2LGKA

Nmr structure of uhrf1 phd domains in a complex with histone h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgkA00
4FK5A 2JMIA 4GNEA 3PURA 1FBVA 4YATA 2L75A 3N9NA 4I7DA 1BORA 1N87A 5DKAA 2H0DB 3VK6A 2VNFA 4S3OB 2F6NA 3U5PA 4F52B 1HYJA 2RSDA 2VP7A 4AYCB 1VFYA 4UI9B 3DPLR 5LCWB 1WESA 5B75A 1WIMA 4L7XA 4YABA 4LLBA 1WFKA 2LGVA 3FL2A 4TKPB 5KH3A 2G43A 5H1UA 4QF3A 2QICA 3DQVR 5D1LB 3O70A 2LV9A 3C5KA 2E6RA 4C9ZA 2ECNA 1U6GB 1IYMA 4I7CA 3GV4A 1LDJB 1XWHA 4P5OB 1WEWA 3EB5A 4B7YC 3N9PA 1DVPA 5H1VA 1RMDA 2LGLA 5LKUA 2KE1A 3PHDA 5C11A 3ASLA 3MHSA 3O37A 4MVTA 5B78A 4WZ2A 5TDWA 1MM3A 2M85A 1T1HA 4PPEA 2VPEA 2D8SA 2KREA 2F6JA 2QJ0A 2G6QA 4XI1A 2OXQC 2YSJA 5D1MB 4ZDTA 5B76A 2KWKA 4LJNA 2I50A 3KQIA 2DX8A 2M3HA 3RTRB 3ZPV1 3L1XA 2KGIA 4MSXA 4A4BA 3ZNIA 2ECIA 4B86C 3KV5A 2YSMA 5G0FA 4IC3A 4N3WA 2XB1A 3NG2A 1JM7B 1WEPA 2LRIC 3N9LA 4GNDA 4I7BA 2C2LA 2KFTA 2M1RA 1WEOA 5AITA 3M99A 5D1KB 2YQLA 3O7AA 4YAXA 1WEVA 2MD8C 1FP0A 2ECTA 2KGGA 5TRBA 2VPGA 2KR4A 1X4IA 4V3LC 1G25A 4CA1A 1WEQA 5B79A 4PTBA 2IDAA 2MA5A 3KV6A 2MT5A 5DINA 2YURA 2L5UA 3C6WA 4A0CD 4R8PK 2LDRA 2AN6A 2K1JA 3O35A 2VPBA 4AP4A 2C2VS 2CKLB 2NAAA 3GL6A 1WE9A 2YUCA 2JMDA 3T6RA 2VJEA 3L1ZB 5LKXA 5AIUA 2FUUA 1WEEA 4YADA 5KH7A 2YU4A 4AYCA 2HDPA 4S3OC 3I2DA 2ECGA 4FJCA 4L58A 4A49A 2LGKA 3N9QA 2JRJA 4FO9A 2LN0A 4NN2A 2MD7B 3M63A 2MUMA 4GNFA 3N9MA 2MNYA 2YT5A 1Z60A 2ECVA 2EGPA 2VJFA 3IHPA 3U5MA 2KWNA 2VPDA 5C13A 2XEUA 2LGGA 4X3GA 4GB0A 5J3XA 1VD4A 4IC2A 3ZVYA 2KYUA 3LQIA 5TABA 2CT2A 4YBTA 2QIZA 3SOXA 5FB1A 5EYAF 3SHBA 1JOCA 5JG6A 2ZETC 2H0DA 5H9MA 2FSAA 2LQ6A 2Y43A 3SOUA 4LADB 1Z2QA 2L0BA 5I3LA 5FEYA 4ZQLA 4LKAA 2K17A 4R7EA 3LQJA 1WILA 1ZBDB 2YW8A 2YQMA 4V3KC 1X4UA 3HCSA 2KU3A 5TDRA 3RPGC 2KWJA 4N4FA 2JMJA 5H1TA 3ZPVE 4WA6A 2ECJA 3HTKC 3M62A 1WENA 5KH9A 4BBQA 2YHOA 2YREA 3LRQA 2F42A 3ZVZB 1F62A 4GNGA 4O64A 2YYRA 1E4UA 2ECWA 1WGMA 4ZUXU 1MM2A 3L11A 1HYIA 5G04B 1K2FA 3EB6A 4YC9A 4LK9A 1WEUA 3T7LA 2EODA 3ZYQA 4AUQB 2CKLA 2CSZA 5FB0A 2KIZA 1LDKC 2E6SA 3U5NA 2BAYA 4R2YA 2L43A 2VJEB 4A4CA 4Q6FA 2LXHC 4W4UA 3ZTGA 5B77A 4BHWA 3PUQA 2CSYA 3LQHA 2K16A 3MHHA 4QF2A 2FUIA 2LXPC 2L80A 2UZGA 3QZVA 3O33A 2PUYA 5G05B 2MIQA 2Y1MA 3V43A 2YHNA 1JM7A 4WZ3B 2Y1NA 3O34A 2M6MA 4AVXA 2G45A 2HYED 3SOWA 2PNXA 2EA6A 1V87A 2MNZA 2RI7A 3RPGB 1VYXA 5LKTA 5TBNA 4YBMA 3HCUA 2K4DA 4UP5A 5LKZA 1CHCA 4UP0A 2VJFB 1X4JA 4CCGX 3O36A 3N9OA 2KWOA 5B8DA 1WEMA 3HCTA 4FIPA 4WZ0A 1Z6UA 4YBSA 5FERA 3U5OA 3KNVA 2MA6A
chains in the Genus database with same CATH superfamily
4FK5A 2JMIA 4GNEA 5SVXA 3PURA 1FBVA 4YATA 2L75A 3N9NA 4I7DA 3LDYA 1BORA 1N87A 5DKAA 2H0DB 3VK6A 2VNFA 2DJAA 2JM3A 3DWDA 3FM8C 2F6NA 4S3OB 3U5PA 4F52B 1HYJA 2RSDA 2CSVA 2VP7A 4AYCB 1VFYA 4UI9B 3DPLR 5LCWB 3FEHA 1WESA 2MKEA 5B75A 5SVIB 1WIMA 4L7XA 4YABA 4QQ4A 4LLBA 1WFKA 2LGVA 3FL2A 3PLWA 4TKPB 5KH3A 2G43A 4Z0OA 5H1UA 4QF3A 2OWAA 2XOZA 3JUEA 2QICA 3DQVR 5D1LB 3O70A 2LV9A 3C5KA 2E6RA 4C9ZA 2ECNA 1U6GB 1IYMA 4I7CA 3T9KA 3GV4A 1LDJB 1XWHA 4P5OB 1WEWA 3EB5A 4B7YC 3N9PA 1DVPA 5H1VA 1RMDA 2LGLA 5LKUA 2KE1A 3PHDA 5C11A 3ASLA 3MHSA 3O37A 4MVTA 5B78A 4WZ2A 5TDWA 5SVYA 1MM3A 2M85A 1T1HA 2FD4A 4PPEA 2VPEA 2D8SA 2KREA 2F6JA 2QJ0A 2G6QA 4XI1A 2OXQC 2YSJA 5D1MB 4ZDTA 2JUNA 5B76A 2KWKA 4LJNA 2I50A 3KQIA 2DX8A 2D8UA 2M3HA 4Z0RA 3RTRB 3ZPV1 3L1XA 2KGIA 4MSXA 4A4BA 3ZNIA 2ECIA 4B86C 3KV5A 2YSMA 5G0FA 4IC3A 2LAUA 4N3WA 2XB1A 3NG2A 1JM7B 1WEPA 2LRIC 3N9LA 4GNDA 2M13A 4I7BA 3H7HA 2C2LA 2KFTA 2M1RA 1WEOA 5AITA 3M99A 5D1KB 2YQLA 3O7AA 4YAXA 1WEVA 2MD8C 1FP0A 2ECTA 3FAOA 2KGGA 5TRBA 2VPGA 2KR4A 1X4IA 2XOYA 4V3LC 1G25A 2L7PA 4CA1A 1WEQA 3O47A 2CRRA 4PTBA 2IDAA 2MA5A 3KV6A 2MT5A 5DINA 5B79A 2YURA 2L5UA 3C6WA 4A0CD 4R8PK 2LDRA 2AN6A 2K1JA 3O35A 4O62A 2VPBA 4AP4A 2KKYA 2C2VS 4OGCA 2CKLB 2NAAA 3GL6A 1WE9A 2YUCA 2JMDA 3T6RA 3L1ZB 2VJEA 5LKXA 5AIUA 2CONA 2FUUA 1WEEA 1MBMA 4YADA 5KH7A 2YU4A 3LVQE 4AYCA 2HDPA 4S3OC 3I2DA 2ECGA 4FJCA 5SVIA 4L58A 4A49A 3LJUX 2LGKA 3N9QA 2JRJA 4FO9A 2LN0A 2XP0A 4NN2A 2MD7B 3M63A 3Q1DA 2MUMA 4GNFA 3N9MA 2MNYA 2YT5A 1Z60A 2ECVA 2EGPA 2VJFA 3IHPA 3U5MA 2KWNA 2E61A 2VPDA 5C13A 2XEUA 2LGGA 4X3GA 4GB0A 5J3XA 1VD4A 4IC2A 3ZVYA 2KYUA 3LQIA 5TABA 2CT2A 4YBTA 2QIZA 3SOXA 5FB1A 5EYAF 3SHBA 1JOCA 5JG6A 4H9DA 2ZETC 2H0DA 5H9MA 2FSAA 2LQ6A 2Y43A 3SOUA 4LADB 1Z2QA 2YVRA 2L0BA 5I3LA 5FEYA 4ZQLA 4LKAA 2K17A 4R7EA 3LQJA 1WILA 1ZBDB 2YW8A 2YQMA 4V3KC 1X4UA 2P57A 3HCSA 2KU3A 5TDRA 3RPGC 2KWJA 4N4FA 3M7KA 2JMJA 5H1TA 3ZPVE 4WA6A 2ECJA 3HTKC 3M62A 1WENA 2EXUA 5KH9A 4BBQA 2YHOA 2YREA 3LRQA 2F42A 3ZVZB 1F62A 3E2DA 3FJUB 4F1PA 4GNGA 4O64A 2YYRA 1E4UA 2ECWA 1WGMA 4ZUXU 1MM2A 3L11A 1HYIA 5G04B 1K2FA 3EB6A 4YC9A 4LK9A 1WEUA 3T7LA 2EODA 3ZYQA 4AUQB 2B0OE 2CKLA 2CSZA 5FB0A 2KIZA 1LDKC 2E6SA 3U5NA 2BAYA 4R2YA 2L43A 2VJEB 4A4CA 4Q6FA 2FFWA 2LXHC 4W4UA 3ZTGA 5B77A 4BHWA 3KDEC 3PUQA 3SUBA 2CSYA 3LQHA 2K16A 3MHHA 4QF2A 2FUIA 2LXPC 2XOCA 2L80A 2UZGA 3MDBC 3QZVA 2DSMA 3LVRE 3O33A 5K3QA 2PUYA 5G05B 3DDTA 2MIQA 2RR4A 2Y1MA 3V43A 2YHNA 1JM7A 1DCQA 4WZ3B 2Y1NA 3O34A 2CRWA 4OGEA 2M6MA 4AVXA 2G45A 2HYED 3SOWA 2PNXA 2EA6A 1V87A 2MNZA 2RI7A 2KKXA 3RPGB 1VYXA 5LKTA 5TBNA 4YBMA 3HCUA 2K4DA 2EGMA 4UP5A 5LKZA 1CHCA 4UP0A 2VJFB 1X4JA 2IQJA 3FANA 4CCGX 3O36A 3N9OA 2KWOA 5B8DA 1WEMA 3HCTA 4FIPA 4WZ0A 1Z6UA 4YBSA 5FERA 3U5OA 3KNVA 2MA6A
chains in the Genus database with same CATH topology
4FK5A 2JMIA 4GNEA 3PURA 1FBVA 4YATA 2L75A 3N9NA 4I7DA 1BORA 1N87A 5DKAA 2H0DB 3VK6A 2VNFA 4S3OB 2F6NA 3U5PA 4F52B 1HYJA 2RSDA 2VP7A 4AYCB 1VFYA 4UI9B 3DPLR 5LCWB 1WESA 5B75A 1WIMA 4L7XA 4YABA 4LLBA 1WFKA 2LGVA 3FL2A 4TKPB 5KH3A 2G43A 5H1UA 4QF3A 2QICA 3DQVR 5D1LB 3O70A 2LV9A 3C5KA 2E6RA 4C9ZA 2ECNA 1U6GB 1IYMA 4I7CA 3GV4A 1LDJB 1XWHA 4P5OB 1WEWA 3EB5A 4B7YC 3N9PA 1DVPA 5H1VA 1RMDA 2LGLA 5LKUA 2KE1A 3PHDA 5C11A 3ASLA 3MHSA 3O37A 4MVTA 5B78A 4WZ2A 5TDWA 1MM3A 2M85A 1T1HA 4PPEA 2VPEA 2D8SA 2KREA 2F6JA 2QJ0A 2G6QA 4XI1A 2OXQC 2YSJA 5D1MB 4ZDTA 5B76A 2KWKA 4LJNA 2I50A 3KQIA 2DX8A 2M3HA 3RTRB 3ZPV1 3L1XA 2KGIA 4MSXA 4A4BA 3ZNIA 2ECIA 4B86C 3KV5A 2YSMA 5G0FA 4IC3A 4N3WA 2XB1A 3NG2A 1JM7B 1WEPA 2LRIC 3N9LA 4GNDA 4I7BA 2C2LA 2KFTA 2M1RA 1WEOA 5AITA 3M99A 5D1KB 2YQLA 3O7AA 4YAXA 1WEVA 2MD8C 1FP0A 2ECTA 2KGGA 5TRBA 2VPGA 2KR4A 1X4IA 4V3LC 1G25A 4CA1A 1WEQA 5B79A 4PTBA 2IDAA 2MA5A 3KV6A 2MT5A 5DINA 2YURA 2L5UA 3C6WA 4A0CD 4R8PK 2LDRA 2AN6A 2K1JA 3O35A 2VPBA 4AP4A 2C2VS 2CKLB 2NAAA 3GL6A 1WE9A 2YUCA 2JMDA 3T6RA 2VJEA 3L1ZB 5LKXA 5AIUA 2FUUA 1WEEA 4YADA 5KH7A 2YU4A 4AYCA 2HDPA 4S3OC 3I2DA 2ECGA 4FJCA 4L58A 4A49A 2LGKA 3N9QA 2JRJA 4FO9A 2LN0A 4NN2A 2MD7B 3M63A 2MUMA 4GNFA 3N9MA 2MNYA 2YT5A 1Z60A 2ECVA 2EGPA 2VJFA 3IHPA 3U5MA 2KWNA 2VPDA 5C13A 2XEUA 2LGGA 4X3GA 4GB0A 5J3XA 1VD4A 4IC2A 3ZVYA 2KYUA 3LQIA 5TABA 2CT2A 4YBTA 2QIZA 3SOXA 5FB1A 5EYAF 3SHBA 1JOCA 5JG6A 2ZETC 2H0DA 5H9MA 2FSAA 2LQ6A 2Y43A 3SOUA 4LADB 1Z2QA 2L0BA 5I3LA 5FEYA 4ZQLA 4LKAA 2K17A 4R7EA 3LQJA 1WILA 1ZBDB 2YW8A 2YQMA 4V3KC 1X4UA 3HCSA 2KU3A 5TDRA 3RPGC 2KWJA 4N4FA 2JMJA 5H1TA 3ZPVE 4WA6A 2ECJA 3HTKC 3M62A 1WENA 5KH9A 4BBQA 2YHOA 2YREA 3LRQA 2F42A 3ZVZB 1F62A 4GNGA 4O64A 2YYRA 1E4UA 2ECWA 1WGMA 4ZUXU 1MM2A 3L11A 1HYIA 5G04B 1K2FA 3EB6A 4YC9A 4LK9A 1WEUA 3T7LA 2EODA 3ZYQA 4AUQB 2CKLA 2CSZA 5FB0A 2KIZA 1LDKC 2E6SA 3U5NA 2BAYA 4R2YA 2L43A 2VJEB 4A4CA 4Q6FA 2LXHC 4W4UA 3ZTGA 5B77A 4BHWA 3PUQA 2CSYA 3LQHA 2K16A 3MHHA 4QF2A 2FUIA 2LXPC 2L80A 2UZGA 3QZVA 3O33A 2PUYA 5G05B 2MIQA 2Y1MA 3V43A 2YHNA 1JM7A 4WZ3B 2Y1NA 3O34A 2M6MA 4AVXA 2G45A 2HYED 3SOWA 2PNXA 2EA6A 1V87A 2MNZA 2RI7A 3RPGB 1VYXA 5LKTA 5TBNA 4YBMA 3HCUA 2K4DA 4UP5A 5LKZA 1CHCA 4UP0A 2VJFB 1X4JA 4CCGX 3O36A 3N9OA 2KWOA 5B8DA 1WEMA 3HCTA 4FIPA 4WZ0A 1Z6UA 4YBSA 5FERA 3U5OA 3KNVA 2MA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 A;  2JMI A;  4GNE A;  3PUR A;  1FBV A;  4YAT A;  2L75 A;  3N9N A;  4I7D A;  1BOR A;  1N87 A;  5DKA A;  2H0D B;  3VK6 A;  2VNF A;  4S3O B;  2F6N A;  3U5P A;  4F52 B;  1HYJ A;  2RSD A;  2VP7 A;  4AYC B;  1VFY A;  4UI9 B;  3DPL R;  5LCW B;  1WES A;  5B75 A;  1WIM A;  4L7X A;  4YAB A;  4LLB A;  1WFK A;  2LGV A;  3FL2 A;  4TKP B;  5KH3 A;  2G43 A;  5H1U A;  4QF3 A;  2QIC A;  3DQV R;  5D1L B;  3O70 A;  2LV9 A;  3C5K A;  2E6R A;  4C9Z A;  2ECN A;  1U6G B;  1IYM A;  4I7C A;  3GV4 A;  1LDJ B;  1XWH A;  4P5O B;  1WEW A;  3EB5 A;  4B7Y C;  3N9P A;  1DVP A;  5H1V A;  1RMD A;  2LGL A;  5LKU A;  2KE1 A;  3PHD A;  5C11 A;  3ASL A;  3MHS A;  3O37 A;  4MVT A;  5B78 A;  4WZ2 A;  5TDW A;  1MM3 A;  2M85 A;  1T1H A;  4PPE A;  2VPE A;  2D8S A;  2KRE A;  2F6J A;  2QJ0 A;  2G6Q A;  4XI1 A;  2OXQ C;  2YSJ A;  5D1M B;  4ZDT A;  5B76 A;  2KWK A;  4LJN A;  2I50 A;  3KQI A;  2DX8 A;  2M3H A;  3RTR B;  3ZPV 1;  3L1X A;  2KGI A;  4MSX A;  4A4B A;  3ZNI A;  2ECI A;  4B86 C;  3KV5 A;  2YSM A;  5G0F A;  4IC3 A;  4N3W A;  2XB1 A;  3NG2 A;  1JM7 B;  1WEP A;  2LRI C;  3N9L A;  4GND A;  4I7B A;  2C2L A;  2KFT A;  2M1R A;  1WEO A;  5AIT A;  3M99 A;  5D1K B;  2YQL A;  3O7A A;  4YAX A;  1WEV A;  2MD8 C;  1FP0 A;  2ECT A;  2KGG A;  5TRB A;  2VPG A;  2KR4 A;  1X4I A;  4V3L C;  1G25 A;  4CA1 A;  1WEQ A;  5B79 A;  4PTB A;  2IDA A;  2MA5 A;  3KV6 A;  2MT5 A;  5DIN A;  2YUR A;  2L5U A;  3C6W A;  4A0C D;  4R8P K;  2LDR A;  2AN6 A;  2K1J A;  3O35 A;  2VPB A;  4AP4 A;  2C2V S;  2CKL B;  2NAA A;  3GL6 A;  1WE9 A;  2YUC A;  2JMD A;  3T6R A;  2VJE A;  3L1Z B;  5LKX A;  5AIU A;  2FUU A;  1WEE A;  4YAD A;  5KH7 A;  2YU4 A;  4AYC A;  2HDP A;  4S3O C;  3I2D A;  2ECG A;  4FJC A;  4L58 A;  4A49 A;  2LGK A;  3N9Q A;  2JRJ A;  4FO9 A;  2LN0 A;  4NN2 A;  2MD7 B;  3M63 A;  2MUM A;  4GNF A;  3N9M A;  2MNY A;  2YT5 A;  1Z60 A;  2ECV A;  2EGP A;  2VJF A;  3IHP A;  3U5M A;  2KWN A;  2VPD A;  5C13 A;  2XEU A;  2LGG A;  4X3G A;  4GB0 A;  5J3X A;  1VD4 A;  4IC2 A;  3ZVY A;  2KYU A;  3LQI A;  5TAB A;  2CT2 A;  4YBT A;  2QIZ A;  3SOX A;  5FB1 A;  5EYA F;  3SHB A;  1JOC A;  5JG6 A;  2ZET C;  2H0D A;  5H9M A;  2FSA A;  2LQ6 A;  2Y43 A;  3SOU A;  4LAD B;  1Z2Q A;  2L0B A;  5I3L A;  5FEY A;  4ZQL A;  4LKA A;  2K17 A;  4R7E A;  3LQJ A;  1WIL A;  1ZBD B;  2YW8 A;  2YQM A;  4V3K C;  1X4U A;  3HCS A;  2KU3 A;  5TDR A;  3RPG C;  2KWJ A;  4N4F A;  2JMJ A;  5H1T A;  3ZPV E;  4WA6 A;  2ECJ A;  3HTK C;  3M62 A;  1WEN A;  5KH9 A;  4BBQ A;  2YHO A;  2YRE A;  3LRQ A;  2F42 A;  3ZVZ B;  1F62 A;  4GNG A;  4O64 A;  2YYR A;  1E4U A;  2ECW A;  1WGM A;  4ZUX U;  1MM2 A;  3L11 A;  1HYI A;  5G04 B;  1K2F A;  3EB6 A;  4YC9 A;  4LK9 A;  1WEU A;  3T7L A;  2EOD A;  3ZYQ A;  4AUQ B;  2CKL A;  2CSZ A;  5FB0 A;  2KIZ A;  1LDK C;  2E6S A;  3U5N A;  2BAY A;  4R2Y A;  2L43 A;  2VJE B;  4A4C A;  4Q6F A;  2LXH C;  4W4U A;  3ZTG A;  5B77 A;  4BHW A;  3PUQ A;  2CSY A;  3LQH A;  2K16 A;  3MHH A;  4QF2 A;  2FUI A;  2LXP C;  2L80 A;  2UZG A;  3QZV A;  3O33 A;  2PUY A;  5G05 B;  2MIQ A;  2Y1M A;  3V43 A;  2YHN A;  1JM7 A;  4WZ3 B;  2Y1N A;  3O34 A;  2M6M A;  4AVX A;  2G45 A;  2HYE D;  3SOW A;  2PNX A;  2EA6 A;  1V87 A;  2MNZ A;  2RI7 A;  3RPG B;  1VYX A;  5LKT A;  5TBN A;  4YBM A;  3HCU A;  2K4D A;  4UP5 A;  5LKZ A;  1CHC A;  4UP0 A;  2VJF B;  1X4J A;  4CCG X;  3O36 A;  3N9O A;  2KWO A;  5B8D A;  1WEM A;  3HCT A;  4FIP A;  4WZ0 A;  1Z6U A;  4YBS A;  5FER A;  3U5O A;  3KNV A;  2MA6 A; 
#chains in the Genus database with same CATH topology
 4FK5 A;  2JMI A;  4GNE A;  5SVX A;  3PUR A;  1FBV A;  4YAT A;  2L75 A;  3N9N A;  4I7D A;  3LDY A;  1BOR A;  1N87 A;  5DKA A;  2H0D B;  3VK6 A;  2VNF A;  2DJA A;  2JM3 A;  3DWD A;  3FM8 C;  2F6N A;  4S3O B;  3U5P A;  4F52 B;  1HYJ A;  2RSD A;  2CSV A;  2VP7 A;  4AYC B;  1VFY A;  4UI9 B;  3DPL R;  5LCW B;  3FEH A;  1WES A;  2MKE A;  5B75 A;  5SVI B;  1WIM A;  4L7X A;  4YAB A;  4QQ4 A;  4LLB A;  1WFK A;  2LGV A;  3FL2 A;  3PLW A;  4TKP B;  5KH3 A;  2G43 A;  4Z0O A;  5H1U A;  4QF3 A;  2OWA A;  2XOZ A;  3JUE A;  2QIC A;  3DQV R;  5D1L B;  3O70 A;  2LV9 A;  3C5K A;  2E6R A;  4C9Z A;  2ECN A;  1U6G B;  1IYM A;  4I7C A;  3T9K A;  3GV4 A;  1LDJ B;  1XWH A;  4P5O B;  1WEW A;  3EB5 A;  4B7Y C;  3N9P A;  1DVP A;  5H1V A;  1RMD A;  2LGL A;  5LKU A;  2KE1 A;  3PHD A;  5C11 A;  3ASL A;  3MHS A;  3O37 A;  4MVT A;  5B78 A;  4WZ2 A;  5TDW A;  5SVY A;  1MM3 A;  2M85 A;  1T1H A;  2FD4 A;  4PPE A;  2VPE A;  2D8S A;  2KRE A;  2F6J A;  2QJ0 A;  2G6Q A;  4XI1 A;  2OXQ C;  2YSJ A;  5D1M B;  4ZDT A;  2JUN A;  5B76 A;  2KWK A;  4LJN A;  2I50 A;  3KQI A;  2DX8 A;  2D8U A;  2M3H A;  4Z0R A;  3RTR B;  3ZPV 1;  3L1X A;  2KGI A;  4MSX A;  4A4B A;  3ZNI A;  2ECI A;  4B86 C;  3KV5 A;  2YSM A;  5G0F A;  4IC3 A;  2LAU A;  4N3W A;  2XB1 A;  3NG2 A;  1JM7 B;  1WEP A;  2LRI C;  3N9L A;  4GND A;  2M13 A;  4I7B A;  3H7H A;  2C2L A;  2KFT A;  2M1R A;  1WEO A;  5AIT A;  3M99 A;  5D1K B;  2YQL A;  3O7A A;  4YAX A;  1WEV A;  2MD8 C;  1FP0 A;  2ECT A;  3FAO A;  2KGG A;  5TRB A;  2VPG A;  2KR4 A;  1X4I A;  2XOY A;  4V3L C;  1G25 A;  2L7P A;  4CA1 A;  1WEQ A;  3O47 A;  2CRR A;  4PTB A;  2IDA A;  2MA5 A;  3KV6 A;  2MT5 A;  5DIN A;  5B79 A;  2YUR A;  2L5U A;  3C6W A;  4A0C D;  4R8P K;  2LDR A;  2AN6 A;  2K1J A;  3O35 A;  4O62 A;  2VPB A;  4AP4 A;  2KKY A;  2C2V S;  4OGC A;  2CKL B;  2NAA A;  3GL6 A;  1WE9 A;  2YUC A;  2JMD A;  3T6R A;  3L1Z B;  2VJE A;  5LKX A;  5AIU A;  2CON A;  2FUU A;  1WEE A;  1MBM A;  4YAD A;  5KH7 A;  2YU4 A;  3LVQ E;  4AYC A;  2HDP A;  4S3O C;  3I2D A;  2ECG A;  4FJC A;  5SVI A;  4L58 A;  4A49 A;  3LJU X;  2LGK A;  3N9Q A;  2JRJ A;  4FO9 A;  2LN0 A;  2XP0 A;  4NN2 A;  2MD7 B;  3M63 A;  3Q1D A;  2MUM A;  4GNF A;  3N9M A;  2MNY A;  2YT5 A;  1Z60 A;  2ECV A;  2EGP A;  2VJF A;  3IHP A;  3U5M A;  2KWN A;  2E61 A;  2VPD A;  5C13 A;  2XEU A;  2LGG A;  4X3G A;  4GB0 A;  5J3X A;  1VD4 A;  4IC2 A;  3ZVY A;  2KYU A;  3LQI A;  5TAB A;  2CT2 A;  4YBT A;  2QIZ A;  3SOX A;  5FB1 A;  5EYA F;  3SHB A;  1JOC A;  5JG6 A;  4H9D A;  2ZET C;  2H0D A;  5H9M A;  2FSA A;  2LQ6 A;  2Y43 A;  3SOU A;  4LAD B;  1Z2Q A;  2YVR A;  2L0B A;  5I3L A;  5FEY A;  4ZQL A;  4LKA A;  2K17 A;  4R7E A;  3LQJ A;  1WIL A;  1ZBD B;  2YW8 A;  2YQM A;  4V3K C;  1X4U A;  2P57 A;  3HCS A;  2KU3 A;  5TDR A;  3RPG C;  2KWJ A;  4N4F A;  3M7K A;  2JMJ A;  5H1T A;  3ZPV E;  4WA6 A;  2ECJ A;  3HTK C;  3M62 A;  1WEN A;  2EXU A;  5KH9 A;  4BBQ A;  2YHO A;  2YRE A;  3LRQ A;  2F42 A;  3ZVZ B;  1F62 A;  3E2D A;  3FJU B;  4F1P A;  4GNG A;  4O64 A;  2YYR A;  1E4U A;  2ECW A;  1WGM A;  4ZUX U;  1MM2 A;  3L11 A;  1HYI A;  5G04 B;  1K2F A;  3EB6 A;  4YC9 A;  4LK9 A;  1WEU A;  3T7L A;  2EOD A;  3ZYQ A;  4AUQ B;  2B0O E;  2CKL A;  2CSZ A;  5FB0 A;  2KIZ A;  1LDK C;  2E6S A;  3U5N A;  2BAY A;  4R2Y A;  2L43 A;  2VJE B;  4A4C A;  4Q6F A;  2FFW A;  2LXH C;  4W4U A;  3ZTG A;  5B77 A;  4BHW A;  3KDE C;  3PUQ A;  3SUB A;  2CSY A;  3LQH A;  2K16 A;  3MHH A;  4QF2 A;  2FUI A;  2LXP C;  2XOC A;  2L80 A;  2UZG A;  3MDB C;  3QZV A;  2DSM A;  3LVR E;  3O33 A;  5K3Q A;  2PUY A;  5G05 B;  3DDT A;  2MIQ A;  2RR4 A;  2Y1M A;  3V43 A;  2YHN A;  1JM7 A;  1DCQ A;  4WZ3 B;  2Y1N A;  3O34 A;  2CRW A;  4OGE A;  2M6M A;  4AVX A;  2G45 A;  2HYE D;  3SOW A;  2PNX A;  2EA6 A;  1V87 A;  2MNZ A;  2RI7 A;  2KKX A;  3RPG B;  1VYX A;  5LKT A;  5TBN A;  4YBM A;  3HCU A;  2K4D A;  2EGM A;  4UP5 A;  5LKZ A;  1CHC A;  4UP0 A;  2VJF B;  1X4J A;  2IQJ A;  3FAN A;  4CCG X;  3O36 A;  3N9O A;  2KWO A;  5B8D A;  1WEM A;  3HCT A;  4FIP A;  4WZ0 A;  1Z6U A;  4YBS A;  5FER A;  3U5O A;  3KNV A;  2MA6 A; 
#chains in the Genus database with same CATH homology
 4FK5 A;  2JMI A;  4GNE A;  3PUR A;  1FBV A;  4YAT A;  2L75 A;  3N9N A;  4I7D A;  1BOR A;  1N87 A;  5DKA A;  2H0D B;  3VK6 A;  2VNF A;  4S3O B;  2F6N A;  3U5P A;  4F52 B;  1HYJ A;  2RSD A;  2VP7 A;  4AYC B;  1VFY A;  4UI9 B;  3DPL R;  5LCW B;  1WES A;  5B75 A;  1WIM A;  4L7X A;  4YAB A;  4LLB A;  1WFK A;  2LGV A;  3FL2 A;  4TKP B;  5KH3 A;  2G43 A;  5H1U A;  4QF3 A;  2QIC A;  3DQV R;  5D1L B;  3O70 A;  2LV9 A;  3C5K A;  2E6R A;  4C9Z A;  2ECN A;  1U6G B;  1IYM A;  4I7C A;  3GV4 A;  1LDJ B;  1XWH A;  4P5O B;  1WEW A;  3EB5 A;  4B7Y C;  3N9P A;  1DVP A;  5H1V A;  1RMD A;  2LGL A;  5LKU A;  2KE1 A;  3PHD A;  5C11 A;  3ASL A;  3MHS A;  3O37 A;  4MVT A;  5B78 A;  4WZ2 A;  5TDW A;  1MM3 A;  2M85 A;  1T1H A;  4PPE A;  2VPE A;  2D8S A;  2KRE A;  2F6J A;  2QJ0 A;  2G6Q A;  4XI1 A;  2OXQ C;  2YSJ A;  5D1M B;  4ZDT A;  5B76 A;  2KWK A;  4LJN A;  2I50 A;  3KQI A;  2DX8 A;  2M3H A;  3RTR B;  3ZPV 1;  3L1X A;  2KGI A;  4MSX A;  4A4B A;  3ZNI A;  2ECI A;  4B86 C;  3KV5 A;  2YSM A;  5G0F A;  4IC3 A;  4N3W A;  2XB1 A;  3NG2 A;  1JM7 B;  1WEP A;  2LRI C;  3N9L A;  4GND A;  4I7B A;  2C2L A;  2KFT A;  2M1R A;  1WEO A;  5AIT A;  3M99 A;  5D1K B;  2YQL A;  3O7A A;  4YAX A;  1WEV A;  2MD8 C;  1FP0 A;  2ECT A;  2KGG A;  5TRB A;  2VPG A;  2KR4 A;  1X4I A;  4V3L C;  1G25 A;  4CA1 A;  1WEQ A;  5B79 A;  4PTB A;  2IDA A;  2MA5 A;  3KV6 A;  2MT5 A;  5DIN A;  2YUR A;  2L5U A;  3C6W A;  4A0C D;  4R8P K;  2LDR A;  2AN6 A;  2K1J A;  3O35 A;  2VPB A;  4AP4 A;  2C2V S;  2CKL B;  2NAA A;  3GL6 A;  1WE9 A;  2YUC A;  2JMD A;  3T6R A;  2VJE A;  3L1Z B;  5LKX A;  5AIU A;  2FUU A;  1WEE A;  4YAD A;  5KH7 A;  2YU4 A;  4AYC A;  2HDP A;  4S3O C;  3I2D A;  2ECG A;  4FJC A;  4L58 A;  4A49 A;  2LGK A;  3N9Q A;  2JRJ A;  4FO9 A;  2LN0 A;  4NN2 A;  2MD7 B;  3M63 A;  2MUM A;  4GNF A;  3N9M A;  2MNY A;  2YT5 A;  1Z60 A;  2ECV A;  2EGP A;  2VJF A;  3IHP A;  3U5M A;  2KWN A;  2VPD A;  5C13 A;  2XEU A;  2LGG A;  4X3G A;  4GB0 A;  5J3X A;  1VD4 A;  4IC2 A;  3ZVY A;  2KYU A;  3LQI A;  5TAB A;  2CT2 A;  4YBT A;  2QIZ A;  3SOX A;  5FB1 A;  5EYA F;  3SHB A;  1JOC A;  5JG6 A;  2ZET C;  2H0D A;  5H9M A;  2FSA A;  2LQ6 A;  2Y43 A;  3SOU A;  4LAD B;  1Z2Q A;  2L0B A;  5I3L A;  5FEY A;  4ZQL A;  4LKA A;  2K17 A;  4R7E A;  3LQJ A;  1WIL A;  1ZBD B;  2YW8 A;  2YQM A;  4V3K C;  1X4U A;  3HCS A;  2KU3 A;  5TDR A;  3RPG C;  2KWJ A;  4N4F A;  2JMJ A;  5H1T A;  3ZPV E;  4WA6 A;  2ECJ A;  3HTK C;  3M62 A;  1WEN A;  5KH9 A;  4BBQ A;  2YHO A;  2YRE A;  3LRQ A;  2F42 A;  3ZVZ B;  1F62 A;  4GNG A;  4O64 A;  2YYR A;  1E4U A;  2ECW A;  1WGM A;  4ZUX U;  1MM2 A;  3L11 A;  1HYI A;  5G04 B;  1K2F A;  3EB6 A;  4YC9 A;  4LK9 A;  1WEU A;  3T7L A;  2EOD A;  3ZYQ A;  4AUQ B;  2CKL A;  2CSZ A;  5FB0 A;  2KIZ A;  1LDK C;  2E6S A;  3U5N A;  2BAY A;  4R2Y A;  2L43 A;  2VJE B;  4A4C A;  4Q6F A;  2LXH C;  4W4U A;  3ZTG A;  5B77 A;  4BHW A;  3PUQ A;  2CSY A;  3LQH A;  2K16 A;  3MHH A;  4QF2 A;  2FUI A;  2LXP C;  2L80 A;  2UZG A;  3QZV A;  3O33 A;  2PUY A;  5G05 B;  2MIQ A;  2Y1M A;  3V43 A;  2YHN A;  1JM7 A;  4WZ3 B;  2Y1N A;  3O34 A;  2M6M A;  4AVX A;  2G45 A;  2HYE D;  3SOW A;  2PNX A;  2EA6 A;  1V87 A;  2MNZ A;  2RI7 A;  3RPG B;  1VYX A;  5LKT A;  5TBN A;  4YBM A;  3HCU A;  2K4D A;  4UP5 A;  5LKZ A;  1CHC A;  4UP0 A;  2VJF B;  1X4J A;  4CCG X;  3O36 A;  3N9O A;  2KWO A;  5B8D A;  1WEM A;  3HCT A;  4FIP A;  4WZ0 A;  1Z6U A;  4YBS A;  5FER A;  3U5O A;  3KNV A;  2MA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...