2LGKA

Nmr structure of uhrf1 phd domains in a complex with histone h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgkA00
5AITA 2PNXA 2MNZA 1WE9A 4I7CA 2VJFB 3L1XA 1Z6UA 3M62A 1LDKC 4ZQLA 4L58A 3LQHA 4GNGA 2MUMA 3LQIA 2HYED 4R2YA 5AIUA 5C11A 2YURA 4L7XA 2M3HA 2CKLB 1WESA 2VJFA 2LGGA 3O35A 2KE1A 4XI1A 3RTRB 3T6RA 5LKTA 5B79A 4LADB 1JOCA 5FB0A 5LCWB 4MSXA 5DINA 1DVPA 2KIZA 2XB1A 2YREA 1WEOA 2MA5A 3IHPA 3N9QA 5C13A 5TDRA 2QICA 4BHWA 2LQ6A 3L11A 3KV5A 2MD7B 1RMDA 4YC9A 2F6NA 3M99A 4AUQB 2QJ0A 2YSMA 2VPGA 2K4DA 2HDPA 2CSZA 3N9PA 5D1KB 2KWNA 2LXHC 1WEQA 2LGKA 4P5OB 1FBVA 4FIPA 2YU4A 3L1ZB 4QF3A 2XEUA 2YYRA 4FJCA 5B8DA 4NN2A 2LN0A 1HYJA 4YADA 4F52B 2F6JA 1MM3A 1WEEA 2VP7A 5D1LB 1N87A 4WA6A 4AVXA 4B86C 2KU3A 3QZVA 2ECVA 3ZYQA 2EODA 5LKZA 2H0DB 1X4UA 4YBTA 4S3OB 2K17A 2MT5A 4A49A 2L5UA 4O64A 2VPBA 4YBMA 3RPGC 5D1MB 2YUCA 5JG6A 2Y43A 2KGGA 2FUIA 4WZ3B 4MVTA 4A4CA 2G45A 2KWJA 3O33A 2M6MA 5B75A 1V87A 1WEPA 2L43A 2L0BA 2UZGA 2FSAA 1X4IA 2JRJA 5G0FA 5H9MA 4GNDA 2KWOA 1MM2A 3FL2A 3I2DA 2OXQC 2KGIA 3DQVR 1T1HA 3PURA 1CHCA 2M85A 3PHDA 2DX8A 4UP0A 3LQJA 3C5KA 2JMJA 4IC3A 2CKLA 2F42A 2EGPA 3N9MA 2VJEB 3KNVA 2MD8C 2NAAA 2KYUA 3SOWA 1FP0A 3EB6A 1F62A 3GV4A 4I7DA 4B7YC 2YSJA 2ECWA 2BAYA 4FK5A 2CSYA 4YATA 5TABA 3U5MA 1K2FA 3U5OA 5H1TA 4AYCB 5FB1A 3SHBA 1VYXA 5EYAF 5KH7A 2Y1MA 4V3KC 2YW8A 2LV9A 2YQMA 4AYCA 3N9NA 5LKUA 2KREA 2ECGA 3VK6A 2FUUA 2YQLA 4QF2A 1WENA 4A4BA 3SOXA 2ECIA 1LDJB 2ECNA 3RPGB 5H1UA 3HTKC 2MNYA 2KWKA 4PPEA 4V3LC 1WGMA 2K1JA 3ZVYA 1WFKA 3GL6A 5B77A 5G05B 3U5NA 3HCTA 3ASLA 1JM7B 2H0DA 2VPEA 3O37A 2E6SA 2CT2A 4W4UA 4LK9A 2ZETC 4YABA 3DPLR 2LGLA 3N9LA 1E4UA 4LJNA 3ZPV1 3N9OA 4R7EA 2MA6A 4ZDTA 3O34A 5TRBA 5KH3A 1JM7A 2I50A 2G6QA 4GNEA 4Q6FA 4GB0A 2JMDA 4UI9B 4TKPB 1WILA 3U5PA 5LKXA 2L75A 5DKAA 3ZVZB 4C9ZA 3HCUA 5KH9A 4YBSA 4A0CD 2LRIC 4AP4A 5G04B 5B76A 1WEWA 2LXPC 1X4JA 1XWHA 2M1RA 5TBNA 1IYMA 3ZPVE 5FERA 2PUYA 1Z2QA 1WEUA 3O36A 4WZ2A 4R8PK 1ZBDB 2QIZA 3ZTGA 3KV6A 1WEVA 2RI7A 4GNFA 3KQIA 4CCGX 4LKAA 2YHNA 4BBQA 2EA6A 5J3XA 5B78A 1VFYA 1WEMA 2VJEA 2Y1NA 4FO9A 2AN6A 2LGVA 3O70A 4WZ0A 3M63A 5I3LA 3SOUA 5FEYA 2RSDA 3EB5A 2YT5A 2VNFA 2MIQA 1HYIA 2C2VS 4ZUXU 4LLBA 4X3GA 3NG2A 4UP5A 2JMIA 4PTBA 3LRQA 2LDRA 3V43A 4N3WA 1BORA 4IC2A 2G43A 2D8SA 3MHHA 1G25A 3PUQA 2KFTA 4I7BA 4N4FA 3C6WA 1VD4A 3O7AA 5H1VA 4YAXA 3MHSA 5TDWA 1WIMA 2L80A 2E6RA 4CA1A 2IDAA 2ECTA 1U6GB 2K16A 3ZNIA 3HCSA 2KR4A 4S3OC 2VPDA 1Z60A 3T7LA 2C2LA 2YHOA 2ECJA
chains in the Genus database with same CATH superfamily
5AITA 2PNXA 2MNZA 1WE9A 4I7CA 2VJFB 3L1XA 2XOCA 1Z6UA 4F1PA 3M62A 1LDKC 4ZQLA 4L58A 3LQHA 4O62A 4GNGA 2MUMA 3LQIA 2HYED 4R2YA 5AIUA 5C11A 3FEHA 2YURA 4L7XA 2M3HA 2CKLB 1WESA 3LVQE 2VJFA 2LGGA 3O35A 2KE1A 4XI1A 3RTRB 3T6RA 5LKTA 5B79A 4LADB 1JOCA 5FB0A 5LCWB 3FM8C 4MSXA 5DINA 1DVPA 2KIZA 2XB1A 2YREA 1WEOA 2MA5A 3IHPA 2M13A 3N9QA 2C2LA 2KKXA 5C13A 5TDRA 2QICA 4BHWA 4QQ4A 2LQ6A 3L11A 4H9DA 3KV5A 2MD7B 1RMDA 4YC9A 2F6NA 3M99A 4AUQB 2QJ0A 2YSMA 2VPGA 2K4DA 5SVYA 2HDPA 2CSZA 3N9PA 5SVIA 5D1KB 2KWNA 2LXHC 1WEQA 2LGKA 4P5OB 1FBVA 4FIPA 2YU4A 3L1ZB 4QF3A 2XEUA 2YYRA 4FJCA 4OGEA 5B8DA 4NN2A 2LN0A 1HYJA 4YADA 4F52B 2F6JA 1MM3A 2XOZA 1WEEA 2L7PA 2VP7A 5D1LB 1N87A 4WA6A 4AVXA 4B86C 2KU3A 3QZVA 2ECVA 3ZYQA 2EODA 2MKEA 5LKZA 2H0DB 1X4UA 4YBTA 4S3OB 2K17A 2E61A 2MT5A 4A49A 2L5UA 1DCQA 4O64A 2VPBA 4YBMA 3RPGC 5D1MB 2YUCA 5JG6A 2Y43A 2KGGA 2FUIA 4WZ3B 4MVTA 4A4CA 5SVXA 2G45A 2KWJA 3O33A 2RR4A 2M6MA 5B75A 1V87A 1WEPA 2L43A 2CSVA 2B0OE 2L0BA 3JUEA 2UZGA 2FSAA 1X4IA 2JRJA 5G0FA 5H9MA 4GNDA 2OWAA 2KWOA 1MM2A 3FL2A 3I2DA 2OXQC 2KGIA 2EXUA 3DQVR 1T1HA 3PURA 1CHCA 2M85A 3PHDA 2DX8A 4UP0A 3LQJA 3C5KA 2JMJA 4IC3A 2CKLA 2F42A 2EGPA 3N9MA 2VJEB 3KNVA 2MD8C 2NAAA 2KYUA 3SOWA 1FP0A 3LVRE 3EB6A 1F62A 3GV4A 4I7DA 4B7YC 3E2DA 2YSJA 2ECWA 3T9KA 2BAYA 4FK5A 2CSYA 4YATA 5TABA 3U5MA 1K2FA 3DDTA 3U5OA 3H7HA 5H1TA 4AYCB 2FFWA 5FB1A 3SHBA 1VYXA 5EYAF 5KH7A 3LDYA 2Y1MA 4V3KC 2YW8A 2LV9A 2YQMA 4AYCA 3N9NA 2DSMA 5LKUA 2KREA 2XOYA 2ECGA 3VK6A 2FUUA 2YVRA 2YQLA 4QF2A 1WENA 3FANA 4A4BA 3SOXA 2ECIA 1LDJB 4Z0RA 2ECNA 3RPGB 2XP0A 5H1UA 3HTKC 2FD4A 3PLWA 3LJUX 2MNYA 2KWKA 4PPEA 4V3LC 1WGMA 2K1JA 2IQJA 3ZVYA 1WFKA 3GL6A 5B77A 5G05B 3U5NA 3HCTA 3ASLA 1JM7B 2H0DA 2VPEA 3O37A 2E6SA 2CT2A 4W4UA 2P57A 4LK9A 2ZETC 4YABA 3DPLR 2LGLA 3N9LA 1E4UA 4LJNA 3ZPV1 5K3QA 3N9OA 4R7EA 2MA6A 4ZDTA 2CRRA 3O34A 5TRBA 5KH3A 1JM7A 2I50A 2G6QA 4GNEA 2LAUA 4Q6FA 4GB0A 2JMDA 4UI9B 4TKPB 1WILA 2JM3A 3U5PA 5LKXA 2L75A 5DKAA 3ZVZB 4C9ZA 3HCUA 5KH9A 4YBSA 3Q1DA 4A0CD 2LRIC 4AP4A 5G04B 5B76A 1WEWA 2LXPC 1X4JA 2CONA 1XWHA 2JUNA 2M1RA 5TBNA 1IYMA 3ZPVE 5FERA 2PUYA 1Z2QA 2DJAA 1WEUA 3O36A 4WZ2A 4R8PK 1ZBDB 2QIZA 3ZTGA 3KV6A 3SUBA 1WEVA 2RI7A 3O47A 4GNFA 3KQIA 2EGMA 4CCGX 4LKAA 2YHNA 4BBQA 2EA6A 5J3XA 5B78A 2D8UA 1VFYA 1WEMA 2VJEA 3FAOA 3DWDA 2Y1NA 4FO9A 2AN6A 2LGVA 5SVIB 3O70A 4WZ0A 3M63A 5I3LA 3SOUA 5FEYA 2RSDA 3EB5A 2YT5A 2VNFA 2MIQA 1HYIA 2C2VS 4ZUXU 4LLBA 4X3GA 3NG2A 4UP5A 2JMIA 4PTBA 3LRQA 2LDRA 3V43A 4N3WA 3MDBC 1BORA 4IC2A 2G43A 2D8SA 3MHHA 1MBMA 1G25A 3PUQA 2KFTA 4I7BA 3M7KA 3KDEC 4N4FA 3C6WA 1VD4A 3O7AA 5H1VA 4YAXA 3MHSA 3FJUB 5TDWA 1WIMA 2L80A 2E6RA 2KKYA 4CA1A 2IDAA 2ECTA 1U6GB 2K16A 3ZNIA 3HCSA 2KR4A 4S3OC 2CRWA 2VPDA 1Z60A 3T7LA 4Z0OA 4OGCA 2YHOA 2ECJA
chains in the Genus database with same CATH topology
5AITA 2PNXA 2MNZA 1WE9A 4I7CA 2VJFB 3L1XA 1Z6UA 3M62A 1LDKC 4ZQLA 4L58A 3LQHA 4GNGA 2MUMA 3LQIA 2HYED 4R2YA 5AIUA 5C11A 2YURA 4L7XA 2M3HA 2CKLB 1WESA 2VJFA 2LGGA 3O35A 2KE1A 4XI1A 3RTRB 3T6RA 5LKTA 5B79A 4LADB 1JOCA 5FB0A 5LCWB 4MSXA 5DINA 1DVPA 2KIZA 2XB1A 2YREA 1WEOA 2MA5A 3IHPA 3N9QA 5C13A 5TDRA 2QICA 4BHWA 2LQ6A 3L11A 3KV5A 2MD7B 1RMDA 4YC9A 2F6NA 3M99A 4AUQB 2QJ0A 2YSMA 2VPGA 2K4DA 2HDPA 2CSZA 3N9PA 5D1KB 2KWNA 2LXHC 1WEQA 2LGKA 4P5OB 1FBVA 4FIPA 2YU4A 3L1ZB 4QF3A 2XEUA 2YYRA 4FJCA 5B8DA 4NN2A 2LN0A 1HYJA 4YADA 4F52B 2F6JA 1MM3A 1WEEA 2VP7A 5D1LB 1N87A 4WA6A 4AVXA 4B86C 2KU3A 3QZVA 2ECVA 3ZYQA 2EODA 5LKZA 2H0DB 1X4UA 4YBTA 4S3OB 2K17A 2MT5A 4A49A 2L5UA 4O64A 2VPBA 4YBMA 3RPGC 5D1MB 2YUCA 5JG6A 2Y43A 2KGGA 2FUIA 4WZ3B 4MVTA 4A4CA 2G45A 2KWJA 3O33A 2M6MA 5B75A 1V87A 1WEPA 2L43A 2L0BA 2UZGA 2FSAA 1X4IA 2JRJA 5G0FA 5H9MA 4GNDA 2KWOA 1MM2A 3FL2A 3I2DA 2OXQC 2KGIA 3DQVR 1T1HA 3PURA 1CHCA 2M85A 3PHDA 2DX8A 4UP0A 3LQJA 3C5KA 2JMJA 4IC3A 2CKLA 2F42A 2EGPA 3N9MA 2VJEB 3KNVA 2MD8C 2NAAA 2KYUA 3SOWA 1FP0A 3EB6A 1F62A 3GV4A 4I7DA 4B7YC 2YSJA 2ECWA 2BAYA 4FK5A 2CSYA 4YATA 5TABA 3U5MA 1K2FA 3U5OA 5H1TA 4AYCB 5FB1A 3SHBA 1VYXA 5EYAF 5KH7A 2Y1MA 4V3KC 2YW8A 2LV9A 2YQMA 4AYCA 3N9NA 5LKUA 2KREA 2ECGA 3VK6A 2FUUA 2YQLA 4QF2A 1WENA 4A4BA 3SOXA 2ECIA 1LDJB 2ECNA 3RPGB 5H1UA 3HTKC 2MNYA 2KWKA 4PPEA 4V3LC 1WGMA 2K1JA 3ZVYA 1WFKA 3GL6A 5B77A 5G05B 3U5NA 3HCTA 3ASLA 1JM7B 2H0DA 2VPEA 3O37A 2E6SA 2CT2A 4W4UA 4LK9A 2ZETC 4YABA 3DPLR 2LGLA 3N9LA 1E4UA 4LJNA 3ZPV1 3N9OA 4R7EA 2MA6A 4ZDTA 3O34A 5TRBA 5KH3A 1JM7A 2I50A 2G6QA 4GNEA 4Q6FA 4GB0A 2JMDA 4UI9B 4TKPB 1WILA 3U5PA 5LKXA 2L75A 5DKAA 3ZVZB 4C9ZA 3HCUA 5KH9A 4YBSA 4A0CD 2LRIC 4AP4A 5G04B 5B76A 1WEWA 2LXPC 1X4JA 1XWHA 2M1RA 5TBNA 1IYMA 3ZPVE 5FERA 2PUYA 1Z2QA 1WEUA 3O36A 4WZ2A 4R8PK 1ZBDB 2QIZA 3ZTGA 3KV6A 1WEVA 2RI7A 4GNFA 3KQIA 4CCGX 4LKAA 2YHNA 4BBQA 2EA6A 5J3XA 5B78A 1VFYA 1WEMA 2VJEA 2Y1NA 4FO9A 2AN6A 2LGVA 3O70A 4WZ0A 3M63A 5I3LA 3SOUA 5FEYA 2RSDA 3EB5A 2YT5A 2VNFA 2MIQA 1HYIA 2C2VS 4ZUXU 4LLBA 4X3GA 3NG2A 4UP5A 2JMIA 4PTBA 3LRQA 2LDRA 3V43A 4N3WA 1BORA 4IC2A 2G43A 2D8SA 3MHHA 1G25A 3PUQA 2KFTA 4I7BA 4N4FA 3C6WA 1VD4A 3O7AA 5H1VA 4YAXA 3MHSA 5TDWA 1WIMA 2L80A 2E6RA 4CA1A 2IDAA 2ECTA 1U6GB 2K16A 3ZNIA 3HCSA 2KR4A 4S3OC 2VPDA 1Z60A 3T7LA 2C2LA 2YHOA 2ECJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIT A;  2PNX A;  2MNZ A;  1WE9 A;  4I7C A;  2VJF B;  3L1X A;  1Z6U A;  3M62 A;  1LDK C;  4ZQL A;  4L58 A;  3LQH A;  4GNG A;  2MUM A;  3LQI A;  2HYE D;  4R2Y A;  5AIU A;  5C11 A;  2YUR A;  4L7X A;  2M3H A;  2CKL B;  1WES A;  2VJF A;  2LGG A;  3O35 A;  2KE1 A;  4XI1 A;  3RTR B;  3T6R A;  5LKT A;  5B79 A;  4LAD B;  1JOC A;  5FB0 A;  5LCW B;  4MSX A;  5DIN A;  1DVP A;  2KIZ A;  2XB1 A;  2YRE A;  1WEO A;  2MA5 A;  3IHP A;  3N9Q A;  5C13 A;  5TDR A;  2QIC A;  4BHW A;  2LQ6 A;  3L11 A;  3KV5 A;  2MD7 B;  1RMD A;  4YC9 A;  2F6N A;  3M99 A;  4AUQ B;  2QJ0 A;  2YSM A;  2VPG A;  2K4D A;  2HDP A;  2CSZ A;  3N9P A;  5D1K B;  2KWN A;  2LXH C;  1WEQ A;  2LGK A;  4P5O B;  1FBV A;  4FIP A;  2YU4 A;  3L1Z B;  4QF3 A;  2XEU A;  2YYR A;  4FJC A;  5B8D A;  4NN2 A;  2LN0 A;  1HYJ A;  4YAD A;  4F52 B;  2F6J A;  1MM3 A;  1WEE A;  2VP7 A;  5D1L B;  1N87 A;  4WA6 A;  4AVX A;  4B86 C;  2KU3 A;  3QZV A;  2ECV A;  3ZYQ A;  2EOD A;  5LKZ A;  2H0D B;  1X4U A;  4YBT A;  4S3O B;  2K17 A;  2MT5 A;  4A49 A;  2L5U A;  4O64 A;  2VPB A;  4YBM A;  3RPG C;  5D1M B;  2YUC A;  5JG6 A;  2Y43 A;  2KGG A;  2FUI A;  4WZ3 B;  4MVT A;  4A4C A;  2G45 A;  2KWJ A;  3O33 A;  2M6M A;  5B75 A;  1V87 A;  1WEP A;  2L43 A;  2L0B A;  2UZG A;  2FSA A;  1X4I A;  2JRJ A;  5G0F A;  5H9M A;  4GND A;  2KWO A;  1MM2 A;  3FL2 A;  3I2D A;  2OXQ C;  2KGI A;  3DQV R;  1T1H A;  3PUR A;  1CHC A;  2M85 A;  3PHD A;  2DX8 A;  4UP0 A;  3LQJ A;  3C5K A;  2JMJ A;  4IC3 A;  2CKL A;  2F42 A;  2EGP A;  3N9M A;  2VJE B;  3KNV A;  2MD8 C;  2NAA A;  2KYU A;  3SOW A;  1FP0 A;  3EB6 A;  1F62 A;  3GV4 A;  4I7D A;  4B7Y C;  2YSJ A;  2ECW A;  2BAY A;  4FK5 A;  2CSY A;  4YAT A;  5TAB A;  3U5M A;  1K2F A;  3U5O A;  5H1T A;  4AYC B;  5FB1 A;  3SHB A;  1VYX A;  5EYA F;  5KH7 A;  2Y1M A;  4V3K C;  2YW8 A;  2LV9 A;  2YQM A;  4AYC A;  3N9N A;  5LKU A;  2KRE A;  2ECG A;  3VK6 A;  2FUU A;  2YQL A;  4QF2 A;  1WEN A;  4A4B A;  3SOX A;  2ECI A;  1LDJ B;  2ECN A;  3RPG B;  5H1U A;  3HTK C;  2MNY A;  2KWK A;  4PPE A;  4V3L C;  1WGM A;  2K1J A;  3ZVY A;  1WFK A;  3GL6 A;  5B77 A;  5G05 B;  3U5N A;  3HCT A;  3ASL A;  1JM7 B;  2H0D A;  2VPE A;  3O37 A;  2E6S A;  2CT2 A;  4W4U A;  4LK9 A;  2ZET C;  4YAB A;  3DPL R;  2LGL A;  3N9L A;  1E4U A;  4LJN A;  3ZPV 1;  3N9O A;  4R7E A;  2MA6 A;  4ZDT A;  3O34 A;  5TRB A;  5KH3 A;  1JM7 A;  2I50 A;  2G6Q A;  4GNE A;  4Q6F A;  4GB0 A;  2JMD A;  4UI9 B;  4TKP B;  1WIL A;  3U5P A;  5LKX A;  2L75 A;  5DKA A;  3ZVZ B;  4C9Z A;  3HCU A;  5KH9 A;  4YBS A;  4A0C D;  2LRI C;  4AP4 A;  5G04 B;  5B76 A;  1WEW A;  2LXP C;  1X4J A;  1XWH A;  2M1R A;  5TBN A;  1IYM A;  3ZPV E;  5FER A;  2PUY A;  1Z2Q A;  1WEU A;  3O36 A;  4WZ2 A;  4R8P K;  1ZBD B;  2QIZ A;  3ZTG A;  3KV6 A;  1WEV A;  2RI7 A;  4GNF A;  3KQI A;  4CCG X;  4LKA A;  2YHN A;  4BBQ A;  2EA6 A;  5J3X A;  5B78 A;  1VFY A;  1WEM A;  2VJE A;  2Y1N A;  4FO9 A;  2AN6 A;  2LGV A;  3O70 A;  4WZ0 A;  3M63 A;  5I3L A;  3SOU A;  5FEY A;  2RSD A;  3EB5 A;  2YT5 A;  2VNF A;  2MIQ A;  1HYI A;  2C2V S;  4ZUX U;  4LLB A;  4X3G A;  3NG2 A;  4UP5 A;  2JMI A;  4PTB A;  3LRQ A;  2LDR A;  3V43 A;  4N3W A;  1BOR A;  4IC2 A;  2G43 A;  2D8S A;  3MHH A;  1G25 A;  3PUQ A;  2KFT A;  4I7B A;  4N4F A;  3C6W A;  1VD4 A;  3O7A A;  5H1V A;  4YAX A;  3MHS A;  5TDW A;  1WIM A;  2L80 A;  2E6R A;  4CA1 A;  2IDA A;  2ECT A;  1U6G B;  2K16 A;  3ZNI A;  3HCS A;  2KR4 A;  4S3O C;  2VPD A;  1Z60 A;  3T7L A;  2C2L A;  2YHO A;  2ECJ A; 
#chains in the Genus database with same CATH topology
 5AIT A;  2PNX A;  2MNZ A;  1WE9 A;  4I7C A;  2VJF B;  3L1X A;  2XOC A;  1Z6U A;  4F1P A;  3M62 A;  1LDK C;  4ZQL A;  4L58 A;  3LQH A;  4O62 A;  4GNG A;  2MUM A;  3LQI A;  2HYE D;  4R2Y A;  5AIU A;  5C11 A;  3FEH A;  2YUR A;  4L7X A;  2M3H A;  2CKL B;  1WES A;  3LVQ E;  2VJF A;  2LGG A;  3O35 A;  2KE1 A;  4XI1 A;  3RTR B;  3T6R A;  5LKT A;  5B79 A;  4LAD B;  1JOC A;  5FB0 A;  5LCW B;  3FM8 C;  4MSX A;  5DIN A;  1DVP A;  2KIZ A;  2XB1 A;  2YRE A;  1WEO A;  2MA5 A;  3IHP A;  2M13 A;  3N9Q A;  2C2L A;  2KKX A;  5C13 A;  5TDR A;  2QIC A;  4BHW A;  4QQ4 A;  2LQ6 A;  3L11 A;  4H9D A;  3KV5 A;  2MD7 B;  1RMD A;  4YC9 A;  2F6N A;  3M99 A;  4AUQ B;  2QJ0 A;  2YSM A;  2VPG A;  2K4D A;  5SVY A;  2HDP A;  2CSZ A;  3N9P A;  5SVI A;  5D1K B;  2KWN A;  2LXH C;  1WEQ A;  2LGK A;  4P5O B;  1FBV A;  4FIP A;  2YU4 A;  3L1Z B;  4QF3 A;  2XEU A;  2YYR A;  4FJC A;  4OGE A;  5B8D A;  4NN2 A;  2LN0 A;  1HYJ A;  4YAD A;  4F52 B;  2F6J A;  1MM3 A;  2XOZ A;  1WEE A;  2L7P A;  2VP7 A;  5D1L B;  1N87 A;  4WA6 A;  4AVX A;  4B86 C;  2KU3 A;  3QZV A;  2ECV A;  3ZYQ A;  2EOD A;  2MKE A;  5LKZ A;  2H0D B;  1X4U A;  4YBT A;  4S3O B;  2K17 A;  2E61 A;  2MT5 A;  4A49 A;  2L5U A;  1DCQ A;  4O64 A;  2VPB A;  4YBM A;  3RPG C;  5D1M B;  2YUC A;  5JG6 A;  2Y43 A;  2KGG A;  2FUI A;  4WZ3 B;  4MVT A;  4A4C A;  5SVX A;  2G45 A;  2KWJ A;  3O33 A;  2RR4 A;  2M6M A;  5B75 A;  1V87 A;  1WEP A;  2L43 A;  2CSV A;  2B0O E;  2L0B A;  3JUE A;  2UZG A;  2FSA A;  1X4I A;  2JRJ A;  5G0F A;  5H9M A;  4GND A;  2OWA A;  2KWO A;  1MM2 A;  3FL2 A;  3I2D A;  2OXQ C;  2KGI A;  2EXU A;  3DQV R;  1T1H A;  3PUR A;  1CHC A;  2M85 A;  3PHD A;  2DX8 A;  4UP0 A;  3LQJ A;  3C5K A;  2JMJ A;  4IC3 A;  2CKL A;  2F42 A;  2EGP A;  3N9M A;  2VJE B;  3KNV A;  2MD8 C;  2NAA A;  2KYU A;  3SOW A;  1FP0 A;  3LVR E;  3EB6 A;  1F62 A;  3GV4 A;  4I7D A;  4B7Y C;  3E2D A;  2YSJ A;  2ECW A;  3T9K A;  2BAY A;  4FK5 A;  2CSY A;  4YAT A;  5TAB A;  3U5M A;  1K2F A;  3DDT A;  3U5O A;  3H7H A;  5H1T A;  4AYC B;  2FFW A;  5FB1 A;  3SHB A;  1VYX A;  5EYA F;  5KH7 A;  3LDY A;  2Y1M A;  4V3K C;  2YW8 A;  2LV9 A;  2YQM A;  4AYC A;  3N9N A;  2DSM A;  5LKU A;  2KRE A;  2XOY A;  2ECG A;  3VK6 A;  2FUU A;  2YVR A;  2YQL A;  4QF2 A;  1WEN A;  3FAN A;  4A4B A;  3SOX A;  2ECI A;  1LDJ B;  4Z0R A;  2ECN A;  3RPG B;  2XP0 A;  5H1U A;  3HTK C;  2FD4 A;  3PLW A;  3LJU X;  2MNY A;  2KWK A;  4PPE A;  4V3L C;  1WGM A;  2K1J A;  2IQJ A;  3ZVY A;  1WFK A;  3GL6 A;  5B77 A;  5G05 B;  3U5N A;  3HCT A;  3ASL A;  1JM7 B;  2H0D A;  2VPE A;  3O37 A;  2E6S A;  2CT2 A;  4W4U A;  2P57 A;  4LK9 A;  2ZET C;  4YAB A;  3DPL R;  2LGL A;  3N9L A;  1E4U A;  4LJN A;  3ZPV 1;  5K3Q A;  3N9O A;  4R7E A;  2MA6 A;  4ZDT A;  2CRR A;  3O34 A;  5TRB A;  5KH3 A;  1JM7 A;  2I50 A;  2G6Q A;  4GNE A;  2LAU A;  4Q6F A;  4GB0 A;  2JMD A;  4UI9 B;  4TKP B;  1WIL A;  2JM3 A;  3U5P A;  5LKX A;  2L75 A;  5DKA A;  3ZVZ B;  4C9Z A;  3HCU A;  5KH9 A;  4YBS A;  3Q1D A;  4A0C D;  2LRI C;  4AP4 A;  5G04 B;  5B76 A;  1WEW A;  2LXP C;  1X4J A;  2CON A;  1XWH A;  2JUN A;  2M1R A;  5TBN A;  1IYM A;  3ZPV E;  5FER A;  2PUY A;  1Z2Q A;  2DJA A;  1WEU A;  3O36 A;  4WZ2 A;  4R8P K;  1ZBD B;  2QIZ A;  3ZTG A;  3KV6 A;  3SUB A;  1WEV A;  2RI7 A;  3O47 A;  4GNF A;  3KQI A;  2EGM A;  4CCG X;  4LKA A;  2YHN A;  4BBQ A;  2EA6 A;  5J3X A;  5B78 A;  2D8U A;  1VFY A;  1WEM A;  2VJE A;  3FAO A;  3DWD A;  2Y1N A;  4FO9 A;  2AN6 A;  2LGV A;  5SVI B;  3O70 A;  4WZ0 A;  3M63 A;  5I3L A;  3SOU A;  5FEY A;  2RSD A;  3EB5 A;  2YT5 A;  2VNF A;  2MIQ A;  1HYI A;  2C2V S;  4ZUX U;  4LLB A;  4X3G A;  3NG2 A;  4UP5 A;  2JMI A;  4PTB A;  3LRQ A;  2LDR A;  3V43 A;  4N3W A;  3MDB C;  1BOR A;  4IC2 A;  2G43 A;  2D8S A;  3MHH A;  1MBM A;  1G25 A;  3PUQ A;  2KFT A;  4I7B A;  3M7K A;  3KDE C;  4N4F A;  3C6W A;  1VD4 A;  3O7A A;  5H1V A;  4YAX A;  3MHS A;  3FJU B;  5TDW A;  1WIM A;  2L80 A;  2E6R A;  2KKY A;  4CA1 A;  2IDA A;  2ECT A;  1U6G B;  2K16 A;  3ZNI A;  3HCS A;  2KR4 A;  4S3O C;  2CRW A;  2VPD A;  1Z60 A;  3T7L A;  4Z0O A;  4OGC A;  2YHO A;  2ECJ A; 
#chains in the Genus database with same CATH homology
 5AIT A;  2PNX A;  2MNZ A;  1WE9 A;  4I7C A;  2VJF B;  3L1X A;  1Z6U A;  3M62 A;  1LDK C;  4ZQL A;  4L58 A;  3LQH A;  4GNG A;  2MUM A;  3LQI A;  2HYE D;  4R2Y A;  5AIU A;  5C11 A;  2YUR A;  4L7X A;  2M3H A;  2CKL B;  1WES A;  2VJF A;  2LGG A;  3O35 A;  2KE1 A;  4XI1 A;  3RTR B;  3T6R A;  5LKT A;  5B79 A;  4LAD B;  1JOC A;  5FB0 A;  5LCW B;  4MSX A;  5DIN A;  1DVP A;  2KIZ A;  2XB1 A;  2YRE A;  1WEO A;  2MA5 A;  3IHP A;  3N9Q A;  5C13 A;  5TDR A;  2QIC A;  4BHW A;  2LQ6 A;  3L11 A;  3KV5 A;  2MD7 B;  1RMD A;  4YC9 A;  2F6N A;  3M99 A;  4AUQ B;  2QJ0 A;  2YSM A;  2VPG A;  2K4D A;  2HDP A;  2CSZ A;  3N9P A;  5D1K B;  2KWN A;  2LXH C;  1WEQ A;  2LGK A;  4P5O B;  1FBV A;  4FIP A;  2YU4 A;  3L1Z B;  4QF3 A;  2XEU A;  2YYR A;  4FJC A;  5B8D A;  4NN2 A;  2LN0 A;  1HYJ A;  4YAD A;  4F52 B;  2F6J A;  1MM3 A;  1WEE A;  2VP7 A;  5D1L B;  1N87 A;  4WA6 A;  4AVX A;  4B86 C;  2KU3 A;  3QZV A;  2ECV A;  3ZYQ A;  2EOD A;  5LKZ A;  2H0D B;  1X4U A;  4YBT A;  4S3O B;  2K17 A;  2MT5 A;  4A49 A;  2L5U A;  4O64 A;  2VPB A;  4YBM A;  3RPG C;  5D1M B;  2YUC A;  5JG6 A;  2Y43 A;  2KGG A;  2FUI A;  4WZ3 B;  4MVT A;  4A4C A;  2G45 A;  2KWJ A;  3O33 A;  2M6M A;  5B75 A;  1V87 A;  1WEP A;  2L43 A;  2L0B A;  2UZG A;  2FSA A;  1X4I A;  2JRJ A;  5G0F A;  5H9M A;  4GND A;  2KWO A;  1MM2 A;  3FL2 A;  3I2D A;  2OXQ C;  2KGI A;  3DQV R;  1T1H A;  3PUR A;  1CHC A;  2M85 A;  3PHD A;  2DX8 A;  4UP0 A;  3LQJ A;  3C5K A;  2JMJ A;  4IC3 A;  2CKL A;  2F42 A;  2EGP A;  3N9M A;  2VJE B;  3KNV A;  2MD8 C;  2NAA A;  2KYU A;  3SOW A;  1FP0 A;  3EB6 A;  1F62 A;  3GV4 A;  4I7D A;  4B7Y C;  2YSJ A;  2ECW A;  2BAY A;  4FK5 A;  2CSY A;  4YAT A;  5TAB A;  3U5M A;  1K2F A;  3U5O A;  5H1T A;  4AYC B;  5FB1 A;  3SHB A;  1VYX A;  5EYA F;  5KH7 A;  2Y1M A;  4V3K C;  2YW8 A;  2LV9 A;  2YQM A;  4AYC A;  3N9N A;  5LKU A;  2KRE A;  2ECG A;  3VK6 A;  2FUU A;  2YQL A;  4QF2 A;  1WEN A;  4A4B A;  3SOX A;  2ECI A;  1LDJ B;  2ECN A;  3RPG B;  5H1U A;  3HTK C;  2MNY A;  2KWK A;  4PPE A;  4V3L C;  1WGM A;  2K1J A;  3ZVY A;  1WFK A;  3GL6 A;  5B77 A;  5G05 B;  3U5N A;  3HCT A;  3ASL A;  1JM7 B;  2H0D A;  2VPE A;  3O37 A;  2E6S A;  2CT2 A;  4W4U A;  4LK9 A;  2ZET C;  4YAB A;  3DPL R;  2LGL A;  3N9L A;  1E4U A;  4LJN A;  3ZPV 1;  3N9O A;  4R7E A;  2MA6 A;  4ZDT A;  3O34 A;  5TRB A;  5KH3 A;  1JM7 A;  2I50 A;  2G6Q A;  4GNE A;  4Q6F A;  4GB0 A;  2JMD A;  4UI9 B;  4TKP B;  1WIL A;  3U5P A;  5LKX A;  2L75 A;  5DKA A;  3ZVZ B;  4C9Z A;  3HCU A;  5KH9 A;  4YBS A;  4A0C D;  2LRI C;  4AP4 A;  5G04 B;  5B76 A;  1WEW A;  2LXP C;  1X4J A;  1XWH A;  2M1R A;  5TBN A;  1IYM A;  3ZPV E;  5FER A;  2PUY A;  1Z2Q A;  1WEU A;  3O36 A;  4WZ2 A;  4R8P K;  1ZBD B;  2QIZ A;  3ZTG A;  3KV6 A;  1WEV A;  2RI7 A;  4GNF A;  3KQI A;  4CCG X;  4LKA A;  2YHN A;  4BBQ A;  2EA6 A;  5J3X A;  5B78 A;  1VFY A;  1WEM A;  2VJE A;  2Y1N A;  4FO9 A;  2AN6 A;  2LGV A;  3O70 A;  4WZ0 A;  3M63 A;  5I3L A;  3SOU A;  5FEY A;  2RSD A;  3EB5 A;  2YT5 A;  2VNF A;  2MIQ A;  1HYI A;  2C2V S;  4ZUX U;  4LLB A;  4X3G A;  3NG2 A;  4UP5 A;  2JMI A;  4PTB A;  3LRQ A;  2LDR A;  3V43 A;  4N3W A;  1BOR A;  4IC2 A;  2G43 A;  2D8S A;  3MHH A;  1G25 A;  3PUQ A;  2KFT A;  4I7B A;  4N4F A;  3C6W A;  1VD4 A;  3O7A A;  5H1V A;  4YAX A;  3MHS A;  5TDW A;  1WIM A;  2L80 A;  2E6R A;  4CA1 A;  2IDA A;  2ECT A;  1U6G B;  2K16 A;  3ZNI A;  3HCS A;  2KR4 A;  4S3O C;  2VPD A;  1Z60 A;  3T7L A;  2C2L A;  2YHO A;  2ECJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...