3B 2L5UA 5TDWA 3U5OA 2KYUA 5LKXA 3N9MA 4R2YA 5G05B 3LQIA 4IC2A 4I7CA 4WZ0A 4PTBA 2KWNA 5C13A 2UZGA 4CCGX 1JM7A 4N4FA 2K17A 4YATA 2Y1MA 4Q6FA 3LQHA 4TKPB 2I50A 1JOCA 2QICA 5B77A 1CHCA 3SHBA 3L1ZB 2KE1A 4AP4A 5D1LB 1WESA 4V3LC 4B7YC 5EYAF 2M6MA 2LGLA 2Y43A 3M62A 4A49A 2FSAA 3VK6A 2YT5A 4UI9B 5I3LA 3PURA 2YSMA 2YYRA 5LKTA 3U5NA 2QIZA 3KV5A 4PPEA 2RI7A 5B79A 4I7DA 4GNEA 4C9ZA 4QF2A 1BORA 5KH3A 3RPGB 3N9LA 1T1HA 2D8SA 3C5KA 4LADB 5D1KB 2CKLB 2YQLA 1LDKC 2XB1A 3HCUA 3O35A 1X4JA 2VNFA 3DPLR 2MA5A 1WE9A 2YW8A 3O36A 5DKAA 2KR4A 1WEMA 4L58A 4B86C 2DX8A 4MVTA 4XI1A 2ECGA 1VYXA 2MNYA 4GB0A 2FUUA 5LCWB 2KWOA 5FERA 1U6GB 4AUQB 1HYJA 1E4UA 4P5OB 2ZETC 3EB5A 4YBTA 1X4IA 2PNXA 5B75A 1VFYA 4LKAA 2MD7B 3N9OA 5G0FA 2VPBA 3KNVA 2MD8C 3T6RA 2KU3A 3N9QA 1V87A 1FBVA 2CSYA 3O34A 2LV9A 2H0DA 5LKUA 2LXPC 2JRJA 2FUIA 3SOUA 5H1VA 3U5PA 1WEOA 2ECTA 4AYCA 3MHHA 3GL6A 4FK5A 2YUCA 3U5MA 4R7EA 3ZYQA 4I7BA 1G25A 1F62A 4ZUXU 3HTKC 1WEQA 2QJ0A 4BBQA 3I2DA 5JG6A 1ZBDB 2CSZA 3ZTGA 1WIMA 4YABA 1JM7B 2RSDA 4LJNA 4AYCB 1Z6UA 3RPGC 1LDJB 1DVPA 1WEEA 4A0CD 1WILA 4R8PK 4GNFA 4YADA 1VD4A 2HDPA 2YHOA 5H1UA 3DQVR 5DINA 3QZVA 2M1RA 2M3HA 4YAXA 4YC9A 2ECVA 2ECJA 2L80A 2KGGA 4FO9A 4WZ2A 2JMJA 3ZPVE 2KGIA 3O7AA 2VJEA 2G45A 4ZQLA 1RMDA 4LLBA 2YREA 4S3OC 1X4UA 2G6QA 2LRIC 3N9PA 2BAYA 4FIPA 5KH9A 5H1TA 4MSXA 2C2VS 3RTRB 4GNGA 2VJEB 2AN6A 2K16A 5FB0A 3LRQA 4FJCA 2IDAA 4UP0A 2CT2A 4F52B 2YHNA 4N3WA 3MHSA 4L7XA 5TABA 4A4BA 1N87A 2F42A 2NAAA 2VPDA 1WEWA 2OXQC 5FB1A 2LXHC 1MM3A 2YQMA 5TDRA 5TRBA 2EODA 2C2LA 4LK9A 2VPEA 4O64A 1WEPA 2L0BA 2VJFA 2F6NA 2F6JA 3PUQA 4V3KC 3IHPA 5B78A 2LGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECN A;  2KRE A;  4IC3 A;  2YU4 A;  2VJF B;  3NG2 A;  2LDR A;  5G04 B;  2YSJ A;  1FP0 A;  5AIU A;  1MM2 A;  2Y1N A;  2K1J A;  2H0D B;  2L43 A;  1Z2Q A;  2KWJ A;  5J3X A;  1XWH A;  3L1X A;  2KWK A;  3M63 A;  2LQ6 A;  3SOX A;  2PUY A;  2EA6 A;  5LKZ A;  3O33 A;  4AVX A;  2YUR A;  2K4D A;  1IYM A;  3KQI A;  2L75 A;  5KH7 A;  3ZNI A;  4BHW A;  1WEN A;  1WGM A;  5D1M B;  1Z60 A;  3LQJ A;  2MA6 A;  2CKL A;  4CA1 A;  5B76 A;  2JMI A;  3N9N A;  4GND A;  3ZVY A;  3M99 A;  5AIT A;  3EB6 A;  2KIZ A;  2LGG A;  5B8D A;  2E6R A;  3GV4 A;  2HYE D;  2JMD A;  1K2F A;  2MIQ A;  1WEV A;  3SOW A;  5H9M A;  3KV6 A;  2ECW A;  1WFK A;  3ZVZ B;  3T7L A;  3V43 A;  3O70 A;  1HYI A;  2MUM A;  4QF3 A;  4YBM A;  5TBN A;  3HCS A;  3L11 A;  3FL2 A;  2ECI A;  2LGK A;  3C6W A;  2G43 A;  3PHD A;  2VP7 A;  4S3O B;  5C11 A;  2LN0 A;  2M85 A;  2EGP A;  4WA6 A;  4W4U A;  4X3G A;  2VPG A;  3ASL A;  2XEU A;  2MNZ A;  4UP5 A;  2E6S A;  3HCT A;  4A4C A;  4YBS A;  2MT5 A;  3ZPV 1;  4ZDT A;  2KFT A;  3O37 A;  4NN2 A;  1WEU A;  5FEY A;  4WZ3 B;  2L5U A;  5TDW A;  3U5O A;  2KYU A;  5LKX A;  3N9M A;  4R2Y A;  5G05 B;  3LQI A;  4IC2 A;  4I7C A;  4WZ0 A;  4PTB A;  2KWN A;  5C13 A;  2UZG A;  4CCG X;  1JM7 A;  4N4F A;  2K17 A;  4YAT A;  2Y1M A;  4Q6F A;  3LQH A;  4TKP B;  2I50 A;  1JOC A;  2QIC A;  5B77 A;  1CHC A;  3SHB A;  3L1Z B;  2KE1 A;  4AP4 A;  5D1L B;  1WES A;  4V3L C;  4B7Y C;  5EYA F;  2M6M A;  2LGL A;  2Y43 A;  3M62 A;  4A49 A;  2FSA A;  3VK6 A;  2YT5 A;  4UI9 B;  5I3L A;  3PUR A;  2YSM A;  2YYR A;  5LKT A;  3U5N A;  2QIZ A;  3KV5 A;  4PPE A;  2RI7 A;  5B79 A;  4I7D A;  4GNE A;  4C9Z A;  4QF2 A;  1BOR A;  5KH3 A;  3RPG B;  3N9L A;  1T1H A;  2D8S A;  3C5K A;  4LAD B;  5D1K B;  2CKL B;  2YQL A;  1LDK C;  2XB1 A;  3HCU A;  3O35 A;  1X4J A;  2VNF A;  3DPL R;  2MA5 A;  1WE9 A;  2YW8 A;  3O36 A;  5DKA A;  2KR4 A;  1WEM A;  4L58 A;  4B86 C;  2DX8 A;  4MVT A;  4XI1 A;  2ECG A;  1VYX A;  2MNY A;  4GB0 A;  2FUU A;  5LCW B;  2KWO A;  5FER A;  1U6G B;  4AUQ B;  1HYJ A;  1E4U A;  4P5O B;  2ZET C;  3EB5 A;  4YBT A;  1X4I A;  2PNX A;  5B75 A;  1VFY A;  4LKA A;  2MD7 B;  3N9O A;  5G0F A;  2VPB A;  3KNV A;  2MD8 C;  3T6R A;  2KU3 A;  3N9Q A;  1V87 A;  1FBV A;  2CSY A;  3O34 A;  2LV9 A;  2H0D A;  5LKU A;  2LXP C;  2JRJ A;  2FUI A;  3SOU A;  5H1V A;  3U5P A;  1WEO A;  2ECT A;  4AYC A;  3MHH A;  3GL6 A;  4FK5 A;  2YUC A;  3U5M A;  4R7E A;  3ZYQ A;  4I7B A;  1G25 A;  1F62 A;  4ZUX U;  3HTK C;  1WEQ A;  2QJ0 A;  4BBQ A;  3I2D A;  5JG6 A;  1ZBD B;  2CSZ A;  3ZTG A;  1WIM A;  4YAB A;  1JM7 B;  2RSD A;  4LJN A;  4AYC B;  1Z6U A;  3RPG C;  1LDJ B;  1DVP A;  1WEE A;  4A0C D;  1WIL A;  4R8P K;  4GNF A;  4YAD A;  1VD4 A;  2HDP A;  2YHO A;  5H1U A;  3DQV R;  5DIN A;  3QZV A;  2M1R A;  2M3H A;  4YAX A;  4YC9 A;  2ECV A;  2ECJ A;  2L80 A;  2KGG A;  4FO9 A;  4WZ2 A;  2JMJ A;  3ZPV E;  2KGI A;  3O7A A;  2VJE A;  2G45 A;  4ZQL A;  1RMD A;  4LLB A;  2YRE A;  4S3O C;  1X4U A;  2G6Q A;  2LRI C;  3N9P A;  2BAY A;  4FIP A;  5KH9 A;  5H1T A;  4MSX A;  2C2V S;  3RTR B;  4GNG A;  2VJE B;  2AN6 A;  2K16 A;  5FB0 A;  3LRQ A;  4FJC A;  2IDA A;  4UP0 A;  2CT2 A;  4F52 B;  2YHN A;  4N3W A;  3MHS A;  4L7X A;  5TAB A;  4A4B A;  1N87 A;  2F42 A;  2NAA A;  2VPD A;  1WEW A;  2OXQ C;  5FB1 A;  2LXH C;  1MM3 A;  2YQM A;  5TDR A;  5TRB A;  2EOD A;  2C2L A;  4LK9 A;  2VPE A;  4O64 A;  1WEP A;  2L0B A;  2VJF A;  2F6N A;  2F6J A;  3PUQ A;  4V3K C;  3IHP A;  5B78 A;  2LGV A; 
#chains in the Genus database with same CATH topology
 2ECN A;  2KRE A;  4IC3 A;  2YU4 A;  2EGM A;  2VJF B;  3NG2 A;  2LDR A;  5G04 B;  2YSJ A;  1FP0 A;  5AIU A;  1MM2 A;  2Y1N A;  2K1J A;  2H0D B;  2L43 A;  2B0O E;  1Z2Q A;  2KWJ A;  5J3X A;  1XWH A;  3L1X A;  2KWK A;  3M63 A;  5SVI A;  2LQ6 A;  3SOX A;  2PUY A;  4OGE A;  2EA6 A;  5LKZ A;  3O33 A;  4AVX A;  2LAU A;  2YUR A;  2K4D A;  1IYM A;  3KQI A;  2L75 A;  5KH7 A;  3ZNI A;  4BHW A;  1WEN A;  1WGM A;  5D1M B;  1Z60 A;  2FFW A;  3LQJ A;  2MA6 A;  2CSV A;  2CKL A;  4CA1 A;  5B76 A;  2JMI A;  3N9N A;  4GND A;  3ZVY A;  2RR4 A;  3FEH A;  5K3Q A;  3M99 A;  5AIT A;  3EB6 A;  4H9D A;  2KIZ A;  2LGG A;  5B8D A;  2E6R A;  3GV4 A;  2HYE D;  2JMD A;  3FAN A;  1K2F A;  2MIQ A;  1WEV A;  3SOW A;  5H9M A;  3KV6 A;  2ECW A;  1WFK A;  3ZVZ B;  2EXU A;  3T7L A;  3V43 A;  3O70 A;  1HYI A;  2MUM A;  2JM3 A;  4QF3 A;  4YBM A;  5TBN A;  3HCS A;  3L11 A;  3FL2 A;  2ECI A;  2LGK A;  3C6W A;  2G43 A;  3PHD A;  3LVQ E;  2VP7 A;  2IQJ A;  4S3O B;  5C11 A;  2LN0 A;  2M85 A;  2EGP A;  4WA6 A;  4W4U A;  4X3G A;  4F1P A;  5SVX A;  2VPG A;  3ASL A;  2XEU A;  2MNZ A;  4UP5 A;  2E6S A;  3HCT A;  4A4C A;  4YBS A;  2MT5 A;  3ZPV 1;  4Z0R A;  4ZDT A;  2KFT A;  4NN2 A;  3O37 A;  1WEU A;  5FEY A;  4WZ3 B;  2L5U A;  5TDW A;  3U5O A;  2KYU A;  5LKX A;  3N9M A;  4R2Y A;  3SUB A;  5G05 B;  3LQI A;  4IC2 A;  4I7C A;  4PTB A;  4WZ0 A;  2KWN A;  2KKX A;  5C13 A;  2UZG A;  4CCG X;  1JM7 A;  4N4F A;  2K17 A;  4YAT A;  2CRW A;  2Y1M A;  4Q6F A;  3LQH A;  4TKP B;  2I50 A;  1JOC A;  2QIC A;  5B77 A;  1CHC A;  3SHB A;  2XP0 A;  3L1Z B;  4O62 A;  2KE1 A;  4AP4 A;  5D1L B;  1WES A;  2XOY A;  4V3L C;  4B7Y C;  5EYA F;  3MDB C;  3LDY A;  3M7K A;  2M6M A;  2LGL A;  2JUN A;  2Y43 A;  5SVI B;  3M62 A;  4A49 A;  2FSA A;  3VK6 A;  2KKY A;  2YT5 A;  4UI9 B;  5I3L A;  3DDT A;  3PUR A;  2YYR A;  2YSM A;  5LKT A;  3U5N A;  2QIZ A;  3KV5 A;  4PPE A;  2RI7 A;  3JUE A;  5B79 A;  4I7D A;  4GNE A;  4C9Z A;  4QF2 A;  1BOR A;  3LVR E;  5KH3 A;  3RPG B;  3N9L A;  2DJA A;  1T1H A;  2D8S A;  3C5K A;  4LAD B;  5D1K B;  2CKL B;  2YQL A;  1LDK C;  2E61 A;  2XB1 A;  3HCU A;  3O35 A;  1X4J A;  2VNF A;  3DPL R;  2MA5 A;  1WE9 A;  2M13 A;  2YW8 A;  4OGC A;  3O36 A;  5DKA A;  2KR4 A;  1WEM A;  3Q1D A;  4L58 A;  2FD4 A;  2DX8 A;  4MVT A;  4B86 C;  2YVR A;  4XI1 A;  2ECG A;  1VYX A;  2MNY A;  4GB0 A;  3FAO A;  3FJU B;  2FUU A;  5LCW B;  2KWO A;  5FER A;  1U6G B;  4AUQ B;  2P57 A;  3H7H A;  2MKE A;  1HYJ A;  1E4U A;  4P5O B;  2ZET C;  3EB5 A;  4YBT A;  1DCQ A;  1X4I A;  2PNX A;  5B75 A;  2L7P A;  1VFY A;  4LKA A;  2MD7 B;  3N9O A;  5G0F A;  2VPB A;  3KNV A;  2MD8 C;  3T6R A;  2KU3 A;  3N9Q A;  1V87 A;  1FBV A;  2CSY A;  3O34 A;  2LV9 A;  2H0D A;  5LKU A;  2LXP C;  2JRJ A;  3FM8 C;  2FUI A;  2DSM A;  3SOU A;  5H1V A;  3U5P A;  1WEO A;  2ECT A;  3KDE C;  4AYC A;  3MHH A;  5SVY A;  3GL6 A;  3PLW A;  4FK5 A;  2YUC A;  3U5M A;  4R7E A;  3ZYQ A;  4I7B A;  1G25 A;  1F62 A;  4ZUX U;  3HTK C;  1WEQ A;  2QJ0 A;  2CRR A;  4BBQ A;  3I2D A;  5JG6 A;  1ZBD B;  2CSZ A;  1MBM A;  3ZTG A;  1WIM A;  2OWA A;  4YAB A;  1JM7 B;  2RSD A;  4LJN A;  4AYC B;  2CON A;  1Z6U A;  3RPG C;  1LDJ B;  1DVP A;  1WEE A;  4A0C D;  1WIL A;  3LJU X;  4R8P K;  4GNF A;  4YAD A;  1VD4 A;  2HDP A;  2YHO A;  5H1U A;  3DQV R;  2XOC A;  4QQ4 A;  5DIN A;  3QZV A;  2M1R A;  2M3H A;  4YAX A;  4YC9 A;  3E2D A;  2ECV A;  2ECJ A;  2L80 A;  2KGG A;  4FO9 A;  4WZ2 A;  2JMJ A;  3ZPV E;  2KGI A;  3O7A A;  3DWD A;  2VJE A;  3O47 A;  2G45 A;  4ZQL A;  1RMD A;  4LLB A;  2YRE A;  4S3O C;  1X4U A;  2G6Q A;  2LRI C;  2XOZ A;  2BAY A;  3N9P A;  4FIP A;  5KH9 A;  5H1T A;  4MSX A;  2C2V S;  3RTR B;  4GNG A;  2VJE B;  2AN6 A;  2K16 A;  5FB0 A;  3LRQ A;  4FJC A;  2IDA A;  4UP0 A;  2CT2 A;  4F52 B;  2YHN A;  4N3W A;  3MHS A;  4L7X A;  5TAB A;  4A4B A;  1N87 A;  2D8U A;  2F42 A;  3T9K A;  2NAA A;  2VPD A;  1WEW A;  2OXQ C;  5FB1 A;  2LXH C;  1MM3 A;  2YQM A;  5TDR A;  5TRB A;  2EOD A;  2C2L A;  4LK9 A;  2VPE A;  4O64 A;  1WEP A;  2L0B A;  2VJF A;  4Z0O A;  2F6N A;  2F6J A;  3PUQ A;  4V3K C;  3IHP A;  5B78 A;  2LGV A; 
#chains in the Genus database with same CATH homology
 2ECN A;  2KRE A;  4IC3 A;  2YU4 A;  2VJF B;  3NG2 A;  2LDR A;  5G04 B;  2YSJ A;  1FP0 A;  5AIU A;  1MM2 A;  2Y1N A;  2K1J A;  2H0D B;  2L43 A;  1Z2Q A;  2KWJ A;  5J3X A;  1XWH A;  3L1X A;  2KWK A;  3M63 A;  2LQ6 A;  3SOX A;  2PUY A;  2EA6 A;  5LKZ A;  3O33 A;  4AVX A;  2YUR A;  2K4D A;  1IYM A;  3KQI A;  2L75 A;  5KH7 A;  3ZNI A;  4BHW A;  1WEN A;  1WGM A;  5D1M B;  1Z60 A;  3LQJ A;  2MA6 A;  2CKL A;  4CA1 A;  5B76 A;  2JMI A;  3N9N A;  4GND A;  3ZVY A;  3M99 A;  5AIT A;  3EB6 A;  2KIZ A;  2LGG A;  5B8D A;  2E6R A;  3GV4 A;  2HYE D;  2JMD A;  1K2F A;  2MIQ A;  1WEV A;  3SOW A;  5H9M A;  3KV6 A;  2ECW A;  1WFK A;  3ZVZ B;  3T7L A;  3V43 A;  3O70 A;  1HYI A;  2MUM A;  4QF3 A;  4YBM A;  5TBN A;  3HCS A;  3L11 A;  3FL2 A;  2ECI A;  2LGK A;  3C6W A;  2G43 A;  3PHD A;  2VP7 A;  4S3O B;  5C11 A;  2LN0 A;  2M85 A;  2EGP A;  4WA6 A;  4W4U A;  4X3G A;  2VPG A;  3ASL A;  2XEU A;  2MNZ A;  4UP5 A;  2E6S A;  3HCT A;  4A4C A;  4YBS A;  2MT5 A;  3ZPV 1;  4ZDT A;  2KFT A;  3O37 A;  4NN2 A;  1WEU A;  5FEY A;  4WZ3 B;  2L5U A;  5TDW A;  3U5O A;  2KYU A;  5LKX A;  3N9M A;  4R2Y A;  5G05 B;  3LQI A;  4IC2 A;  4I7C A;  4WZ0 A;  4PTB A;  2KWN A;  5C13 A;  2UZG A;  4CCG X;  1JM7 A;  4N4F A;  2K17 A;  4YAT A;  2Y1M A;  4Q6F A;  3LQH A;  4TKP B;  2I50 A;  1JOC A;  2QIC A;  5B77 A;  1CHC A;  3SHB A;  3L1Z B;  2KE1 A;  4AP4 A;  5D1L B;  1WES A;  4V3L C;  4B7Y C;  5EYA F;  2M6M A;  2LGL A;  2Y43 A;  3M62 A;  4A49 A;  2FSA A;  3VK6 A;  2YT5 A;  4UI9 B;  5I3L A;  3PUR A;  2YSM A;  2YYR A;  5LKT A;  3U5N A;  2QIZ A;  3KV5 A;  4PPE A;  2RI7 A;  5B79 A;  4I7D A;  4GNE A;  4C9Z A;  4QF2 A;  1BOR A;  5KH3 A;  3RPG B;  3N9L A;  1T1H A;  2D8S A;  3C5K A;  4LAD B;  5D1K B;  2CKL B;  2YQL A;  1LDK C;  2XB1 A;  3HCU A;  3O35 A;  1X4J A;  2VNF A;  3DPL R;  2MA5 A;  1WE9 A;  2YW8 A;  3O36 A;  5DKA A;  2KR4 A;  1WEM A;  4L58 A;  4B86 C;  2DX8 A;  4MVT A;  4XI1 A;  2ECG A;  1VYX A;  2MNY A;  4GB0 A;  2FUU A;  5LCW B;  2KWO A;  5FER A;  1U6G B;  4AUQ B;  1HYJ A;  1E4U A;  4P5O B;  2ZET C;  3EB5 A;  4YBT A;  1X4I A;  2PNX A;  5B75 A;  1VFY A;  4LKA A;  2MD7 B;  3N9O A;  5G0F A;  2VPB A;  3KNV A;  2MD8 C;  3T6R A;  2KU3 A;  3N9Q A;  1V87 A;  1FBV A;  2CSY A;  3O34 A;  2LV9 A;  2H0D A;  5LKU A;  2LXP C;  2JRJ A;  2FUI A;  3SOU A;  5H1V A;  3U5P A;  1WEO A;  2ECT A;  4AYC A;  3MHH A;  3GL6 A;  4FK5 A;  2YUC A;  3U5M A;  4R7E A;  3ZYQ A;  4I7B A;  1G25 A;  1F62 A;  4ZUX U;  3HTK C;  1WEQ A;  2QJ0 A;  4BBQ A;  3I2D A;  5JG6 A;  1ZBD B;  2CSZ A;  3ZTG A;  1WIM A;  4YAB A;  1JM7 B;  2RSD A;  4LJN A;  4AYC B;  1Z6U A;  3RPG C;  1LDJ B;  1DVP A;  1WEE A;  4A0C D;  1WIL A;  4R8P K;  4GNF A;  4YAD A;  1VD4 A;  2HDP A;  2YHO A;  5H1U A;  3DQV R;  5DIN A;  3QZV A;  2M1R A;  2M3H A;  4YAX A;  4YC9 A;  2ECV A;  2ECJ A;  2L80 A;  2KGG A;  4FO9 A;  4WZ2 A;  2JMJ A;  3ZPV E;  2KGI A;  3O7A A;  2VJE A;  2G45 A;  4ZQL A;  1RMD A;  4LLB A;  2YRE A;  4S3O C;  1X4U A;  2G6Q A;  2LRI C;  3N9P A;  2BAY A;  4FIP A;  5KH9 A;  5H1T A;  4MSX A;  2C2V S;  3RTR B;  4GNG A;  2VJE B;  2AN6 A;  2K16 A;  5FB0 A;  3LRQ A;  4FJC A;  2IDA A;  4UP0 A;  2CT2 A;  4F52 B;  2YHN A;  4N3W A;  3MHS A;  4L7X A;  5TAB A;  4A4B A;  1N87 A;  2F42 A;  2NAA A;  2VPD A;  1WEW A;  2OXQ C;  5FB1 A;  2LXH C;  1MM3 A;  2YQM A;  5TDR A;  5TRB A;  2EOD A;  2C2L A;  4LK9 A;  2VPE A;  4O64 A;  1WEP A;  2L0B A;  2VJF A;  2F6N A;  2F6J A;  3PUQ A;  4V3K C;  3IHP A;  5B78 A;  2LGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...