2YQLA

Solution structure of the phd domain in phd finger protein 21a
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
56
structure length
56
Chain Sequence
b'GSSGSSGHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQ'

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 21A
publication title Solution structure of the PHD domain in PHD finger protein 21A
rcsb
source organism Homo sapiens
molecule tags Transcription
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqlA00
2L75A 1WE9A 4UI9B 3ZYQA 2PNXA 2QJ0A 2CSZA 5C11A 3LRQA 2LXPC 4NN2A 3FL2A 2I50A 2C2LA 4BHWA 1WGMA 4CCGX 4YBSA 2VJFB 3T7LA 2M85A 2YSMA 4R2YA 5H1UA 2E6RA 3N9QA 4A4CA 3U5PA 1VFYA 1VD4A 2H0DB 2ECJA 2YW8A 4I7BA 1IYMA 2LXHC 2M1RA 2DX8A 4L58A 4AYCA 3EB5A 5AIUA 2F6NA 2EGPA 2YURA 2M6MA 3O36A 2C2VS 4YATA 2H0DA 2L43A 4Q6FA 2L5UA 2G6QA 3PURA 5FERA 4A49A 2HDPA 5DKAA 2ECNA 4I7DA 2EODA 4I7CA 4LJNA 3V43A 2YT5A 3M62A 3VK6A 3ZPVE 5TABA 2E6SA 3N9LA 2G45A 1WEUA 2ECIA 5D1KB 3LQHA 3U5OA 2LV9A 2LQ6A 3N9NA 1FBVA 2K17A 2YHNA 4GB0A 1WEQA 2CKLB 4XI1A 3LQJA 3GL6A 2KWOA 1WILA 4FK5A 5TDRA 1X4IA 1WEOA 2KU3A 2VNFA 2KREA 4GNFA 2ECWA 4FO9A 5TBNA 5FB1A 2YQMA 2CKLA 2MA5A 2YU4A 2VPGA 5C13A 3HCSA 4QF3A 3RPGC 3ZTGA 5LCWB 4V3LC 2AN6A 3N9PA 1HYJA 4MVTA 2LGVA 4YAXA 3SOXA 4S3OB 2JMJA 5KH3A 3ZVYA 2JMIA 4QF2A 2OXQC 4WZ0A 4F52B 2IDAA 4ZUXU 1WEEA 2MUMA 3HTKC 1Z2QA 2KWJA 4ZQLA 5TRBA 4LK9A 5J3XA 4AYCB 4MSXA 2KGIA 3MHSA 4R8PK 4WZ3B 1CHCA 3U5NA 2KE1A 1WEPA 4A0CD 2KYUA 5FB0A 2F42A 1ZBDB 2FUUA 1WESA 2MD8C 2ECVA 2LGKA 3RTRB 5H1TA 3M63A 3DPLR 2MNZA 3U5MA 2Y1MA 3O70A 3O37A 4GNEA 4WA6A 3ZVZB 1F62A 2ZETC 2MNYA 4B7YC 4X3GA 3PHDA 4L7XA 2VJEA 2BAYA 4A4BA 2KR4A 2VPBA 4IC3A 4PPEA 2KFTA 2MIQA 4YADA 2YQLA 5DINA 3SOWA 5B78A 3O35A 3ZPV1 1E4UA 5EYAF 2VPEA 5B76A 4N4FA 1K2FA 3EB6A 2YSJA 2YYRA 5H1VA 2QICA 3DQVR 1U6GB 1JM7B 4YBMA 2F6JA 2K16A 2KGGA 5B8DA 2HYED 2Y43A 1WENA 2NAAA 2YREA 2LGLA 2YHOA 2FUIA 1JM7A 1T1HA 1MM2A 3HCTA 2RI7A 2JMDA 1HYIA 4P5OB 2MT5A 4V3KC 5JG6A 1X4UA 3T6RA 2LRIC 4AP4A 2M3HA 3NG2A 4ZDTA 1V87A 4GNGA 2PUYA 2LDRA 1MM3A 5H9MA 2KWNA 4N3WA 1LDKC 4R7EA 1DVPA 2ECTA 2KWKA 2LGGA 4LADB 4O64A 3HCUA 2L0BA 2CT2A 5AITA 4C9ZA 3O7AA 2FSAA 4W4UA 5I3LA 1WEVA 1WEWA 4YBTA 5D1LB 3C5KA 4TKPB 5B77A 2K1JA 5G0FA 5TDWA 4BBQA 4GNDA 5FEYA 3N9MA 4FJCA 2QIZA 2XB1A 4S3OC 3KNVA 2VJEB 2RSDA 5G04B 2VJFA 4CA1A 4AVXA 5KH9A 3ZNIA 5LKTA 2YUCA 2D8SA 3MHHA 1FP0A 3GV4A 1Z60A 5LKXA 3RPGB 2CSYA 2VPDA 3KV5A 2ECGA 4PTBA 3C6WA 2L80A 1BORA 3QZVA 4LKAA 3L1ZB 3IHPA 1XWHA 4IC2A 5B75A 1LDJB 1X4JA 4LLBA 4FIPA 4UP5A 2VP7A 4WZ2A 1G25A 4AUQB 1JOCA 5LKUA 2G43A 3M99A 3L11A 4YABA 4YC9A 3ASLA 4B86C 3L1XA 5LKZA 2Y1NA 3KQIA 1WFKA 1RMDA 2JRJA 4UP0A 5D1MB 3PUQA 5B79A 2MD7B 3N9OA 1N87A 3LQIA 2UZGA 3SOUA 3KV6A 3SHBA 2LN0A 5G05B 2MA6A 3O33A 2KIZA 1WEMA 3O34A 5KH7A 1WIMA 2K4DA 3I2DA 2XEUA 1Z6UA 1VYXA 2EA6A
chains in the Genus database with same CATH superfamily
2L75A 2CONA 2OWAA 1WE9A 4UI9B 3ZYQA 2PNXA 2QJ0A 2CSZA 5C11A 3LRQA 2LXPC 2XOCA 4NN2A 3FL2A 2I50A 2C2LA 4BHWA 1WGMA 4CCGX 4YBSA 2CRWA 2VJFB 3T7LA 2M85A 2YSMA 4R2YA 5H1UA 2E6RA 3N9QA 4A4CA 3U5PA 1VFYA 1VD4A 2H0DB 2ECJA 2YW8A 4I7BA 1IYMA 2LXHC 4OGEA 2M1RA 2DX8A 4L58A 4AYCA 3EB5A 5AIUA 2F6NA 2XOZA 2EGPA 2YURA 3Q1DA 2M6MA 3O36A 2C2VS 3M7KA 4YATA 2H0DA 5SVIB 2L43A 4Q6FA 2L5UA 2LAUA 2G6QA 3PURA 5FERA 4A49A 2HDPA 5DKAA 2ECNA 5SVIA 2CSVA 4I7DA 2EODA 1MBMA 4I7CA 4LJNA 3V43A 2YT5A 3M62A 3VK6A 3ZPVE 5TABA 2E6SA 2CRRA 3N9LA 2G45A 1WEUA 2ECIA 5D1KB 3LQHA 3U5OA 2LV9A 2LQ6A 3N9NA 1FBVA 2K17A 2YHNA 4GB0A 1WEQA 2CKLB 4XI1A 3LQJA 4FK5A 3GL6A 2KWOA 1WILA 3PLWA 5TDRA 1X4IA 1WEOA 2KU3A 2VNFA 2KREA 4GNFA 2ECWA 4FO9A 5TBNA 5FB1A 2YQMA 2CKLA 2MA5A 2M13A 2KKXA 2YU4A 2VPGA 3LVQE 5C13A 3HCSA 4QF3A 3RPGC 2DSMA 3ZTGA 5LCWB 4V3LC 2AN6A 3N9PA 1HYJA 4O62A 4MVTA 2LGVA 4YAXA 3SOXA 4S3OB 2JMJA 3E2DA 5KH3A 3ZVYA 3FANA 2JMIA 4QF2A 2OXQC 4WZ0A 5SVXA 3FM8C 4F52B 2IDAA 3FAOA 2IQJA 4ZUXU 1WEEA 2MUMA 3HTKC 1Z2QA 2KWJA 4ZQLA 5TRBA 4LK9A 5J3XA 4AYCB 3KDEC 4MSXA 2KGIA 3MHSA 4Z0OA 4R8PK 4WZ3B 1CHCA 3U5NA 2KE1A 3DWDA 1WEPA 4A0CD 2KYUA 5FB0A 2F42A 1ZBDB 4QQ4A 2FUUA 1WESA 2MD8C 2ECVA 2LGKA 3RTRB 5H1TA 3DPLR 3M63A 2MNZA 3U5MA 2Y1MA 3O70A 3O37A 4GNEA 4WA6A 2JUNA 3ZVZB 1F62A 2ZETC 2MNYA 4B7YC 4X3GA 3PHDA 4L7XA 2VJEA 2BAYA 2EXUA 4A4BA 2KR4A 2VPBA 4IC3A 4PPEA 2KFTA 4OGCA 2MIQA 4YADA 2XOYA 2YQLA 5DINA 3SOWA 5B78A 3O35A 3ZPV1 1E4UA 5EYAF 2VPEA 5B76A 4N4FA 1K2FA 3EB6A 3MDBC 2YSJA 2YYRA 4F1PA 5H1VA 2QICA 3DQVR 1U6GB 1JM7B 4YBMA 4Z0RA 2F6JA 2K16A 2KGGA 5B8DA 2HYED 2Y43A 3O47A 1WENA 2D8UA 2NAAA 2YREA 2LGLA 2YHOA 2FUIA 1JM7A 5K3QA 1DCQA 1T1HA 1MM2A 3HCTA 3FJUB 2RI7A 2JMDA 1HYIA 4P5OB 3H7HA 2MT5A 4V3KC 5JG6A 1X4UA 3T6RA 2LRIC 4AP4A 2M3HA 3LJUX 3NG2A 4ZDTA 1V87A 4GNGA 2PUYA 2LDRA 1MM3A 2JM3A 5H9MA 2KWNA 4H9DA 4N3WA 1LDKC 4R7EA 3T9KA 1DVPA 2ECTA 2KWKA 2LGGA 3LVRE 4LADB 4O64A 3HCUA 2L0BA 2CT2A 5AITA 4C9ZA 3O7AA 2FSAA 4W4UA 5I3LA 1WEVA 1WEWA 4YBTA 5D1LB 3C5KA 4TKPB 5B77A 2K1JA 5G0FA 5TDWA 4BBQA 4GNDA 5FEYA 3N9MA 4FJCA 2QIZA 2XB1A 4S3OC 3KNVA 2VJEB 2RSDA 5G04B 2E61A 2VJFA 4CA1A 4AVXA 5KH9A 3ZNIA 5LKTA 3SUBA 2YUCA 2D8SA 2RR4A 1FP0A 3GV4A 3MHHA 1Z60A 5LKXA 3RPGB 2CSYA 2VPDA 3KV5A 2ECGA 4PTBA 3C6WA 2L80A 1BORA 3QZVA 4LKAA 3L1ZB 3DDTA 3IHPA 1XWHA 4IC2A 5B75A 3LDYA 2KKYA 1LDJB 1X4JA 2XP0A 4LLBA 4FIPA 2MKEA 4UP5A 2VP7A 4WZ2A 1G25A 4AUQB 1JOCA 5LKUA 2G43A 3M99A 3L11A 4YABA 4YC9A 3FEHA 3ASLA 4B86C 2YVRA 2DJAA 3L1XA 2FD4A 5LKZA 5SVYA 2Y1NA 3KQIA 1WFKA 1RMDA 2JRJA 4UP0A 5D1MB 3PUQA 5B79A 2L7PA 2MD7B 2P57A 3N9OA 1N87A 3LQIA 2UZGA 3SOUA 3KV6A 3SHBA 2LN0A 3JUEA 5G05B 2MA6A 3O33A 2KIZA 1WEMA 3O34A 5KH7A 1WIMA 2K4DA 3I2DA 2XEUA 1Z6UA 1VYXA 2B0OE 2EGMA 2EA6A 2FFWA
chains in the Genus database with same CATH topology
2L75A 1WE9A 4UI9B 3ZYQA 2PNXA 2QJ0A 2CSZA 5C11A 3LRQA 2LXPC 4NN2A 3FL2A 2I50A 2C2LA 4BHWA 1WGMA 4CCGX 4YBSA 2VJFB 3T7LA 2M85A 2YSMA 4R2YA 5H1UA 2E6RA 3N9QA 4A4CA 3U5PA 1VFYA 1VD4A 2H0DB 2ECJA 2YW8A 4I7BA 1IYMA 2LXHC 2M1RA 2DX8A 4L58A 4AYCA 3EB5A 5AIUA 2F6NA 2EGPA 2YURA 2M6MA 3O36A 2C2VS 4YATA 2H0DA 2L43A 4Q6FA 2L5UA 2G6QA 3PURA 5FERA 4A49A 2HDPA 5DKAA 2ECNA 4I7DA 2EODA 4I7CA 4LJNA 3V43A 2YT5A 3M62A 3VK6A 3ZPVE 5TABA 2E6SA 3N9LA 2G45A 1WEUA 2ECIA 5D1KB 3LQHA 3U5OA 2LV9A 2LQ6A 3N9NA 1FBVA 2K17A 2YHNA 4GB0A 1WEQA 2CKLB 4XI1A 3LQJA 3GL6A 2KWOA 1WILA 4FK5A 5TDRA 1X4IA 1WEOA 2KU3A 2VNFA 2KREA 4GNFA 2ECWA 4FO9A 5TBNA 5FB1A 2YQMA 2CKLA 2MA5A 2YU4A 2VPGA 5C13A 3HCSA 4QF3A 3RPGC 3ZTGA 5LCWB 4V3LC 2AN6A 3N9PA 1HYJA 4MVTA 2LGVA 4YAXA 3SOXA 4S3OB 2JMJA 5KH3A 3ZVYA 2JMIA 4QF2A 2OXQC 4WZ0A 4F52B 2IDAA 4ZUXU 1WEEA 2MUMA 3HTKC 1Z2QA 2KWJA 4ZQLA 5TRBA 4LK9A 5J3XA 4AYCB 4MSXA 2KGIA 3MHSA 4R8PK 4WZ3B 1CHCA 3U5NA 2KE1A 1WEPA 4A0CD 2KYUA 5FB0A 2F42A 1ZBDB 2FUUA 1WESA 2MD8C 2ECVA 2LGKA 3RTRB 5H1TA 3M63A 3DPLR 2MNZA 3U5MA 2Y1MA 3O70A 3O37A 4GNEA 4WA6A 3ZVZB 1F62A 2ZETC 2MNYA 4B7YC 4X3GA 3PHDA 4L7XA 2VJEA 2BAYA 4A4BA 2KR4A 2VPBA 4IC3A 4PPEA 2KFTA 2MIQA 4YADA 2YQLA 5DINA 3SOWA 5B78A 3O35A 3ZPV1 1E4UA 5EYAF 2VPEA 5B76A 4N4FA 1K2FA 3EB6A 2YSJA 2YYRA 5H1VA 2QICA 3DQVR 1U6GB 1JM7B 4YBMA 2F6JA 2K16A 2KGGA 5B8DA 2HYED 2Y43A 1WENA 2NAAA 2YREA 2LGLA 2YHOA 2FUIA 1JM7A 1T1HA 1MM2A 3HCTA 2RI7A 2JMDA 1HYIA 4P5OB 2MT5A 4V3KC 5JG6A 1X4UA 3T6RA 2LRIC 4AP4A 2M3HA 3NG2A 4ZDTA 1V87A 4GNGA 2PUYA 2LDRA 1MM3A 5H9MA 2KWNA 4N3WA 1LDKC 4R7EA 1DVPA 2ECTA 2KWKA 2LGGA 4LADB 4O64A 3HCUA 2L0BA 2CT2A 5AITA 4C9ZA 3O7AA 2FSAA 4W4UA 5I3LA 1WEVA 1WEWA 4YBTA 5D1LB 3C5KA 4TKPB 5B77A 2K1JA 5G0FA 5TDWA 4BBQA 4GNDA 5FEYA 3N9MA 4FJCA 2QIZA 2XB1A 4S3OC 3KNVA 2VJEB 2RSDA 5G04B 2VJFA 4CA1A 4AVXA 5KH9A 3ZNIA 5LKTA 2YUCA 2D8SA 3MHHA 1FP0A 3GV4A 1Z60A 5LKXA 3RPGB 2CSYA 2VPDA 3KV5A 2ECGA 4PTBA 3C6WA 2L80A 1BORA 3QZVA 4LKAA 3L1ZB 3IHPA 1XWHA 4IC2A 5B75A 1LDJB 1X4JA 4LLBA 4FIPA 4UP5A 2VP7A 4WZ2A 1G25A 4AUQB 1JOCA 5LKUA 2G43A 3M99A 3L11A 4YABA 4YC9A 3ASLA 4B86C 3L1XA 5LKZA 2Y1NA 3KQIA 1WFKA 1RMDA 2JRJA 4UP0A 5D1MB 3PUQA 5B79A 2MD7B 3N9OA 1N87A 3LQIA 2UZGA 3SOUA 3KV6A 3SHBA 2LN0A 5G05B 2MA6A 3O33A 2KIZA 1WEMA 3O34A 5KH7A 1WIMA 2K4DA 3I2DA 2XEUA 1Z6UA 1VYXA 2EA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  1WE9 A;  4UI9 B;  3ZYQ A;  2PNX A;  2QJ0 A;  2CSZ A;  5C11 A;  3LRQ A;  2LXP C;  4NN2 A;  3FL2 A;  2I50 A;  2C2L A;  4BHW A;  1WGM A;  4CCG X;  4YBS A;  2VJF B;  3T7L A;  2M85 A;  2YSM A;  4R2Y A;  5H1U A;  2E6R A;  3N9Q A;  4A4C A;  3U5P A;  1VFY A;  1VD4 A;  2H0D B;  2ECJ A;  2YW8 A;  4I7B A;  1IYM A;  2LXH C;  2M1R A;  2DX8 A;  4L58 A;  4AYC A;  3EB5 A;  5AIU A;  2F6N A;  2EGP A;  2YUR A;  2M6M A;  3O36 A;  2C2V S;  4YAT A;  2H0D A;  2L43 A;  4Q6F A;  2L5U A;  2G6Q A;  3PUR A;  5FER A;  4A49 A;  2HDP A;  5DKA A;  2ECN A;  4I7D A;  2EOD A;  4I7C A;  4LJN A;  3V43 A;  2YT5 A;  3M62 A;  3VK6 A;  3ZPV E;  5TAB A;  2E6S A;  3N9L A;  2G45 A;  1WEU A;  2ECI A;  5D1K B;  3LQH A;  3U5O A;  2LV9 A;  2LQ6 A;  3N9N A;  1FBV A;  2K17 A;  2YHN A;  4GB0 A;  1WEQ A;  2CKL B;  4XI1 A;  3LQJ A;  3GL6 A;  2KWO A;  1WIL A;  4FK5 A;  5TDR A;  1X4I A;  1WEO A;  2KU3 A;  2VNF A;  2KRE A;  4GNF A;  2ECW A;  4FO9 A;  5TBN A;  5FB1 A;  2YQM A;  2CKL A;  2MA5 A;  2YU4 A;  2VPG A;  5C13 A;  3HCS A;  4QF3 A;  3RPG C;  3ZTG A;  5LCW B;  4V3L C;  2AN6 A;  3N9P A;  1HYJ A;  4MVT A;  2LGV A;  4YAX A;  3SOX A;  4S3O B;  2JMJ A;  5KH3 A;  3ZVY A;  2JMI A;  4QF2 A;  2OXQ C;  4WZ0 A;  4F52 B;  2IDA A;  4ZUX U;  1WEE A;  2MUM A;  3HTK C;  1Z2Q A;  2KWJ A;  4ZQL A;  5TRB A;  4LK9 A;  5J3X A;  4AYC B;  4MSX A;  2KGI A;  3MHS A;  4R8P K;  4WZ3 B;  1CHC A;  3U5N A;  2KE1 A;  1WEP A;  4A0C D;  2KYU A;  5FB0 A;  2F42 A;  1ZBD B;  2FUU A;  1WES A;  2MD8 C;  2ECV A;  2LGK A;  3RTR B;  5H1T A;  3M63 A;  3DPL R;  2MNZ A;  3U5M A;  2Y1M A;  3O70 A;  3O37 A;  4GNE A;  4WA6 A;  3ZVZ B;  1F62 A;  2ZET C;  2MNY A;  4B7Y C;  4X3G A;  3PHD A;  4L7X A;  2VJE A;  2BAY A;  4A4B A;  2KR4 A;  2VPB A;  4IC3 A;  4PPE A;  2KFT A;  2MIQ A;  4YAD A;  2YQL A;  5DIN A;  3SOW A;  5B78 A;  3O35 A;  3ZPV 1;  1E4U A;  5EYA F;  2VPE A;  5B76 A;  4N4F A;  1K2F A;  3EB6 A;  2YSJ A;  2YYR A;  5H1V A;  2QIC A;  3DQV R;  1U6G B;  1JM7 B;  4YBM A;  2F6J A;  2K16 A;  2KGG A;  5B8D A;  2HYE D;  2Y43 A;  1WEN A;  2NAA A;  2YRE A;  2LGL A;  2YHO A;  2FUI A;  1JM7 A;  1T1H A;  1MM2 A;  3HCT A;  2RI7 A;  2JMD A;  1HYI A;  4P5O B;  2MT5 A;  4V3K C;  5JG6 A;  1X4U A;  3T6R A;  2LRI C;  4AP4 A;  2M3H A;  3NG2 A;  4ZDT A;  1V87 A;  4GNG A;  2PUY A;  2LDR A;  1MM3 A;  5H9M A;  2KWN A;  4N3W A;  1LDK C;  4R7E A;  1DVP A;  2ECT A;  2KWK A;  2LGG A;  4LAD B;  4O64 A;  3HCU A;  2L0B A;  2CT2 A;  5AIT A;  4C9Z A;  3O7A A;  2FSA A;  4W4U A;  5I3L A;  1WEV A;  1WEW A;  4YBT A;  5D1L B;  3C5K A;  4TKP B;  5B77 A;  2K1J A;  5G0F A;  5TDW A;  4BBQ A;  4GND A;  5FEY A;  3N9M A;  4FJC A;  2QIZ A;  2XB1 A;  4S3O C;  3KNV A;  2VJE B;  2RSD A;  5G04 B;  2VJF A;  4CA1 A;  4AVX A;  5KH9 A;  3ZNI A;  5LKT A;  2YUC A;  2D8S A;  3MHH A;  1FP0 A;  3GV4 A;  1Z60 A;  5LKX A;  3RPG B;  2CSY A;  2VPD A;  3KV5 A;  2ECG A;  4PTB A;  3C6W A;  2L80 A;  1BOR A;  3QZV A;  4LKA A;  3L1Z B;  3IHP A;  1XWH A;  4IC2 A;  5B75 A;  1LDJ B;  1X4J A;  4LLB A;  4FIP A;  4UP5 A;  2VP7 A;  4WZ2 A;  1G25 A;  4AUQ B;  1JOC A;  5LKU A;  2G43 A;  3M99 A;  3L11 A;  4YAB A;  4YC9 A;  3ASL A;  4B86 C;  3L1X A;  5LKZ A;  2Y1N A;  3KQI A;  1WFK A;  1RMD A;  2JRJ A;  4UP0 A;  5D1M B;  3PUQ A;  5B79 A;  2MD7 B;  3N9O A;  1N87 A;  3LQI A;  2UZG A;  3SOU A;  3KV6 A;  3SHB A;  2LN0 A;  5G05 B;  2MA6 A;  3O33 A;  2KIZ A;  1WEM A;  3O34 A;  5KH7 A;  1WIM A;  2K4D A;  3I2D A;  2XEU A;  1Z6U A;  1VYX A;  2EA6 A; 
#chains in the Genus database with same CATH topology
 2L75 A;  2CON A;  2OWA A;  1WE9 A;  4UI9 B;  3ZYQ A;  2PNX A;  2QJ0 A;  2CSZ A;  5C11 A;  3LRQ A;  2LXP C;  2XOC A;  4NN2 A;  3FL2 A;  2I50 A;  2C2L A;  4BHW A;  1WGM A;  4CCG X;  4YBS A;  2CRW A;  2VJF B;  3T7L A;  2M85 A;  2YSM A;  4R2Y A;  5H1U A;  2E6R A;  3N9Q A;  4A4C A;  3U5P A;  1VFY A;  1VD4 A;  2H0D B;  2ECJ A;  2YW8 A;  4I7B A;  1IYM A;  2LXH C;  4OGE A;  2M1R A;  2DX8 A;  4L58 A;  4AYC A;  3EB5 A;  5AIU A;  2F6N A;  2XOZ A;  2EGP A;  2YUR A;  3Q1D A;  2M6M A;  3O36 A;  2C2V S;  3M7K A;  4YAT A;  2H0D A;  5SVI B;  2L43 A;  4Q6F A;  2L5U A;  2LAU A;  2G6Q A;  3PUR A;  5FER A;  4A49 A;  2HDP A;  5DKA A;  2ECN A;  5SVI A;  2CSV A;  4I7D A;  2EOD A;  1MBM A;  4I7C A;  4LJN A;  3V43 A;  2YT5 A;  3M62 A;  3VK6 A;  3ZPV E;  5TAB A;  2E6S A;  2CRR A;  3N9L A;  2G45 A;  1WEU A;  2ECI A;  5D1K B;  3LQH A;  3U5O A;  2LV9 A;  2LQ6 A;  3N9N A;  1FBV A;  2K17 A;  2YHN A;  4GB0 A;  1WEQ A;  2CKL B;  4XI1 A;  3LQJ A;  4FK5 A;  3GL6 A;  2KWO A;  1WIL A;  3PLW A;  5TDR A;  1X4I A;  1WEO A;  2KU3 A;  2VNF A;  2KRE A;  4GNF A;  2ECW A;  4FO9 A;  5TBN A;  5FB1 A;  2YQM A;  2CKL A;  2MA5 A;  2M13 A;  2KKX A;  2YU4 A;  2VPG A;  3LVQ E;  5C13 A;  3HCS A;  4QF3 A;  3RPG C;  2DSM A;  3ZTG A;  5LCW B;  4V3L C;  2AN6 A;  3N9P A;  1HYJ A;  4O62 A;  4MVT A;  2LGV A;  4YAX A;  3SOX A;  4S3O B;  2JMJ A;  3E2D A;  5KH3 A;  3ZVY A;  3FAN A;  2JMI A;  4QF2 A;  2OXQ C;  4WZ0 A;  5SVX A;  3FM8 C;  4F52 B;  2IDA A;  3FAO A;  2IQJ A;  4ZUX U;  1WEE A;  2MUM A;  3HTK C;  1Z2Q A;  2KWJ A;  4ZQL A;  5TRB A;  4LK9 A;  5J3X A;  4AYC B;  3KDE C;  4MSX A;  2KGI A;  3MHS A;  4Z0O A;  4R8P K;  4WZ3 B;  1CHC A;  3U5N A;  2KE1 A;  3DWD A;  1WEP A;  4A0C D;  2KYU A;  5FB0 A;  2F42 A;  1ZBD B;  4QQ4 A;  2FUU A;  1WES A;  2MD8 C;  2ECV A;  2LGK A;  3RTR B;  5H1T A;  3DPL R;  3M63 A;  2MNZ A;  3U5M A;  2Y1M A;  3O70 A;  3O37 A;  4GNE A;  4WA6 A;  2JUN A;  3ZVZ B;  1F62 A;  2ZET C;  2MNY A;  4B7Y C;  4X3G A;  3PHD A;  4L7X A;  2VJE A;  2BAY A;  2EXU A;  4A4B A;  2KR4 A;  2VPB A;  4IC3 A;  4PPE A;  2KFT A;  4OGC A;  2MIQ A;  4YAD A;  2XOY A;  2YQL A;  5DIN A;  3SOW A;  5B78 A;  3O35 A;  3ZPV 1;  1E4U A;  5EYA F;  2VPE A;  5B76 A;  4N4F A;  1K2F A;  3EB6 A;  3MDB C;  2YSJ A;  2YYR A;  4F1P A;  5H1V A;  2QIC A;  3DQV R;  1U6G B;  1JM7 B;  4YBM A;  4Z0R A;  2F6J A;  2K16 A;  2KGG A;  5B8D A;  2HYE D;  2Y43 A;  3O47 A;  1WEN A;  2D8U A;  2NAA A;  2YRE A;  2LGL A;  2YHO A;  2FUI A;  1JM7 A;  5K3Q A;  1DCQ A;  1T1H A;  1MM2 A;  3HCT A;  3FJU B;  2RI7 A;  2JMD A;  1HYI A;  4P5O B;  3H7H A;  2MT5 A;  4V3K C;  5JG6 A;  1X4U A;  3T6R A;  2LRI C;  4AP4 A;  2M3H A;  3LJU X;  3NG2 A;  4ZDT A;  1V87 A;  4GNG A;  2PUY A;  2LDR A;  1MM3 A;  2JM3 A;  5H9M A;  2KWN A;  4H9D A;  4N3W A;  1LDK C;  4R7E A;  3T9K A;  1DVP A;  2ECT A;  2KWK A;  2LGG A;  3LVR E;  4LAD B;  4O64 A;  3HCU A;  2L0B A;  2CT2 A;  5AIT A;  4C9Z A;  3O7A A;  2FSA A;  4W4U A;  5I3L A;  1WEV A;  1WEW A;  4YBT A;  5D1L B;  3C5K A;  4TKP B;  5B77 A;  2K1J A;  5G0F A;  5TDW A;  4BBQ A;  4GND A;  5FEY A;  3N9M A;  4FJC A;  2QIZ A;  2XB1 A;  4S3O C;  3KNV A;  2VJE B;  2RSD A;  5G04 B;  2E61 A;  2VJF A;  4CA1 A;  4AVX A;  5KH9 A;  3ZNI A;  5LKT A;  3SUB A;  2YUC A;  2D8S A;  2RR4 A;  1FP0 A;  3GV4 A;  3MHH A;  1Z60 A;  5LKX A;  3RPG B;  2CSY A;  2VPD A;  3KV5 A;  2ECG A;  4PTB A;  3C6W A;  2L80 A;  1BOR A;  3QZV A;  4LKA A;  3L1Z B;  3DDT A;  3IHP A;  1XWH A;  4IC2 A;  5B75 A;  3LDY A;  2KKY A;  1LDJ B;  1X4J A;  2XP0 A;  4LLB A;  4FIP A;  2MKE A;  4UP5 A;  2VP7 A;  4WZ2 A;  1G25 A;  4AUQ B;  1JOC A;  5LKU A;  2G43 A;  3M99 A;  3L11 A;  4YAB A;  4YC9 A;  3FEH A;  3ASL A;  4B86 C;  2YVR A;  2DJA A;  3L1X A;  2FD4 A;  5LKZ A;  5SVY A;  2Y1N A;  3KQI A;  1WFK A;  1RMD A;  2JRJ A;  4UP0 A;  5D1M B;  3PUQ A;  5B79 A;  2L7P A;  2MD7 B;  2P57 A;  3N9O A;  1N87 A;  3LQI A;  2UZG A;  3SOU A;  3KV6 A;  3SHB A;  2LN0 A;  3JUE A;  5G05 B;  2MA6 A;  3O33 A;  2KIZ A;  1WEM A;  3O34 A;  5KH7 A;  1WIM A;  2K4D A;  3I2D A;  2XEU A;  1Z6U A;  1VYX A;  2B0O E;  2EGM A;  2EA6 A;  2FFW A; 
#chains in the Genus database with same CATH homology
 2L75 A;  1WE9 A;  4UI9 B;  3ZYQ A;  2PNX A;  2QJ0 A;  2CSZ A;  5C11 A;  3LRQ A;  2LXP C;  4NN2 A;  3FL2 A;  2I50 A;  2C2L A;  4BHW A;  1WGM A;  4CCG X;  4YBS A;  2VJF B;  3T7L A;  2M85 A;  2YSM A;  4R2Y A;  5H1U A;  2E6R A;  3N9Q A;  4A4C A;  3U5P A;  1VFY A;  1VD4 A;  2H0D B;  2ECJ A;  2YW8 A;  4I7B A;  1IYM A;  2LXH C;  2M1R A;  2DX8 A;  4L58 A;  4AYC A;  3EB5 A;  5AIU A;  2F6N A;  2EGP A;  2YUR A;  2M6M A;  3O36 A;  2C2V S;  4YAT A;  2H0D A;  2L43 A;  4Q6F A;  2L5U A;  2G6Q A;  3PUR A;  5FER A;  4A49 A;  2HDP A;  5DKA A;  2ECN A;  4I7D A;  2EOD A;  4I7C A;  4LJN A;  3V43 A;  2YT5 A;  3M62 A;  3VK6 A;  3ZPV E;  5TAB A;  2E6S A;  3N9L A;  2G45 A;  1WEU A;  2ECI A;  5D1K B;  3LQH A;  3U5O A;  2LV9 A;  2LQ6 A;  3N9N A;  1FBV A;  2K17 A;  2YHN A;  4GB0 A;  1WEQ A;  2CKL B;  4XI1 A;  3LQJ A;  3GL6 A;  2KWO A;  1WIL A;  4FK5 A;  5TDR A;  1X4I A;  1WEO A;  2KU3 A;  2VNF A;  2KRE A;  4GNF A;  2ECW A;  4FO9 A;  5TBN A;  5FB1 A;  2YQM A;  2CKL A;  2MA5 A;  2YU4 A;  2VPG A;  5C13 A;  3HCS A;  4QF3 A;  3RPG C;  3ZTG A;  5LCW B;  4V3L C;  2AN6 A;  3N9P A;  1HYJ A;  4MVT A;  2LGV A;  4YAX A;  3SOX A;  4S3O B;  2JMJ A;  5KH3 A;  3ZVY A;  2JMI A;  4QF2 A;  2OXQ C;  4WZ0 A;  4F52 B;  2IDA A;  4ZUX U;  1WEE A;  2MUM A;  3HTK C;  1Z2Q A;  2KWJ A;  4ZQL A;  5TRB A;  4LK9 A;  5J3X A;  4AYC B;  4MSX A;  2KGI A;  3MHS A;  4R8P K;  4WZ3 B;  1CHC A;  3U5N A;  2KE1 A;  1WEP A;  4A0C D;  2KYU A;  5FB0 A;  2F42 A;  1ZBD B;  2FUU A;  1WES A;  2MD8 C;  2ECV A;  2LGK A;  3RTR B;  5H1T A;  3M63 A;  3DPL R;  2MNZ A;  3U5M A;  2Y1M A;  3O70 A;  3O37 A;  4GNE A;  4WA6 A;  3ZVZ B;  1F62 A;  2ZET C;  2MNY A;  4B7Y C;  4X3G A;  3PHD A;  4L7X A;  2VJE A;  2BAY A;  4A4B A;  2KR4 A;  2VPB A;  4IC3 A;  4PPE A;  2KFT A;  2MIQ A;  4YAD A;  2YQL A;  5DIN A;  3SOW A;  5B78 A;  3O35 A;  3ZPV 1;  1E4U A;  5EYA F;  2VPE A;  5B76 A;  4N4F A;  1K2F A;  3EB6 A;  2YSJ A;  2YYR A;  5H1V A;  2QIC A;  3DQV R;  1U6G B;  1JM7 B;  4YBM A;  2F6J A;  2K16 A;  2KGG A;  5B8D A;  2HYE D;  2Y43 A;  1WEN A;  2NAA A;  2YRE A;  2LGL A;  2YHO A;  2FUI A;  1JM7 A;  1T1H A;  1MM2 A;  3HCT A;  2RI7 A;  2JMD A;  1HYI A;  4P5O B;  2MT5 A;  4V3K C;  5JG6 A;  1X4U A;  3T6R A;  2LRI C;  4AP4 A;  2M3H A;  3NG2 A;  4ZDT A;  1V87 A;  4GNG A;  2PUY A;  2LDR A;  1MM3 A;  5H9M A;  2KWN A;  4N3W A;  1LDK C;  4R7E A;  1DVP A;  2ECT A;  2KWK A;  2LGG A;  4LAD B;  4O64 A;  3HCU A;  2L0B A;  2CT2 A;  5AIT A;  4C9Z A;  3O7A A;  2FSA A;  4W4U A;  5I3L A;  1WEV A;  1WEW A;  4YBT A;  5D1L B;  3C5K A;  4TKP B;  5B77 A;  2K1J A;  5G0F A;  5TDW A;  4BBQ A;  4GND A;  5FEY A;  3N9M A;  4FJC A;  2QIZ A;  2XB1 A;  4S3O C;  3KNV A;  2VJE B;  2RSD A;  5G04 B;  2VJF A;  4CA1 A;  4AVX A;  5KH9 A;  3ZNI A;  5LKT A;  2YUC A;  2D8S A;  3MHH A;  1FP0 A;  3GV4 A;  1Z60 A;  5LKX A;  3RPG B;  2CSY A;  2VPD A;  3KV5 A;  2ECG A;  4PTB A;  3C6W A;  2L80 A;  1BOR A;  3QZV A;  4LKA A;  3L1Z B;  3IHP A;  1XWH A;  4IC2 A;  5B75 A;  1LDJ B;  1X4J A;  4LLB A;  4FIP A;  4UP5 A;  2VP7 A;  4WZ2 A;  1G25 A;  4AUQ B;  1JOC A;  5LKU A;  2G43 A;  3M99 A;  3L11 A;  4YAB A;  4YC9 A;  3ASL A;  4B86 C;  3L1X A;  5LKZ A;  2Y1N A;  3KQI A;  1WFK A;  1RMD A;  2JRJ A;  4UP0 A;  5D1M B;  3PUQ A;  5B79 A;  2MD7 B;  3N9O A;  1N87 A;  3LQI A;  2UZG A;  3SOU A;  3KV6 A;  3SHB A;  2LN0 A;  5G05 B;  2MA6 A;  3O33 A;  2KIZ A;  1WEM A;  3O34 A;  5KH7 A;  1WIM A;  2K4D A;  3I2D A;  2XEU A;  1Z6U A;  1VYX A;  2EA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...