2LGKA

Nmr structure of uhrf1 phd domains in a complex with histone h3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgkA00
2CSYA 1MM2A 2H0DB 4S3OB 4BHWA 2KWJA 1F62A 2JMIA 2KWKA 1K2FA 5TDRA 4PPEA 3O33A 3N9LA 4FJCA 3FL2A 3GL6A 4I7CA 5FEYA 4YABA 2NAAA 4UP0A 5TBNA 4YBMA 5D1KB 2IDAA 5B75A 3RTRB 4AYCA 4YBTA 2LGKA 2EODA 1Z60A 2VNFA 3ZNIA 2YQLA 5B79A 4YBSA 4AUQB 3IHPA 4B7YC 4P5OB 2I50A 4W4UA 4A4CA 3O37A 2L75A 3GV4A 2KU3A 3NG2A 3M63A 2KWOA 4PTBA 4F52B 1WEVA 2L5UA 2LXPC 1IYMA 3EB5A 3KNVA 2L80A 4GB0A 4GNEA 1RMDA 1WILA 2LQ6A 1WENA 3C5KA 5FB0A 4S3OC 1WESA 3U5PA 4Q6FA 2M85A 3EB6A 5J3XA 2RSDA 2QIZA 3MHSA 4TKPB 4CCGX 1U6GB 2Y1MA 5LKZA 1LDKC 2OXQC 5LKUA 4MVTA 2YSJA 5FB1A 2KREA 2YHOA 2G43A 4A49A 1WE9A 2L43A 2F6JA 3O7AA 3SOWA 1V87A 4I7DA 2LRIC 2KE1A 3C6WA 1HYIA 5B78A 4YAXA 4BBQA 2ECNA 3O70A 2DX8A 1WEQA 2KIZA 3U5NA 3V43A 2FUUA 4LJNA 4FO9A 3LQIA 2LGGA 3HCUA 2M3HA 3M62A 2G45A 4YADA 2F6NA 3LQHA 2FSAA 2FUIA 2LXHC 2LDRA 4QF2A 1X4UA 3MHHA 2LGVA 3N9QA 5B77A 2MNZA 3PURA 4R8PK 3N9NA 3O35A 2YW8A 4FK5A 1X4JA 1JM7B 4NN2A 5AITA 2K1JA 5TABA 3N9PA 3PHDA 2MIQA 3N9MA 1JM7A 2E6SA 4AVXA 4V3KC 4L58A 3RPGC 2K17A 2KR4A 1E4UA 3U5OA 4GNGA 1HYJA 5EYAF 2M6MA 5KH9A 2YHNA 5TDWA 4I7BA 2VJEB 4R2YA 4ZQLA 2MD8C 3HCTA 2ECIA 5B76A 2E6RA 3L11A 1WFKA 1XWHA 2HDPA 3ZVZB 2Y43A 2EA6A 2YURA 2VPGA 5AIUA 4AYCB 4O64A 2C2LA 2RI7A 4L7XA 4N3WA 2EGPA 2LGLA 2KGGA 2CSZA 3L1XA 4YATA 1VFYA 2HYED 2C2VS 2ECVA 4MSXA 1FP0A 2MNYA 5KH7A 1X4IA 4WZ3B 5DKAA 5FERA 2CKLB 4XI1A 2PNXA 2G6QA 3O34A 5G04B 2M1RA 3LQJA 2VJFA 2ECTA 1WEOA 4C9ZA 2LN0A 2XEUA 5H9MA 4QF3A 2JMDA 2D8SA 2VJFB 2ECGA 2VP7A 4GNFA 1MM3A 3ZTGA 5KH3A 2JMJA 4X3GA 3ZPV1 4WZ2A 2K4DA 1T1HA 3KV5A 5TRBA 1LDJB 3DQVR 3VK6A 4WA6A 2YQMA 4LK9A 3QZVA 3HCSA 4LADB 5LKXA 5D1MB 4UP5A 5LKTA 2YU4A 2KGIA 4V3LC 1Z6UA 2XB1A 2YSMA 3I2DA 2BAYA 2L0BA 3ASLA 3DPLR 1G25A 1VYXA 4GNDA 2MA6A 1DVPA 1WEWA 4A4BA 5DINA 1CHCA 2JRJA 5G05B 2LV9A 1VD4A 1N87A 2QICA 2YYRA 4IC2A 3SHBA 3M99A 5G0FA 5C13A 4YC9A 2Y1NA 3ZYQA 2VPEA 4N4FA 4B86C 2MD7B 4IC3A 2QJ0A 2YUCA 5C11A 2PUYA 5JG6A 1WEMA 2ECWA 3SOXA 4UI9B 2VPBA 3RPGB 2MUMA 5H1UA 2VPDA 1WGMA 3HTKC 1Z2QA 2UZGA 2AN6A 2ZETC 1WIMA 5D1LB 2KWNA 4ZDTA 3T7LA 2VJEA 4FIPA 2YT5A 3KV6A 4WZ0A 2F42A 5B8DA 3SOUA 1WEUA 1WEEA 4AP4A 3L1ZB 2KFTA 1JOCA 3O36A 5LCWB 3U5MA 2YREA 3PUQA 4CA1A 2K16A 4LKAA 4A0CD 2CKLA 3ZVYA 3N9OA 4R7EA 5I3LA 2CT2A 1ZBDB 3LRQA 2H0DA 2MT5A 1BORA 4LLBA 2ECJA 1FBVA 5H1VA 3T6RA 5H1TA 3ZPVE 3KQIA 2KYUA 4ZUXU 1WEPA 2MA5A
chains in the Genus database with same CATH superfamily
2CSYA 1MM2A 2H0DB 2CONA 2M13A 4S3OB 4BHWA 2KWJA 1F62A 2JMIA 2KWKA 1K2FA 5TDRA 4PPEA 3FANA 3O33A 3N9LA 4FJCA 4F1PA 3FL2A 2D8UA 3GL6A 4I7CA 5FEYA 4YABA 2NAAA 4UP0A 5TBNA 4YBMA 5D1KB 2IDAA 5B75A 2DJAA 3RTRB 4AYCA 4YBTA 2LGKA 2EODA 1Z60A 3H7HA 2VNFA 3ZNIA 2YQLA 5B79A 4YBSA 4AUQB 3IHPA 4B7YC 4P5OB 2I50A 4W4UA 4A4CA 3O37A 2L75A 3GV4A 2KU3A 3LJUX 3NG2A 3M63A 2KWOA 4PTBA 4F52B 1WEVA 2L5UA 2LXPC 1IYMA 3EB5A 3KNVA 2L80A 4GB0A 4GNEA 1RMDA 1WILA 2LQ6A 1WENA 3C5KA 5FB0A 4S3OC 1WESA 3U5PA 2B0OE 4Q6FA 2M85A 3EB6A 5J3XA 2RSDA 2QIZA 3MHSA 4TKPB 4CCGX 1U6GB 3JUEA 2Y1MA 5LKZA 1LDKC 2OXQC 5LKUA 4MVTA 2YSJA 5FB1A 2KREA 2YHOA 2G43A 4A49A 1WE9A 2L43A 2KKXA 2F6JA 5SVIB 3O7AA 3SOWA 1V87A 4I7DA 2LRIC 5K3QA 2KE1A 3C6WA 1HYIA 3E2DA 5B78A 4YAXA 4BBQA 2ECNA 3O70A 2DX8A 1WEQA 2KIZA 3U5NA 3V43A 2FUUA 2OWAA 4LJNA 5SVIA 4FO9A 3LQIA 2LGGA 3HCUA 2M3HA 3M62A 2G45A 4YADA 3DWDA 2F6NA 3Q1DA 3LQHA 2FSAA 3FJUB 4H9DA 3FM8C 2FUIA 2LXHC 2LDRA 4QF2A 4O62A 1X4UA 3MHHA 2LGVA 3N9QA 5B77A 2MNZA 3PURA 4R8PK 3N9NA 3O35A 2YW8A 4FK5A 1X4JA 1JM7B 4NN2A 5AITA 2K1JA 5TABA 2FD4A 3N9PA 3PHDA 2MIQA 3N9MA 1JM7A 2E6SA 4AVXA 4V3KC 4L58A 2E61A 3RPGC 2K17A 2KR4A 2DSMA 1E4UA 2XP0A 3U5OA 4GNGA 1HYJA 5EYAF 2M6MA 5KH9A 2YHNA 5TDWA 2MKEA 4I7BA 2VJEB 4R2YA 4ZQLA 4Z0RA 2MD8C 3HCTA 2ECIA 5B76A 2E6RA 3L11A 1WFKA 1XWHA 2HDPA 3ZVZB 2Y43A 2EA6A 2YURA 2VPGA 5AIUA 4AYCB 4O64A 2C2LA 2RI7A 3FAOA 4L7XA 4N3WA 2EGPA 2EGMA 2LGLA 1DCQA 2KGGA 2CSZA 3L1XA 4YATA 4OGEA 1VFYA 2L7PA 2HYED 2C2VS 2ECVA 4MSXA 1FP0A 2MNYA 5KH7A 1X4IA 4WZ3B 2JM3A 5DKAA 2IQJA 5FERA 2CKLB 2CRRA 2PNXA 4XI1A 2G6QA 3LVQE 3O34A 5G04B 2M1RA 3T9KA 3LQJA 2VJFA 2ECTA 1WEOA 4C9ZA 2LN0A 2XEUA 5H9MA 4QF3A 2JMDA 2D8SA 2VJFB 2P57A 2ECGA 2VP7A 4GNFA 1MM3A 5SVXA 2CRWA 3PLWA 3FEHA 3ZTGA 5KH3A 2JMJA 4X3GA 3ZPV1 4WZ2A 2K4DA 1T1HA 3KV5A 5TRBA 1LDJB 3DQVR 3VK6A 4WA6A 2YQMA 4LK9A 3O47A 3QZVA 3HCSA 4LADB 5LKXA 2CSVA 5D1MB 1MBMA 4UP5A 5LKTA 2YU4A 3LVRE 2KGIA 4V3LC 3SUBA 1Z6UA 2XB1A 2YSMA 3I2DA 2BAYA 2L0BA 3ASLA 3DPLR 1G25A 1VYXA 4GNDA 3LDYA 2MA6A 1DVPA 1WEWA 4A4BA 5DINA 1CHCA 2JRJA 5G05B 2LV9A 1VD4A 1N87A 2QICA 2YYRA 4IC2A 3SHBA 3M99A 5G0FA 5C13A 4YC9A 2XOZA 2Y1NA 3ZYQA 2VPEA 4N4FA 5SVYA 4B86C 2MD7B 4IC3A 2QJ0A 2YUCA 5C11A 2PUYA 5JG6A 1WEMA 2ECWA 3SOXA 4UI9B 2VPBA 3RPGB 2XOYA 2MUMA 3DDTA 2FFWA 5H1UA 2VPDA 2RR4A 1WGMA 3HTKC 1Z2QA 2UZGA 4OGCA 2AN6A 2ZETC 1WIMA 5D1LB 2KWNA 4ZDTA 3T7LA 2VJEA 4FIPA 2YT5A 3KV6A 4WZ0A 2F42A 5B8DA 3SOUA 1WEUA 1WEEA 4AP4A 4QQ4A 3L1ZB 2KFTA 1JOCA 3O36A 2KKYA 5LCWB 3U5MA 2YREA 3PUQA 4CA1A 2K16A 4LKAA 4A0CD 3M7KA 2JUNA 2CKLA 4Z0OA 3N9OA 3ZVYA 4R7EA 2LAUA 5I3LA 2CT2A 1ZBDB 3LRQA 2EXUA 2H0DA 3MDBC 2MT5A 2XOCA 1BORA 2YVRA 4LLBA 2ECJA 1FBVA 3KDEC 5H1VA 3T6RA 5H1TA 3ZPVE 3KQIA 2KYUA 4ZUXU 1WEPA 2MA5A
chains in the Genus database with same CATH topology
2CSYA 1MM2A 2H0DB 4S3OB 4BHWA 2KWJA 1F62A 2JMIA 2KWKA 1K2FA 5TDRA 4PPEA 3O33A 3N9LA 4FJCA 3FL2A 3GL6A 4I7CA 5FEYA 4YABA 2NAAA 4UP0A 5TBNA 4YBMA 5D1KB 2IDAA 5B75A 3RTRB 4AYCA 4YBTA 2LGKA 2EODA 1Z60A 2VNFA 3ZNIA 2YQLA 5B79A 4YBSA 4AUQB 3IHPA 4B7YC 4P5OB 2I50A 4W4UA 4A4CA 3O37A 2L75A 3GV4A 2KU3A 3NG2A 3M63A 2KWOA 4PTBA 4F52B 1WEVA 2L5UA 2LXPC 1IYMA 3EB5A 3KNVA 2L80A 4GB0A 4GNEA 1RMDA 1WILA 2LQ6A 1WENA 3C5KA 5FB0A 4S3OC 1WESA 3U5PA 4Q6FA 2M85A 3EB6A 5J3XA 2RSDA 2QIZA 3MHSA 4TKPB 4CCGX 1U6GB 2Y1MA 5LKZA 1LDKC 2OXQC 5LKUA 4MVTA 2YSJA 5FB1A 2KREA 2YHOA 2G43A 4A49A 1WE9A 2L43A 2F6JA 3O7AA 3SOWA 1V87A 4I7DA 2LRIC 2KE1A 3C6WA 1HYIA 5B78A 4YAXA 4BBQA 2ECNA 3O70A 2DX8A 1WEQA 2KIZA 3U5NA 3V43A 2FUUA 4LJNA 4FO9A 3LQIA 2LGGA 3HCUA 2M3HA 3M62A 2G45A 4YADA 2F6NA 3LQHA 2FSAA 2FUIA 2LXHC 2LDRA 4QF2A 1X4UA 3MHHA 2LGVA 3N9QA 5B77A 2MNZA 3PURA 4R8PK 3N9NA 3O35A 2YW8A 4FK5A 1X4JA 1JM7B 4NN2A 5AITA 2K1JA 5TABA 3N9PA 3PHDA 2MIQA 3N9MA 1JM7A 2E6SA 4AVXA 4V3KC 4L58A 3RPGC 2K17A 2KR4A 1E4UA 3U5OA 4GNGA 1HYJA 5EYAF 2M6MA 5KH9A 2YHNA 5TDWA 4I7BA 2VJEB 4R2YA 4ZQLA 2MD8C 3HCTA 2ECIA 5B76A 2E6RA 3L11A 1WFKA 1XWHA 2HDPA 3ZVZB 2Y43A 2EA6A 2YURA 2VPGA 5AIUA 4AYCB 4O64A 2C2LA 2RI7A 4L7XA 4N3WA 2EGPA 2LGLA 2KGGA 2CSZA 3L1XA 4YATA 1VFYA 2HYED 2C2VS 2ECVA 4MSXA 1FP0A 2MNYA 5KH7A 1X4IA 4WZ3B 5DKAA 5FERA 2CKLB 4XI1A 2PNXA 2G6QA 3O34A 5G04B 2M1RA 3LQJA 2VJFA 2ECTA 1WEOA 4C9ZA 2LN0A 2XEUA 5H9MA 4QF3A 2JMDA 2D8SA 2VJFB 2ECGA 2VP7A 4GNFA 1MM3A 3ZTGA 5KH3A 2JMJA 4X3GA 3ZPV1 4WZ2A 2K4DA 1T1HA 3KV5A 5TRBA 1LDJB 3DQVR 3VK6A 4WA6A 2YQMA 4LK9A 3QZVA 3HCSA 4LADB 5LKXA 5D1MB 4UP5A 5LKTA 2YU4A 2KGIA 4V3LC 1Z6UA 2XB1A 2YSMA 3I2DA 2BAYA 2L0BA 3ASLA 3DPLR 1G25A 1VYXA 4GNDA 2MA6A 1DVPA 1WEWA 4A4BA 5DINA 1CHCA 2JRJA 5G05B 2LV9A 1VD4A 1N87A 2QICA 2YYRA 4IC2A 3SHBA 3M99A 5G0FA 5C13A 4YC9A 2Y1NA 3ZYQA 2VPEA 4N4FA 4B86C 2MD7B 4IC3A 2QJ0A 2YUCA 5C11A 2PUYA 5JG6A 1WEMA 2ECWA 3SOXA 4UI9B 2VPBA 3RPGB 2MUMA 5H1UA 2VPDA 1WGMA 3HTKC 1Z2QA 2UZGA 2AN6A 2ZETC 1WIMA 5D1LB 2KWNA 4ZDTA 3T7LA 2VJEA 4FIPA 2YT5A 3KV6A 4WZ0A 2F42A 5B8DA 3SOUA 1WEUA 1WEEA 4AP4A 3L1ZB 2KFTA 1JOCA 3O36A 5LCWB 3U5MA 2YREA 3PUQA 4CA1A 2K16A 4LKAA 4A0CD 2CKLA 3ZVYA 3N9OA 4R7EA 5I3LA 2CT2A 1ZBDB 3LRQA 2H0DA 2MT5A 1BORA 4LLBA 2ECJA 1FBVA 5H1VA 3T6RA 5H1TA 3ZPVE 3KQIA 2KYUA 4ZUXU 1WEPA 2MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSY A;  1MM2 A;  2H0D B;  4S3O B;  4BHW A;  2KWJ A;  1F62 A;  2JMI A;  2KWK A;  1K2F A;  5TDR A;  4PPE A;  3O33 A;  3N9L A;  4FJC A;  3FL2 A;  3GL6 A;  4I7C A;  5FEY A;  4YAB A;  2NAA A;  4UP0 A;  5TBN A;  4YBM A;  5D1K B;  2IDA A;  5B75 A;  3RTR B;  4AYC A;  4YBT A;  2LGK A;  2EOD A;  1Z60 A;  2VNF A;  3ZNI A;  2YQL A;  5B79 A;  4YBS A;  4AUQ B;  3IHP A;  4B7Y C;  4P5O B;  2I50 A;  4W4U A;  4A4C A;  3O37 A;  2L75 A;  3GV4 A;  2KU3 A;  3NG2 A;  3M63 A;  2KWO A;  4PTB A;  4F52 B;  1WEV A;  2L5U A;  2LXP C;  1IYM A;  3EB5 A;  3KNV A;  2L80 A;  4GB0 A;  4GNE A;  1RMD A;  1WIL A;  2LQ6 A;  1WEN A;  3C5K A;  5FB0 A;  4S3O C;  1WES A;  3U5P A;  4Q6F A;  2M85 A;  3EB6 A;  5J3X A;  2RSD A;  2QIZ A;  3MHS A;  4TKP B;  4CCG X;  1U6G B;  2Y1M A;  5LKZ A;  1LDK C;  2OXQ C;  5LKU A;  4MVT A;  2YSJ A;  5FB1 A;  2KRE A;  2YHO A;  2G43 A;  4A49 A;  1WE9 A;  2L43 A;  2F6J A;  3O7A A;  3SOW A;  1V87 A;  4I7D A;  2LRI C;  2KE1 A;  3C6W A;  1HYI A;  5B78 A;  4YAX A;  4BBQ A;  2ECN A;  3O70 A;  2DX8 A;  1WEQ A;  2KIZ A;  3U5N A;  3V43 A;  2FUU A;  4LJN A;  4FO9 A;  3LQI A;  2LGG A;  3HCU A;  2M3H A;  3M62 A;  2G45 A;  4YAD A;  2F6N A;  3LQH A;  2FSA A;  2FUI A;  2LXH C;  2LDR A;  4QF2 A;  1X4U A;  3MHH A;  2LGV A;  3N9Q A;  5B77 A;  2MNZ A;  3PUR A;  4R8P K;  3N9N A;  3O35 A;  2YW8 A;  4FK5 A;  1X4J A;  1JM7 B;  4NN2 A;  5AIT A;  2K1J A;  5TAB A;  3N9P A;  3PHD A;  2MIQ A;  3N9M A;  1JM7 A;  2E6S A;  4AVX A;  4V3K C;  4L58 A;  3RPG C;  2K17 A;  2KR4 A;  1E4U A;  3U5O A;  4GNG A;  1HYJ A;  5EYA F;  2M6M A;  5KH9 A;  2YHN A;  5TDW A;  4I7B A;  2VJE B;  4R2Y A;  4ZQL A;  2MD8 C;  3HCT A;  2ECI A;  5B76 A;  2E6R A;  3L11 A;  1WFK A;  1XWH A;  2HDP A;  3ZVZ B;  2Y43 A;  2EA6 A;  2YUR A;  2VPG A;  5AIU A;  4AYC B;  4O64 A;  2C2L A;  2RI7 A;  4L7X A;  4N3W A;  2EGP A;  2LGL A;  2KGG A;  2CSZ A;  3L1X A;  4YAT A;  1VFY A;  2HYE D;  2C2V S;  2ECV A;  4MSX A;  1FP0 A;  2MNY A;  5KH7 A;  1X4I A;  4WZ3 B;  5DKA A;  5FER A;  2CKL B;  4XI1 A;  2PNX A;  2G6Q A;  3O34 A;  5G04 B;  2M1R A;  3LQJ A;  2VJF A;  2ECT A;  1WEO A;  4C9Z A;  2LN0 A;  2XEU A;  5H9M A;  4QF3 A;  2JMD A;  2D8S A;  2VJF B;  2ECG A;  2VP7 A;  4GNF A;  1MM3 A;  3ZTG A;  5KH3 A;  2JMJ A;  4X3G A;  3ZPV 1;  4WZ2 A;  2K4D A;  1T1H A;  3KV5 A;  5TRB A;  1LDJ B;  3DQV R;  3VK6 A;  4WA6 A;  2YQM A;  4LK9 A;  3QZV A;  3HCS A;  4LAD B;  5LKX A;  5D1M B;  4UP5 A;  5LKT A;  2YU4 A;  2KGI A;  4V3L C;  1Z6U A;  2XB1 A;  2YSM A;  3I2D A;  2BAY A;  2L0B A;  3ASL A;  3DPL R;  1G25 A;  1VYX A;  4GND A;  2MA6 A;  1DVP A;  1WEW A;  4A4B A;  5DIN A;  1CHC A;  2JRJ A;  5G05 B;  2LV9 A;  1VD4 A;  1N87 A;  2QIC A;  2YYR A;  4IC2 A;  3SHB A;  3M99 A;  5G0F A;  5C13 A;  4YC9 A;  2Y1N A;  3ZYQ A;  2VPE A;  4N4F A;  4B86 C;  2MD7 B;  4IC3 A;  2QJ0 A;  2YUC A;  5C11 A;  2PUY A;  5JG6 A;  1WEM A;  2ECW A;  3SOX A;  4UI9 B;  2VPB A;  3RPG B;  2MUM A;  5H1U A;  2VPD A;  1WGM A;  3HTK C;  1Z2Q A;  2UZG A;  2AN6 A;  2ZET C;  1WIM A;  5D1L B;  2KWN A;  4ZDT A;  3T7L A;  2VJE A;  4FIP A;  2YT5 A;  3KV6 A;  4WZ0 A;  2F42 A;  5B8D A;  3SOU A;  1WEU A;  1WEE A;  4AP4 A;  3L1Z B;  2KFT A;  1JOC A;  3O36 A;  5LCW B;  3U5M A;  2YRE A;  3PUQ A;  4CA1 A;  2K16 A;  4LKA A;  4A0C D;  2CKL A;  3ZVY A;  3N9O A;  4R7E A;  5I3L A;  2CT2 A;  1ZBD B;  3LRQ A;  2H0D A;  2MT5 A;  1BOR A;  4LLB A;  2ECJ A;  1FBV A;  5H1V A;  3T6R A;  5H1T A;  3ZPV E;  3KQI A;  2KYU A;  4ZUX U;  1WEP A;  2MA5 A; 
#chains in the Genus database with same CATH topology
 2CSY A;  1MM2 A;  2H0D B;  2CON A;  2M13 A;  4S3O B;  4BHW A;  2KWJ A;  1F62 A;  2JMI A;  2KWK A;  1K2F A;  5TDR A;  4PPE A;  3FAN A;  3O33 A;  3N9L A;  4FJC A;  4F1P A;  3FL2 A;  2D8U A;  3GL6 A;  4I7C A;  5FEY A;  4YAB A;  2NAA A;  4UP0 A;  5TBN A;  4YBM A;  5D1K B;  2IDA A;  5B75 A;  2DJA A;  3RTR B;  4AYC A;  4YBT A;  2LGK A;  2EOD A;  1Z60 A;  3H7H A;  2VNF A;  3ZNI A;  2YQL A;  5B79 A;  4YBS A;  4AUQ B;  3IHP A;  4B7Y C;  4P5O B;  2I50 A;  4W4U A;  4A4C A;  3O37 A;  2L75 A;  3GV4 A;  2KU3 A;  3LJU X;  3NG2 A;  3M63 A;  2KWO A;  4PTB A;  4F52 B;  1WEV A;  2L5U A;  2LXP C;  1IYM A;  3EB5 A;  3KNV A;  2L80 A;  4GB0 A;  4GNE A;  1RMD A;  1WIL A;  2LQ6 A;  1WEN A;  3C5K A;  5FB0 A;  4S3O C;  1WES A;  3U5P A;  2B0O E;  4Q6F A;  2M85 A;  3EB6 A;  5J3X A;  2RSD A;  2QIZ A;  3MHS A;  4TKP B;  4CCG X;  1U6G B;  3JUE A;  2Y1M A;  5LKZ A;  1LDK C;  2OXQ C;  5LKU A;  4MVT A;  2YSJ A;  5FB1 A;  2KRE A;  2YHO A;  2G43 A;  4A49 A;  1WE9 A;  2L43 A;  2KKX A;  2F6J A;  5SVI B;  3O7A A;  3SOW A;  1V87 A;  4I7D A;  2LRI C;  5K3Q A;  2KE1 A;  3C6W A;  1HYI A;  3E2D A;  5B78 A;  4YAX A;  4BBQ A;  2ECN A;  3O70 A;  2DX8 A;  1WEQ A;  2KIZ A;  3U5N A;  3V43 A;  2FUU A;  2OWA A;  4LJN A;  5SVI A;  4FO9 A;  3LQI A;  2LGG A;  3HCU A;  2M3H A;  3M62 A;  2G45 A;  4YAD A;  3DWD A;  2F6N A;  3Q1D A;  3LQH A;  2FSA A;  3FJU B;  4H9D A;  3FM8 C;  2FUI A;  2LXH C;  2LDR A;  4QF2 A;  4O62 A;  1X4U A;  3MHH A;  2LGV A;  3N9Q A;  5B77 A;  2MNZ A;  3PUR A;  4R8P K;  3N9N A;  3O35 A;  2YW8 A;  4FK5 A;  1X4J A;  1JM7 B;  4NN2 A;  5AIT A;  2K1J A;  5TAB A;  2FD4 A;  3N9P A;  3PHD A;  2MIQ A;  3N9M A;  1JM7 A;  2E6S A;  4AVX A;  4V3K C;  4L58 A;  2E61 A;  3RPG C;  2K17 A;  2KR4 A;  2DSM A;  1E4U A;  2XP0 A;  3U5O A;  4GNG A;  1HYJ A;  5EYA F;  2M6M A;  5KH9 A;  2YHN A;  5TDW A;  2MKE A;  4I7B A;  2VJE B;  4R2Y A;  4ZQL A;  4Z0R A;  2MD8 C;  3HCT A;  2ECI A;  5B76 A;  2E6R A;  3L11 A;  1WFK A;  1XWH A;  2HDP A;  3ZVZ B;  2Y43 A;  2EA6 A;  2YUR A;  2VPG A;  5AIU A;  4AYC B;  4O64 A;  2C2L A;  2RI7 A;  3FAO A;  4L7X A;  4N3W A;  2EGP A;  2EGM A;  2LGL A;  1DCQ A;  2KGG A;  2CSZ A;  3L1X A;  4YAT A;  4OGE A;  1VFY A;  2L7P A;  2HYE D;  2C2V S;  2ECV A;  4MSX A;  1FP0 A;  2MNY A;  5KH7 A;  1X4I A;  4WZ3 B;  2JM3 A;  5DKA A;  2IQJ A;  5FER A;  2CKL B;  2CRR A;  2PNX A;  4XI1 A;  2G6Q A;  3LVQ E;  3O34 A;  5G04 B;  2M1R A;  3T9K A;  3LQJ A;  2VJF A;  2ECT A;  1WEO A;  4C9Z A;  2LN0 A;  2XEU A;  5H9M A;  4QF3 A;  2JMD A;  2D8S A;  2VJF B;  2P57 A;  2ECG A;  2VP7 A;  4GNF A;  1MM3 A;  5SVX A;  2CRW A;  3PLW A;  3FEH A;  3ZTG A;  5KH3 A;  2JMJ A;  4X3G A;  3ZPV 1;  4WZ2 A;  2K4D A;  1T1H A;  3KV5 A;  5TRB A;  1LDJ B;  3DQV R;  3VK6 A;  4WA6 A;  2YQM A;  4LK9 A;  3O47 A;  3QZV A;  3HCS A;  4LAD B;  5LKX A;  2CSV A;  5D1M B;  1MBM A;  4UP5 A;  5LKT A;  2YU4 A;  3LVR E;  2KGI A;  4V3L C;  3SUB A;  1Z6U A;  2XB1 A;  2YSM A;  3I2D A;  2BAY A;  2L0B A;  3ASL A;  3DPL R;  1G25 A;  1VYX A;  4GND A;  3LDY A;  2MA6 A;  1DVP A;  1WEW A;  4A4B A;  5DIN A;  1CHC A;  2JRJ A;  5G05 B;  2LV9 A;  1VD4 A;  1N87 A;  2QIC A;  2YYR A;  4IC2 A;  3SHB A;  3M99 A;  5G0F A;  5C13 A;  4YC9 A;  2XOZ A;  2Y1N A;  3ZYQ A;  2VPE A;  4N4F A;  5SVY A;  4B86 C;  2MD7 B;  4IC3 A;  2QJ0 A;  2YUC A;  5C11 A;  2PUY A;  5JG6 A;  1WEM A;  2ECW A;  3SOX A;  4UI9 B;  2VPB A;  3RPG B;  2XOY A;  2MUM A;  3DDT A;  2FFW A;  5H1U A;  2VPD A;  2RR4 A;  1WGM A;  3HTK C;  1Z2Q A;  2UZG A;  4OGC A;  2AN6 A;  2ZET C;  1WIM A;  5D1L B;  2KWN A;  4ZDT A;  3T7L A;  2VJE A;  4FIP A;  2YT5 A;  3KV6 A;  4WZ0 A;  2F42 A;  5B8D A;  3SOU A;  1WEU A;  1WEE A;  4AP4 A;  4QQ4 A;  3L1Z B;  2KFT A;  1JOC A;  3O36 A;  2KKY A;  5LCW B;  3U5M A;  2YRE A;  3PUQ A;  4CA1 A;  2K16 A;  4LKA A;  4A0C D;  3M7K A;  2JUN A;  2CKL A;  4Z0O A;  3N9O A;  3ZVY A;  4R7E A;  2LAU A;  5I3L A;  2CT2 A;  1ZBD B;  3LRQ A;  2EXU A;  2H0D A;  3MDB C;  2MT5 A;  2XOC A;  1BOR A;  2YVR A;  4LLB A;  2ECJ A;  1FBV A;  3KDE C;  5H1V A;  3T6R A;  5H1T A;  3ZPV E;  3KQI A;  2KYU A;  4ZUX U;  1WEP A;  2MA5 A; 
#chains in the Genus database with same CATH homology
 2CSY A;  1MM2 A;  2H0D B;  4S3O B;  4BHW A;  2KWJ A;  1F62 A;  2JMI A;  2KWK A;  1K2F A;  5TDR A;  4PPE A;  3O33 A;  3N9L A;  4FJC A;  3FL2 A;  3GL6 A;  4I7C A;  5FEY A;  4YAB A;  2NAA A;  4UP0 A;  5TBN A;  4YBM A;  5D1K B;  2IDA A;  5B75 A;  3RTR B;  4AYC A;  4YBT A;  2LGK A;  2EOD A;  1Z60 A;  2VNF A;  3ZNI A;  2YQL A;  5B79 A;  4YBS A;  4AUQ B;  3IHP A;  4B7Y C;  4P5O B;  2I50 A;  4W4U A;  4A4C A;  3O37 A;  2L75 A;  3GV4 A;  2KU3 A;  3NG2 A;  3M63 A;  2KWO A;  4PTB A;  4F52 B;  1WEV A;  2L5U A;  2LXP C;  1IYM A;  3EB5 A;  3KNV A;  2L80 A;  4GB0 A;  4GNE A;  1RMD A;  1WIL A;  2LQ6 A;  1WEN A;  3C5K A;  5FB0 A;  4S3O C;  1WES A;  3U5P A;  4Q6F A;  2M85 A;  3EB6 A;  5J3X A;  2RSD A;  2QIZ A;  3MHS A;  4TKP B;  4CCG X;  1U6G B;  2Y1M A;  5LKZ A;  1LDK C;  2OXQ C;  5LKU A;  4MVT A;  2YSJ A;  5FB1 A;  2KRE A;  2YHO A;  2G43 A;  4A49 A;  1WE9 A;  2L43 A;  2F6J A;  3O7A A;  3SOW A;  1V87 A;  4I7D A;  2LRI C;  2KE1 A;  3C6W A;  1HYI A;  5B78 A;  4YAX A;  4BBQ A;  2ECN A;  3O70 A;  2DX8 A;  1WEQ A;  2KIZ A;  3U5N A;  3V43 A;  2FUU A;  4LJN A;  4FO9 A;  3LQI A;  2LGG A;  3HCU A;  2M3H A;  3M62 A;  2G45 A;  4YAD A;  2F6N A;  3LQH A;  2FSA A;  2FUI A;  2LXH C;  2LDR A;  4QF2 A;  1X4U A;  3MHH A;  2LGV A;  3N9Q A;  5B77 A;  2MNZ A;  3PUR A;  4R8P K;  3N9N A;  3O35 A;  2YW8 A;  4FK5 A;  1X4J A;  1JM7 B;  4NN2 A;  5AIT A;  2K1J A;  5TAB A;  3N9P A;  3PHD A;  2MIQ A;  3N9M A;  1JM7 A;  2E6S A;  4AVX A;  4V3K C;  4L58 A;  3RPG C;  2K17 A;  2KR4 A;  1E4U A;  3U5O A;  4GNG A;  1HYJ A;  5EYA F;  2M6M A;  5KH9 A;  2YHN A;  5TDW A;  4I7B A;  2VJE B;  4R2Y A;  4ZQL A;  2MD8 C;  3HCT A;  2ECI A;  5B76 A;  2E6R A;  3L11 A;  1WFK A;  1XWH A;  2HDP A;  3ZVZ B;  2Y43 A;  2EA6 A;  2YUR A;  2VPG A;  5AIU A;  4AYC B;  4O64 A;  2C2L A;  2RI7 A;  4L7X A;  4N3W A;  2EGP A;  2LGL A;  2KGG A;  2CSZ A;  3L1X A;  4YAT A;  1VFY A;  2HYE D;  2C2V S;  2ECV A;  4MSX A;  1FP0 A;  2MNY A;  5KH7 A;  1X4I A;  4WZ3 B;  5DKA A;  5FER A;  2CKL B;  4XI1 A;  2PNX A;  2G6Q A;  3O34 A;  5G04 B;  2M1R A;  3LQJ A;  2VJF A;  2ECT A;  1WEO A;  4C9Z A;  2LN0 A;  2XEU A;  5H9M A;  4QF3 A;  2JMD A;  2D8S A;  2VJF B;  2ECG A;  2VP7 A;  4GNF A;  1MM3 A;  3ZTG A;  5KH3 A;  2JMJ A;  4X3G A;  3ZPV 1;  4WZ2 A;  2K4D A;  1T1H A;  3KV5 A;  5TRB A;  1LDJ B;  3DQV R;  3VK6 A;  4WA6 A;  2YQM A;  4LK9 A;  3QZV A;  3HCS A;  4LAD B;  5LKX A;  5D1M B;  4UP5 A;  5LKT A;  2YU4 A;  2KGI A;  4V3L C;  1Z6U A;  2XB1 A;  2YSM A;  3I2D A;  2BAY A;  2L0B A;  3ASL A;  3DPL R;  1G25 A;  1VYX A;  4GND A;  2MA6 A;  1DVP A;  1WEW A;  4A4B A;  5DIN A;  1CHC A;  2JRJ A;  5G05 B;  2LV9 A;  1VD4 A;  1N87 A;  2QIC A;  2YYR A;  4IC2 A;  3SHB A;  3M99 A;  5G0F A;  5C13 A;  4YC9 A;  2Y1N A;  3ZYQ A;  2VPE A;  4N4F A;  4B86 C;  2MD7 B;  4IC3 A;  2QJ0 A;  2YUC A;  5C11 A;  2PUY A;  5JG6 A;  1WEM A;  2ECW A;  3SOX A;  4UI9 B;  2VPB A;  3RPG B;  2MUM A;  5H1U A;  2VPD A;  1WGM A;  3HTK C;  1Z2Q A;  2UZG A;  2AN6 A;  2ZET C;  1WIM A;  5D1L B;  2KWN A;  4ZDT A;  3T7L A;  2VJE A;  4FIP A;  2YT5 A;  3KV6 A;  4WZ0 A;  2F42 A;  5B8D A;  3SOU A;  1WEU A;  1WEE A;  4AP4 A;  3L1Z B;  2KFT A;  1JOC A;  3O36 A;  5LCW B;  3U5M A;  2YRE A;  3PUQ A;  4CA1 A;  2K16 A;  4LKA A;  4A0C D;  2CKL A;  3ZVY A;  3N9O A;  4R7E A;  5I3L A;  2CT2 A;  1ZBD B;  3LRQ A;  2H0D A;  2MT5 A;  1BOR A;  4LLB A;  2ECJ A;  1FBV A;  5H1V A;  3T6R A;  5H1T A;  3ZPV E;  3KQI A;  2KYU A;  4ZUX U;  1WEP A;  2MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...