2LGKA

Nmr structure of uhrf1 phd domains in a complex with histone h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgkA00
5LKUA 1XWHA 4L7XA 1Z60A 3EB5A 2Y1NA 3O7AA 3RPGB 2BAYA 2LGLA 2CKLA 2HDPA 4L58A 4LKAA 1MM2A 4YBMA 3LRQA 3ZYQA 4I7CA 4B86C 3T7LA 3MHHA 2Y43A 5FERA 4YADA 1ZBDB 1WEEA 1JM7B 2G45A 3SOXA 3KV5A 4CCGX 2F6JA 3QZVA 4B7YC 1WEPA 3KQIA 2YU4A 2OXQC 5DINA 5B75A 4LJNA 4BHWA 3ZVYA 2MA6A 5D1KB 4PTBA 1IYMA 2JMDA 2LXPC 3EB6A 2EODA 2YQLA 5JG6A 4S3OC 4WZ3B 1N87A 5D1MB 1WENA 2VP7A 2K16A 2RSDA 3ZPVE 3U5MA 5LKTA 4GNGA 2XEUA 2G43A 4GNEA 2LV9A 2HYED 2KREA 4ZQLA 2E6SA 3U5PA 1WEMA 5KH3A 2YREA 1LDKC 4YBSA 4O64A 4QF3A 5FB0A 2KWNA 4V3KC 4LK9A 2ECIA 1X4JA 5H1TA 2JMIA 3FL2A 4QF2A 5AIUA 2M3HA 2VJEB 3T6RA 3N9OA 2ZETC 4R7EA 2FUUA 2YW8A 1VD4A 2M6MA 2KGGA 1Z2QA 5TRBA 3LQHA 2D8SA 2RI7A 2K17A 4AYCA 4C9ZA 3N9MA 5H1UA 2F6NA 5FB1A 4CA1A 2CT2A 1F62A 5FEYA 5C11A 4GNDA 4X3GA 4YBTA 2QJ0A 2LGGA 2YUCA 4R2YA 3LQIA 3PURA 4W4UA 1T1HA 2MD8C 2L80A 3ZVZB 4A49A 1JOCA 3DQVR 2C2LA 3SOUA 2ECNA 4R8PK 3MHSA 1HYJA 4BBQA 1V87A 2PNXA 5TDRA 2H0DB 5LCWB 4V3LC 4N4FA 4GNFA 2ECTA 4AUQB 2KYUA 2FSAA 1VYXA 2M85A 4IC2A 2DX8A 5TBNA 3O36A 2LGVA 2QICA 2KGIA 3IHPA 4YC9A 1WE9A 3KV6A 2K1JA 3U5NA 1RMDA 4TKPB 2KFTA 2EGPA 5B8DA 2Y1MA 4FO9A 4YABA 2JRJA 4MSXA 1WEWA 5AITA 3NG2A 2ECGA 2VPDA 2CSZA 1JM7A 2VJFA 4WZ2A 2QIZA 2AN6A 1DVPA 2YHOA 3N9QA 1WEUA 2YYRA 2IDAA 2XB1A 2YSMA 4FIPA 2LDRA 4FJCA 3N9NA 4Q6FA 1X4UA 5EYAF 2MT5A 2KWJA 3U5OA 1WEOA 3L1ZB 2CKLB 3RTRB 2MA5A 1FP0A 2K4DA 1FBVA 3O34A 2NAAA 2KWOA 1LDJB 3ZTGA 2VNFA 3O33A 1WESA 3ZNIA 3C6WA 1MM3A 3O37A 4A4CA 2JMJA 1BORA 4YATA 4YAXA 2LQ6A 2MNYA 2G6QA 2VPEA 3RPGC 1G25A 3PUQA 5B76A 1VFYA 3M63A 5LKXA 4I7BA 2LXHC 3C5KA 5D1LB 2KIZA 2VJEA 2L0BA 5B77A 3VK6A 3M62A 2VPBA 4ZUXU 4AP4A 3L1XA 3ZPV1 2L75A 5KH7A 2PUYA 2YT5A 3O70A 3L11A 2VJFB 3GV4A 5B78A 1WEQA 2ECVA 4WZ0A 2I50A 2MUMA 4GB0A 5B79A 5G04B 2ECWA 2LRIC 2YQMA 2LN0A 5TDWA 3SHBA 4A4BA 2KWKA 1WGMA 2M1RA 4N3WA 3N9PA 3LQJA 3N9LA 5TABA 4LLBA 2KU3A 1WILA 2YHNA 4UP5A 1HYIA 2LGKA 4FK5A 4S3OB 2YURA 3PHDA 2H0DA 4WA6A 1K2FA 5C13A 5J3XA 4IC3A 5G05B 4I7DA 4AVXA 5DKAA 2FUIA 4LADB 2VPGA 4UP0A 5I3LA 3GL6A 1WFKA 3V43A 4AYCB 1WEVA 2KR4A 5KH9A 2MD7B 5H9MA 3HCUA 2MNZA 4PPEA 4F52B 4MVTA 2KE1A 2L5UA 4ZDTA 2ECJA 1WIMA 2E6RA 1X4IA 3SOWA 4A0CD 2C2VS 2UZGA 3DPLR 1E4UA 1CHCA 3ASLA 2YSJA 2L43A 3KNVA 5LKZA 3M99A 2MIQA 2EA6A 4P5OB 5H1VA 3HTKC 1U6GB 4UI9B 4NN2A 5G0FA 2F42A 3O35A 3HCSA 2CSYA 3I2DA 4XI1A 3HCTA 1Z6UA
chains in the Genus database with same CATH superfamily
5LKUA 1XWHA 4L7XA 1Z60A 3EB5A 2Y1NA 3O7AA 3RPGB 2BAYA 2LGLA 2CKLA 2HDPA 4L58A 4LKAA 1MM2A 4YBMA 3LRQA 3ZYQA 4I7CA 4B86C 3T7LA 3MHHA 2Y43A 5FERA 4YADA 1ZBDB 2P57A 1WEEA 4Z0OA 1JM7B 2G45A 3SOXA 3KV5A 4CCGX 2F6JA 2XOYA 3QZVA 2EXUA 4B7YC 1WEPA 3KQIA 2YU4A 3FANA 4H9DA 2OXQC 5DINA 5B75A 4LJNA 4BHWA 3ZVYA 2MA6A 5D1KB 4PTBA 1IYMA 2JMDA 2LXPC 3EB6A 2EGMA 2EODA 2YQLA 5JG6A 4S3OC 4WZ3B 1N87A 2B0OE 5D1MB 1WENA 2VP7A 2K16A 2RSDA 3ZPVE 3U5MA 5LKTA 4GNGA 2XEUA 2G43A 3FM8C 4GNEA 2LV9A 2HYED 2KREA 4ZQLA 2E6SA 3U5PA 1WEMA 5KH3A 2YREA 3H7HA 1LDKC 4YBSA 4O64A 4QF3A 5FB0A 3E2DA 2KWNA 4V3KC 4LK9A 2ECIA 1X4JA 5H1TA 2JMIA 3FL2A 4QF2A 5AIUA 2FD4A 5SVIB 2M3HA 2VJEB 3T6RA 3N9OA 2ZETC 4R7EA 2FUUA 3FJUB 2YW8A 3LJUX 1VD4A 2M6MA 3FAOA 2KGGA 1Z2QA 5TRBA 3LQHA 2D8SA 2RI7A 2K17A 4AYCA 4C9ZA 3N9MA 5H1UA 2F6NA 5FB1A 2CRRA 4CA1A 2CT2A 1F62A 5SVYA 5FEYA 5C11A 4GNDA 4X3GA 4YBTA 2QJ0A 3KDEC 5K3QA 2LGGA 2YUCA 4R2YA 3LVRE 3LQIA 3PURA 2MKEA 4W4UA 1T1HA 2MD8C 1MBMA 2L80A 3ZVZB 4A49A 1JOCA 3DQVR 2C2LA 3SOUA 2ECNA 4R8PK 3MHSA 1HYJA 4BBQA 1V87A 2PNXA 5TDRA 2H0DB 3LVQE 3JUEA 5LCWB 4V3LC 4N4FA 3FEHA 4GNFA 2ECTA 4AUQB 2KYUA 2FSAA 2LAUA 1VYXA 4IC2A 2M85A 2DX8A 5TBNA 3O36A 2LGVA 2QICA 2KGIA 1DCQA 3IHPA 4YC9A 1WE9A 3KV6A 2K1JA 3U5NA 3Q1DA 2KKYA 3T9KA 1RMDA 4TKPB 2KFTA 2EGPA 5B8DA 2Y1MA 4FO9A 4YABA 2JRJA 4MSXA 1WEWA 5AITA 3NG2A 2ECGA 2VPDA 2CSZA 1JM7A 2VJFA 4WZ2A 2QIZA 2M13A 2AN6A 1DVPA 4O62A 2DJAA 2YHOA 3N9QA 1WEUA 2YYRA 2IDAA 2XB1A 2YSMA 4FIPA 2LDRA 4FJCA 3N9NA 2RR4A 4Q6FA 2OWAA 1X4UA 5EYAF 2MT5A 2KWJA 3U5OA 1WEOA 3L1ZB 2CKLB 3RTRB 2MA5A 1FP0A 2K4DA 1FBVA 3O34A 2NAAA 2KWOA 2IQJA 1LDJB 3ZTGA 2VNFA 3O33A 1WESA 3DWDA 3LDYA 3ZNIA 2CRWA 3C6WA 1MM3A 3O37A 4A4CA 2JMJA 1BORA 4YATA 4YAXA 2LQ6A 2MNYA 2G6QA 2VPEA 3RPGC 1G25A 3PUQA 5B76A 1VFYA 3M63A 5LKXA 4I7BA 2LXHC 3C5KA 5D1LB 2KIZA 5SVIA 2VJEA 2L0BA 5B77A 3DDTA 3VK6A 2CONA 2XOCA 3M62A 2VPBA 4ZUXU 4AP4A 3L1XA 4QQ4A 3ZPV1 2L75A 5KH7A 2PUYA 2JM3A 2YT5A 3O70A 3L11A 2YVRA 2KKXA 2VJFB 3GV4A 2JUNA 5B78A 1WEQA 2ECVA 4WZ0A 2I50A 2MUMA 4GB0A 5B79A 5G04B 2ECWA 2LRIC 2YQMA 2LN0A 5TDWA 3SHBA 4A4BA 2KWKA 2XOZA 1WGMA 2M1RA 4N3WA 3N9PA 3LQJA 3N9LA 5TABA 2XP0A 4LLBA 2KU3A 3SUBA 1WILA 2YHNA 2L7PA 4UP5A 1HYIA 2E61A 2LGKA 3PLWA 4FK5A 4S3OB 2YURA 2CSVA 3PHDA 2H0DA 4OGEA 4WA6A 1K2FA 5C13A 5J3XA 2FFWA 4IC3A 5G05B 4I7DA 4AVXA 5DKAA 2FUIA 3M7KA 4LADB 2VPGA 4F1PA 4UP0A 5I3LA 3GL6A 1WFKA 3V43A 4AYCB 1WEVA 2KR4A 5KH9A 2MD7B 5H9MA 3HCUA 2MNZA 4PPEA 2D8UA 4F52B 3O47A 4MVTA 2KE1A 2L5UA 4ZDTA 2ECJA 1WIMA 4OGCA 2E6RA 1X4IA 3SOWA 4A0CD 2C2VS 2UZGA 3DPLR 4Z0RA 1E4UA 1CHCA 3ASLA 2YSJA 2L43A 3KNVA 5SVXA 3MDBC 5LKZA 3M99A 2MIQA 2EA6A 4P5OB 5H1VA 2DSMA 3HTKC 1U6GB 4UI9B 4NN2A 5G0FA 2F42A 3O35A 3HCSA 2CSYA 3I2DA 4XI1A 3HCTA 1Z6UA
chains in the Genus database with same CATH topology
5LKUA 1XWHA 4L7XA 1Z60A 3EB5A 2Y1NA 3O7AA 3RPGB 2BAYA 2LGLA 2CKLA 2HDPA 4L58A 4LKAA 1MM2A 4YBMA 3LRQA 3ZYQA 4I7CA 4B86C 3T7LA 3MHHA 2Y43A 5FERA 4YADA 1ZBDB 1WEEA 1JM7B 2G45A 3SOXA 3KV5A 4CCGX 2F6JA 3QZVA 4B7YC 1WEPA 3KQIA 2YU4A 2OXQC 5DINA 5B75A 4LJNA 4BHWA 3ZVYA 2MA6A 5D1KB 4PTBA 1IYMA 2JMDA 2LXPC 3EB6A 2EODA 2YQLA 5JG6A 4S3OC 4WZ3B 1N87A 5D1MB 1WENA 2VP7A 2K16A 2RSDA 3ZPVE 3U5MA 5LKTA 4GNGA 2XEUA 2G43A 4GNEA 2LV9A 2HYED 2KREA 4ZQLA 2E6SA 3U5PA 1WEMA 5KH3A 2YREA 1LDKC 4YBSA 4O64A 4QF3A 5FB0A 2KWNA 4V3KC 4LK9A 2ECIA 1X4JA 5H1TA 2JMIA 3FL2A 4QF2A 5AIUA 2M3HA 2VJEB 3T6RA 3N9OA 2ZETC 4R7EA 2FUUA 2YW8A 1VD4A 2M6MA 2KGGA 1Z2QA 5TRBA 3LQHA 2D8SA 2RI7A 2K17A 4AYCA 4C9ZA 3N9MA 5H1UA 2F6NA 5FB1A 4CA1A 2CT2A 1F62A 5FEYA 5C11A 4GNDA 4X3GA 4YBTA 2QJ0A 2LGGA 2YUCA 4R2YA 3LQIA 3PURA 4W4UA 1T1HA 2MD8C 2L80A 3ZVZB 4A49A 1JOCA 3DQVR 2C2LA 3SOUA 2ECNA 4R8PK 3MHSA 1HYJA 4BBQA 1V87A 2PNXA 5TDRA 2H0DB 5LCWB 4V3LC 4N4FA 4GNFA 2ECTA 4AUQB 2KYUA 2FSAA 1VYXA 2M85A 4IC2A 2DX8A 5TBNA 3O36A 2LGVA 2QICA 2KGIA 3IHPA 4YC9A 1WE9A 3KV6A 2K1JA 3U5NA 1RMDA 4TKPB 2KFTA 2EGPA 5B8DA 2Y1MA 4FO9A 4YABA 2JRJA 4MSXA 1WEWA 5AITA 3NG2A 2ECGA 2VPDA 2CSZA 1JM7A 2VJFA 4WZ2A 2QIZA 2AN6A 1DVPA 2YHOA 3N9QA 1WEUA 2YYRA 2IDAA 2XB1A 2YSMA 4FIPA 2LDRA 4FJCA 3N9NA 4Q6FA 1X4UA 5EYAF 2MT5A 2KWJA 3U5OA 1WEOA 3L1ZB 2CKLB 3RTRB 2MA5A 1FP0A 2K4DA 1FBVA 3O34A 2NAAA 2KWOA 1LDJB 3ZTGA 2VNFA 3O33A 1WESA 3ZNIA 3C6WA 1MM3A 3O37A 4A4CA 2JMJA 1BORA 4YATA 4YAXA 2LQ6A 2MNYA 2G6QA 2VPEA 3RPGC 1G25A 3PUQA 5B76A 1VFYA 3M63A 5LKXA 4I7BA 2LXHC 3C5KA 5D1LB 2KIZA 2VJEA 2L0BA 5B77A 3VK6A 3M62A 2VPBA 4ZUXU 4AP4A 3L1XA 3ZPV1 2L75A 5KH7A 2PUYA 2YT5A 3O70A 3L11A 2VJFB 3GV4A 5B78A 1WEQA 2ECVA 4WZ0A 2I50A 2MUMA 4GB0A 5B79A 5G04B 2ECWA 2LRIC 2YQMA 2LN0A 5TDWA 3SHBA 4A4BA 2KWKA 1WGMA 2M1RA 4N3WA 3N9PA 3LQJA 3N9LA 5TABA 4LLBA 2KU3A 1WILA 2YHNA 4UP5A 1HYIA 2LGKA 4FK5A 4S3OB 2YURA 3PHDA 2H0DA 4WA6A 1K2FA 5C13A 5J3XA 4IC3A 5G05B 4I7DA 4AVXA 5DKAA 2FUIA 4LADB 2VPGA 4UP0A 5I3LA 3GL6A 1WFKA 3V43A 4AYCB 1WEVA 2KR4A 5KH9A 2MD7B 5H9MA 3HCUA 2MNZA 4PPEA 4F52B 4MVTA 2KE1A 2L5UA 4ZDTA 2ECJA 1WIMA 2E6RA 1X4IA 3SOWA 4A0CD 2C2VS 2UZGA 3DPLR 1E4UA 1CHCA 3ASLA 2YSJA 2L43A 3KNVA 5LKZA 3M99A 2MIQA 2EA6A 4P5OB 5H1VA 3HTKC 1U6GB 4UI9B 4NN2A 5G0FA 2F42A 3O35A 3HCSA 2CSYA 3I2DA 4XI1A 3HCTA 1Z6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKU A;  1XWH A;  4L7X A;  1Z60 A;  3EB5 A;  2Y1N A;  3O7A A;  3RPG B;  2BAY A;  2LGL A;  2CKL A;  2HDP A;  4L58 A;  4LKA A;  1MM2 A;  4YBM A;  3LRQ A;  3ZYQ A;  4I7C A;  4B86 C;  3T7L A;  3MHH A;  2Y43 A;  5FER A;  4YAD A;  1ZBD B;  1WEE A;  1JM7 B;  2G45 A;  3SOX A;  3KV5 A;  4CCG X;  2F6J A;  3QZV A;  4B7Y C;  1WEP A;  3KQI A;  2YU4 A;  2OXQ C;  5DIN A;  5B75 A;  4LJN A;  4BHW A;  3ZVY A;  2MA6 A;  5D1K B;  4PTB A;  1IYM A;  2JMD A;  2LXP C;  3EB6 A;  2EOD A;  2YQL A;  5JG6 A;  4S3O C;  4WZ3 B;  1N87 A;  5D1M B;  1WEN A;  2VP7 A;  2K16 A;  2RSD A;  3ZPV E;  3U5M A;  5LKT A;  4GNG A;  2XEU A;  2G43 A;  4GNE A;  2LV9 A;  2HYE D;  2KRE A;  4ZQL A;  2E6S A;  3U5P A;  1WEM A;  5KH3 A;  2YRE A;  1LDK C;  4YBS A;  4O64 A;  4QF3 A;  5FB0 A;  2KWN A;  4V3K C;  4LK9 A;  2ECI A;  1X4J A;  5H1T A;  2JMI A;  3FL2 A;  4QF2 A;  5AIU A;  2M3H A;  2VJE B;  3T6R A;  3N9O A;  2ZET C;  4R7E A;  2FUU A;  2YW8 A;  1VD4 A;  2M6M A;  2KGG A;  1Z2Q A;  5TRB A;  3LQH A;  2D8S A;  2RI7 A;  2K17 A;  4AYC A;  4C9Z A;  3N9M A;  5H1U A;  2F6N A;  5FB1 A;  4CA1 A;  2CT2 A;  1F62 A;  5FEY A;  5C11 A;  4GND A;  4X3G A;  4YBT A;  2QJ0 A;  2LGG A;  2YUC A;  4R2Y A;  3LQI A;  3PUR A;  4W4U A;  1T1H A;  2MD8 C;  2L80 A;  3ZVZ B;  4A49 A;  1JOC A;  3DQV R;  2C2L A;  3SOU A;  2ECN A;  4R8P K;  3MHS A;  1HYJ A;  4BBQ A;  1V87 A;  2PNX A;  5TDR A;  2H0D B;  5LCW B;  4V3L C;  4N4F A;  4GNF A;  2ECT A;  4AUQ B;  2KYU A;  2FSA A;  1VYX A;  2M85 A;  4IC2 A;  2DX8 A;  5TBN A;  3O36 A;  2LGV A;  2QIC A;  2KGI A;  3IHP A;  4YC9 A;  1WE9 A;  3KV6 A;  2K1J A;  3U5N A;  1RMD A;  4TKP B;  2KFT A;  2EGP A;  5B8D A;  2Y1M A;  4FO9 A;  4YAB A;  2JRJ A;  4MSX A;  1WEW A;  5AIT A;  3NG2 A;  2ECG A;  2VPD A;  2CSZ A;  1JM7 A;  2VJF A;  4WZ2 A;  2QIZ A;  2AN6 A;  1DVP A;  2YHO A;  3N9Q A;  1WEU A;  2YYR A;  2IDA A;  2XB1 A;  2YSM A;  4FIP A;  2LDR A;  4FJC A;  3N9N A;  4Q6F A;  1X4U A;  5EYA F;  2MT5 A;  2KWJ A;  3U5O A;  1WEO A;  3L1Z B;  2CKL B;  3RTR B;  2MA5 A;  1FP0 A;  2K4D A;  1FBV A;  3O34 A;  2NAA A;  2KWO A;  1LDJ B;  3ZTG A;  2VNF A;  3O33 A;  1WES A;  3ZNI A;  3C6W A;  1MM3 A;  3O37 A;  4A4C A;  2JMJ A;  1BOR A;  4YAT A;  4YAX A;  2LQ6 A;  2MNY A;  2G6Q A;  2VPE A;  3RPG C;  1G25 A;  3PUQ A;  5B76 A;  1VFY A;  3M63 A;  5LKX A;  4I7B A;  2LXH C;  3C5K A;  5D1L B;  2KIZ A;  2VJE A;  2L0B A;  5B77 A;  3VK6 A;  3M62 A;  2VPB A;  4ZUX U;  4AP4 A;  3L1X A;  3ZPV 1;  2L75 A;  5KH7 A;  2PUY A;  2YT5 A;  3O70 A;  3L11 A;  2VJF B;  3GV4 A;  5B78 A;  1WEQ A;  2ECV A;  4WZ0 A;  2I50 A;  2MUM A;  4GB0 A;  5B79 A;  5G04 B;  2ECW A;  2LRI C;  2YQM A;  2LN0 A;  5TDW A;  3SHB A;  4A4B A;  2KWK A;  1WGM A;  2M1R A;  4N3W A;  3N9P A;  3LQJ A;  3N9L A;  5TAB A;  4LLB A;  2KU3 A;  1WIL A;  2YHN A;  4UP5 A;  1HYI A;  2LGK A;  4FK5 A;  4S3O B;  2YUR A;  3PHD A;  2H0D A;  4WA6 A;  1K2F A;  5C13 A;  5J3X A;  4IC3 A;  5G05 B;  4I7D A;  4AVX A;  5DKA A;  2FUI A;  4LAD B;  2VPG A;  4UP0 A;  5I3L A;  3GL6 A;  1WFK A;  3V43 A;  4AYC B;  1WEV A;  2KR4 A;  5KH9 A;  2MD7 B;  5H9M A;  3HCU A;  2MNZ A;  4PPE A;  4F52 B;  4MVT A;  2KE1 A;  2L5U A;  4ZDT A;  2ECJ A;  1WIM A;  2E6R A;  1X4I A;  3SOW A;  4A0C D;  2C2V S;  2UZG A;  3DPL R;  1E4U A;  1CHC A;  3ASL A;  2YSJ A;  2L43 A;  3KNV A;  5LKZ A;  3M99 A;  2MIQ A;  2EA6 A;  4P5O B;  5H1V A;  3HTK C;  1U6G B;  4UI9 B;  4NN2 A;  5G0F A;  2F42 A;  3O35 A;  3HCS A;  2CSY A;  3I2D A;  4XI1 A;  3HCT A;  1Z6U A; 
#chains in the Genus database with same CATH topology
 5LKU A;  1XWH A;  4L7X A;  1Z60 A;  3EB5 A;  2Y1N A;  3O7A A;  3RPG B;  2BAY A;  2LGL A;  2CKL A;  2HDP A;  4L58 A;  4LKA A;  1MM2 A;  4YBM A;  3LRQ A;  3ZYQ A;  4I7C A;  4B86 C;  3T7L A;  3MHH A;  2Y43 A;  5FER A;  4YAD A;  1ZBD B;  2P57 A;  1WEE A;  4Z0O A;  1JM7 B;  2G45 A;  3SOX A;  3KV5 A;  4CCG X;  2F6J A;  2XOY A;  3QZV A;  2EXU A;  4B7Y C;  1WEP A;  3KQI A;  2YU4 A;  3FAN A;  4H9D A;  2OXQ C;  5DIN A;  5B75 A;  4LJN A;  4BHW A;  3ZVY A;  2MA6 A;  5D1K B;  4PTB A;  1IYM A;  2JMD A;  2LXP C;  3EB6 A;  2EGM A;  2EOD A;  2YQL A;  5JG6 A;  4S3O C;  4WZ3 B;  1N87 A;  2B0O E;  5D1M B;  1WEN A;  2VP7 A;  2K16 A;  2RSD A;  3ZPV E;  3U5M A;  5LKT A;  4GNG A;  2XEU A;  2G43 A;  3FM8 C;  4GNE A;  2LV9 A;  2HYE D;  2KRE A;  4ZQL A;  2E6S A;  3U5P A;  1WEM A;  5KH3 A;  2YRE A;  3H7H A;  1LDK C;  4YBS A;  4O64 A;  4QF3 A;  5FB0 A;  3E2D A;  2KWN A;  4V3K C;  4LK9 A;  2ECI A;  1X4J A;  5H1T A;  2JMI A;  3FL2 A;  4QF2 A;  5AIU A;  2FD4 A;  5SVI B;  2M3H A;  2VJE B;  3T6R A;  3N9O A;  2ZET C;  4R7E A;  2FUU A;  3FJU B;  2YW8 A;  3LJU X;  1VD4 A;  2M6M A;  3FAO A;  2KGG A;  1Z2Q A;  5TRB A;  3LQH A;  2D8S A;  2RI7 A;  2K17 A;  4AYC A;  4C9Z A;  3N9M A;  5H1U A;  2F6N A;  5FB1 A;  2CRR A;  4CA1 A;  2CT2 A;  1F62 A;  5SVY A;  5FEY A;  5C11 A;  4GND A;  4X3G A;  4YBT A;  2QJ0 A;  3KDE C;  5K3Q A;  2LGG A;  2YUC A;  4R2Y A;  3LVR E;  3LQI A;  3PUR A;  2MKE A;  4W4U A;  1T1H A;  2MD8 C;  1MBM A;  2L80 A;  3ZVZ B;  4A49 A;  1JOC A;  3DQV R;  2C2L A;  3SOU A;  2ECN A;  4R8P K;  3MHS A;  1HYJ A;  4BBQ A;  1V87 A;  2PNX A;  5TDR A;  2H0D B;  3LVQ E;  3JUE A;  5LCW B;  4V3L C;  4N4F A;  3FEH A;  4GNF A;  2ECT A;  4AUQ B;  2KYU A;  2FSA A;  2LAU A;  1VYX A;  4IC2 A;  2M85 A;  2DX8 A;  5TBN A;  3O36 A;  2LGV A;  2QIC A;  2KGI A;  1DCQ A;  3IHP A;  4YC9 A;  1WE9 A;  3KV6 A;  2K1J A;  3U5N A;  3Q1D A;  2KKY A;  3T9K A;  1RMD A;  4TKP B;  2KFT A;  2EGP A;  5B8D A;  2Y1M A;  4FO9 A;  4YAB A;  2JRJ A;  4MSX A;  1WEW A;  5AIT A;  3NG2 A;  2ECG A;  2VPD A;  2CSZ A;  1JM7 A;  2VJF A;  4WZ2 A;  2QIZ A;  2M13 A;  2AN6 A;  1DVP A;  4O62 A;  2DJA A;  2YHO A;  3N9Q A;  1WEU A;  2YYR A;  2IDA A;  2XB1 A;  2YSM A;  4FIP A;  2LDR A;  4FJC A;  3N9N A;  2RR4 A;  4Q6F A;  2OWA A;  1X4U A;  5EYA F;  2MT5 A;  2KWJ A;  3U5O A;  1WEO A;  3L1Z B;  2CKL B;  3RTR B;  2MA5 A;  1FP0 A;  2K4D A;  1FBV A;  3O34 A;  2NAA A;  2KWO A;  2IQJ A;  1LDJ B;  3ZTG A;  2VNF A;  3O33 A;  1WES A;  3DWD A;  3LDY A;  3ZNI A;  2CRW A;  3C6W A;  1MM3 A;  3O37 A;  4A4C A;  2JMJ A;  1BOR A;  4YAT A;  4YAX A;  2LQ6 A;  2MNY A;  2G6Q A;  2VPE A;  3RPG C;  1G25 A;  3PUQ A;  5B76 A;  1VFY A;  3M63 A;  5LKX A;  4I7B A;  2LXH C;  3C5K A;  5D1L B;  2KIZ A;  5SVI A;  2VJE A;  2L0B A;  5B77 A;  3DDT A;  3VK6 A;  2CON A;  2XOC A;  3M62 A;  2VPB A;  4ZUX U;  4AP4 A;  3L1X A;  4QQ4 A;  3ZPV 1;  2L75 A;  5KH7 A;  2PUY A;  2JM3 A;  2YT5 A;  3O70 A;  3L11 A;  2YVR A;  2KKX A;  2VJF B;  3GV4 A;  2JUN A;  5B78 A;  1WEQ A;  2ECV A;  4WZ0 A;  2I50 A;  2MUM A;  4GB0 A;  5B79 A;  5G04 B;  2ECW A;  2LRI C;  2YQM A;  2LN0 A;  5TDW A;  3SHB A;  4A4B A;  2KWK A;  2XOZ A;  1WGM A;  2M1R A;  4N3W A;  3N9P A;  3LQJ A;  3N9L A;  5TAB A;  2XP0 A;  4LLB A;  2KU3 A;  3SUB A;  1WIL A;  2YHN A;  2L7P A;  4UP5 A;  1HYI A;  2E61 A;  2LGK A;  3PLW A;  4FK5 A;  4S3O B;  2YUR A;  2CSV A;  3PHD A;  2H0D A;  4OGE A;  4WA6 A;  1K2F A;  5C13 A;  5J3X A;  2FFW A;  4IC3 A;  5G05 B;  4I7D A;  4AVX A;  5DKA A;  2FUI A;  3M7K A;  4LAD B;  2VPG A;  4F1P A;  4UP0 A;  5I3L A;  3GL6 A;  1WFK A;  3V43 A;  4AYC B;  1WEV A;  2KR4 A;  5KH9 A;  2MD7 B;  5H9M A;  3HCU A;  2MNZ A;  4PPE A;  2D8U A;  4F52 B;  3O47 A;  4MVT A;  2KE1 A;  2L5U A;  4ZDT A;  2ECJ A;  1WIM A;  4OGC A;  2E6R A;  1X4I A;  3SOW A;  4A0C D;  2C2V S;  2UZG A;  3DPL R;  4Z0R A;  1E4U A;  1CHC A;  3ASL A;  2YSJ A;  2L43 A;  3KNV A;  5SVX A;  3MDB C;  5LKZ A;  3M99 A;  2MIQ A;  2EA6 A;  4P5O B;  5H1V A;  2DSM A;  3HTK C;  1U6G B;  4UI9 B;  4NN2 A;  5G0F A;  2F42 A;  3O35 A;  3HCS A;  2CSY A;  3I2D A;  4XI1 A;  3HCT A;  1Z6U A; 
#chains in the Genus database with same CATH homology
 5LKU A;  1XWH A;  4L7X A;  1Z60 A;  3EB5 A;  2Y1N A;  3O7A A;  3RPG B;  2BAY A;  2LGL A;  2CKL A;  2HDP A;  4L58 A;  4LKA A;  1MM2 A;  4YBM A;  3LRQ A;  3ZYQ A;  4I7C A;  4B86 C;  3T7L A;  3MHH A;  2Y43 A;  5FER A;  4YAD A;  1ZBD B;  1WEE A;  1JM7 B;  2G45 A;  3SOX A;  3KV5 A;  4CCG X;  2F6J A;  3QZV A;  4B7Y C;  1WEP A;  3KQI A;  2YU4 A;  2OXQ C;  5DIN A;  5B75 A;  4LJN A;  4BHW A;  3ZVY A;  2MA6 A;  5D1K B;  4PTB A;  1IYM A;  2JMD A;  2LXP C;  3EB6 A;  2EOD A;  2YQL A;  5JG6 A;  4S3O C;  4WZ3 B;  1N87 A;  5D1M B;  1WEN A;  2VP7 A;  2K16 A;  2RSD A;  3ZPV E;  3U5M A;  5LKT A;  4GNG A;  2XEU A;  2G43 A;  4GNE A;  2LV9 A;  2HYE D;  2KRE A;  4ZQL A;  2E6S A;  3U5P A;  1WEM A;  5KH3 A;  2YRE A;  1LDK C;  4YBS A;  4O64 A;  4QF3 A;  5FB0 A;  2KWN A;  4V3K C;  4LK9 A;  2ECI A;  1X4J A;  5H1T A;  2JMI A;  3FL2 A;  4QF2 A;  5AIU A;  2M3H A;  2VJE B;  3T6R A;  3N9O A;  2ZET C;  4R7E A;  2FUU A;  2YW8 A;  1VD4 A;  2M6M A;  2KGG A;  1Z2Q A;  5TRB A;  3LQH A;  2D8S A;  2RI7 A;  2K17 A;  4AYC A;  4C9Z A;  3N9M A;  5H1U A;  2F6N A;  5FB1 A;  4CA1 A;  2CT2 A;  1F62 A;  5FEY A;  5C11 A;  4GND A;  4X3G A;  4YBT A;  2QJ0 A;  2LGG A;  2YUC A;  4R2Y A;  3LQI A;  3PUR A;  4W4U A;  1T1H A;  2MD8 C;  2L80 A;  3ZVZ B;  4A49 A;  1JOC A;  3DQV R;  2C2L A;  3SOU A;  2ECN A;  4R8P K;  3MHS A;  1HYJ A;  4BBQ A;  1V87 A;  2PNX A;  5TDR A;  2H0D B;  5LCW B;  4V3L C;  4N4F A;  4GNF A;  2ECT A;  4AUQ B;  2KYU A;  2FSA A;  1VYX A;  2M85 A;  4IC2 A;  2DX8 A;  5TBN A;  3O36 A;  2LGV A;  2QIC A;  2KGI A;  3IHP A;  4YC9 A;  1WE9 A;  3KV6 A;  2K1J A;  3U5N A;  1RMD A;  4TKP B;  2KFT A;  2EGP A;  5B8D A;  2Y1M A;  4FO9 A;  4YAB A;  2JRJ A;  4MSX A;  1WEW A;  5AIT A;  3NG2 A;  2ECG A;  2VPD A;  2CSZ A;  1JM7 A;  2VJF A;  4WZ2 A;  2QIZ A;  2AN6 A;  1DVP A;  2YHO A;  3N9Q A;  1WEU A;  2YYR A;  2IDA A;  2XB1 A;  2YSM A;  4FIP A;  2LDR A;  4FJC A;  3N9N A;  4Q6F A;  1X4U A;  5EYA F;  2MT5 A;  2KWJ A;  3U5O A;  1WEO A;  3L1Z B;  2CKL B;  3RTR B;  2MA5 A;  1FP0 A;  2K4D A;  1FBV A;  3O34 A;  2NAA A;  2KWO A;  1LDJ B;  3ZTG A;  2VNF A;  3O33 A;  1WES A;  3ZNI A;  3C6W A;  1MM3 A;  3O37 A;  4A4C A;  2JMJ A;  1BOR A;  4YAT A;  4YAX A;  2LQ6 A;  2MNY A;  2G6Q A;  2VPE A;  3RPG C;  1G25 A;  3PUQ A;  5B76 A;  1VFY A;  3M63 A;  5LKX A;  4I7B A;  2LXH C;  3C5K A;  5D1L B;  2KIZ A;  2VJE A;  2L0B A;  5B77 A;  3VK6 A;  3M62 A;  2VPB A;  4ZUX U;  4AP4 A;  3L1X A;  3ZPV 1;  2L75 A;  5KH7 A;  2PUY A;  2YT5 A;  3O70 A;  3L11 A;  2VJF B;  3GV4 A;  5B78 A;  1WEQ A;  2ECV A;  4WZ0 A;  2I50 A;  2MUM A;  4GB0 A;  5B79 A;  5G04 B;  2ECW A;  2LRI C;  2YQM A;  2LN0 A;  5TDW A;  3SHB A;  4A4B A;  2KWK A;  1WGM A;  2M1R A;  4N3W A;  3N9P A;  3LQJ A;  3N9L A;  5TAB A;  4LLB A;  2KU3 A;  1WIL A;  2YHN A;  4UP5 A;  1HYI A;  2LGK A;  4FK5 A;  4S3O B;  2YUR A;  3PHD A;  2H0D A;  4WA6 A;  1K2F A;  5C13 A;  5J3X A;  4IC3 A;  5G05 B;  4I7D A;  4AVX A;  5DKA A;  2FUI A;  4LAD B;  2VPG A;  4UP0 A;  5I3L A;  3GL6 A;  1WFK A;  3V43 A;  4AYC B;  1WEV A;  2KR4 A;  5KH9 A;  2MD7 B;  5H9M A;  3HCU A;  2MNZ A;  4PPE A;  4F52 B;  4MVT A;  2KE1 A;  2L5U A;  4ZDT A;  2ECJ A;  1WIM A;  2E6R A;  1X4I A;  3SOW A;  4A0C D;  2C2V S;  2UZG A;  3DPL R;  1E4U A;  1CHC A;  3ASL A;  2YSJ A;  2L43 A;  3KNV A;  5LKZ A;  3M99 A;  2MIQ A;  2EA6 A;  4P5O B;  5H1V A;  3HTK C;  1U6G B;  4UI9 B;  4NN2 A;  5G0F A;  2F42 A;  3O35 A;  3HCS A;  2CSY A;  3I2D A;  4XI1 A;  3HCT A;  1Z6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...