2YQLA

Solution structure of the phd domain in phd finger protein 21a
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
56
structure length
56
Chain Sequence
GSSGSSGHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PHD finger protein 21A
publication title Solution structure of the PHD domain in PHD finger protein 21A
rcsb
source organism Homo sapiens
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqlA00
1X4UA 3I2DA 3ZPVE 3HCSA 4A4CA 3DQVR 3ZVYA 4TKPB 4IC3A 2LXPC 5FEYA 3M62A 2KR4A 3KV5A 4I7BA 2ECJA 4AP4A 4YBMA 2CT2A 2RSDA 1WEWA 1T1HA 4IC2A 2H0DB 2F6JA 3ZNIA 2LGGA 5TDWA 1WEUA 3HTKC 3O37A 2HDPA 2YQMA 4AYCB 2LRIC 3O70A 2L80A 3NG2A 2G43A 4XI1A 2L5UA 2LGKA 3N9OA 3O34A 3U5PA 2Y1NA 3ZVZB 3LQJA 5KH3A 1VYXA 2CKLA 3KNVA 5AIUA 3O35A 3PURA 2ECWA 5B77A 2KWJA 3DPLR 2KWKA 2M6MA 2VPEA 2K4DA 2K17A 2XEUA 4GNDA 1JM7B 4R2YA 2YQLA 4AVXA 3ASLA 3IHPA 2EODA 4FK5A 5LKTA 1FP0A 4WZ3B 3ZPV1 4A0CD 4ZUXU 5B76A 3ZTGA 2K16A 2BAYA 4AUQB 3MHSA 1WIMA 4WZ2A 4V3KC 1MM3A 2XB1A 3KQIA 1Z2QA 4LKAA 3SOXA 5B8DA 4QF3A 5TBNA 1N87A 4MSXA 4ZDTA 4FIPA 2CSZA 5J3XA 1HYIA 1K2FA 4ZQLA 4LADB 4YAXA 2LQ6A 2LDRA 1BORA 4S3OC 2YW8A 1WEMA 5AITA 4I7DA 2MD7B 4YBTA 4WZ0A 1DVPA 2MNZA 1VD4A 2F6NA 2AN6A 4O64A 4N3WA 4YC9A 2JMJA 2KIZA 4WA6A 1HYJA 3HCUA 3N9LA 4UP5A 1WFKA 2VJEB 4N4FA 3FL2A 2ECGA 4CA1A 2K1JA 2ZETC 2MA6A 3LQHA 2HYED 1WEPA 5KH7A 4S3OB 2FSAA 4FO9A 2PUYA 4PTBA 1F62A 1MM2A 4L58A 3SHBA 4I7CA 2L75A 2ECNA 5D1LB 3EB6A 3EB5A 2G6QA 2NAAA 5LKUA 5TRBA 5TDRA 2VPDA 2ECVA 4X3GA 2VPGA 1WEOA 2QICA 2KU3A 3HCTA 2PNXA 4FJCA 4UP0A 2E6SA 3LRQA 3O36A 2FUIA 2YREA 1WESA 5LCWB 2MD8C 2L0BA 4GNFA 3O7AA 1XWHA 4Q6FA 4UI9B 2IDAA 3SOUA 3KV6A 1X4IA 2MT5A 3MHHA 4R8PK 2OXQC 3LQIA 3N9MA 2YU4A 3U5OA 2YSMA 3V43A 1WEVA 3PUQA 2QJ0A 3ZYQA 2VJEA 1WENA 2JRJA 3PHDA 3RPGC 2VPBA 3M99A 2D8SA 3VK6A 2H0DA 2L43A 3T6RA 1WE9A 2KGGA 5H1TA 3C6WA 2RI7A 1X4JA 3L1XA 4AYCA 4YATA 2LN0A 4A4BA 3N9QA 5G04B 5DINA 3QZVA 2KFTA 2MNYA 5D1KB 2Y1MA 1V87A 5KH9A 4R7EA 5FB1A 1ZBDB 2YURA 4A49A 2CSYA 4LJNA 2EA6A 2Y43A 3RPGB 5FB0A 2C2VS 2YSJA 4GNEA 2YHOA 1JM7A 3M63A 4BBQA 4L7XA 4YABA 2LXHC 1Z60A 1FBVA 2VJFB 3U5NA 4NN2A 2JMIA 4BHWA 3N9NA 5C11A 4P5OB 4CCGX 4YBSA 2LV9A 5G0FA 2KWNA 4W4UA 2MIQA 3GV4A 5B79A 5I3LA 5G05B 4QF2A 4F52B 5TABA 2LGLA 2KWOA 2LGVA 5LKXA 4PPEA 3L1ZB 2KGIA 2I50A 4V3LC 1WEQA 5B75A 2FUUA 5C13A 1IYMA 2UZGA 1WGMA 4MVTA 2VP7A 1LDKC 1VFYA 1E4UA 1G25A 3T7LA 1WEEA 2EGPA 2G45A 2YT5A 2M1RA 3GL6A 2ECTA 2ECIA 5JG6A 1WILA 3N9PA 2M3HA 2DX8A 5EYAF 2YHNA 5H9MA 1RMDA 5D1MB 3C5KA 4GNGA 3SOWA 3O33A 5LKZA 1U6GB 2VJFA 2VNFA 2C2LA 2MUMA 3L11A 1Z6UA 1CHCA 4LK9A 2YYRA 5H1UA 5B78A 2E6RA 4GB0A 2KYUA 2F42A 2KE1A 2CKLB 2KREA 2JMDA 5DKAA 1LDJB 3U5MA 4B7YC 5H1VA 2M85A 1JOCA 4YADA 2MA5A 3RTRB 5FERA 2QIZA 4LLBA 4C9ZA 2YUCA 4B86C
chains in the Genus database with same CATH superfamily
1X4UA 3I2DA 3ZPVE 3HCSA 4A4CA 3DQVR 3ZVYA 4TKPB 4IC3A 2LXPC 5FEYA 3M62A 2KR4A 3KV5A 4I7BA 2ECJA 4AP4A 4YBMA 2CT2A 2RSDA 1WEWA 1T1HA 4IC2A 2H0DB 2F6JA 3ZNIA 2LGGA 5TDWA 1WEUA 3HTKC 3O37A 2MKEA 2KKYA 2HDPA 2YQMA 4AYCB 2LRIC 3MDBC 3O70A 2L80A 3NG2A 3Q1DA 2G43A 4XI1A 2L5UA 2LGKA 3N9OA 3O34A 1MBMA 3U5PA 2Y1NA 3FANA 3ZVZB 1DCQA 3LQJA 5SVXA 5KH3A 1VYXA 2CKLA 3KNVA 5AIUA 3O35A 3PURA 2ECWA 5B77A 2D8UA 2B0OE 2KWJA 3DPLR 2KWKA 2M6MA 2VPEA 2K4DA 4Z0RA 2K17A 2XEUA 4GNDA 1JM7B 4R2YA 2YQLA 4AVXA 3ASLA 3IHPA 2EODA 2DSMA 2OWAA 4FK5A 5LKTA 1FP0A 4WZ3B 3ZPV1 4A0CD 3LJUX 4ZUXU 5B76A 3ZTGA 2K16A 4O62A 2BAYA 4AUQB 3MHSA 2KKXA 1WIMA 2FD4A 2XB1A 4V3KC 1MM3A 4WZ2A 3KQIA 1Z2QA 4LKAA 3SOXA 5B8DA 2DJAA 4QF3A 5TBNA 1N87A 4MSXA 4ZDTA 4FIPA 2CSZA 5J3XA 3T9KA 1K2FA 1HYIA 4ZQLA 4LADB 2CONA 4YAXA 2LQ6A 2LDRA 1BORA 4S3OC 2YW8A 1WEMA 5AITA 4I7DA 2P57A 2MD7B 4YBTA 4WZ0A 1DVPA 2MNZA 5SVIB 1VD4A 2F6NA 2AN6A 4O64A 4N3WA 2IQJA 4YC9A 3FM8C 3KDEC 2JMJA 2KIZA 4WA6A 1HYJA 3HCUA 3N9LA 4UP5A 1WFKA 2VJEB 4N4FA 4Z0OA 3FL2A 4F1PA 2ECGA 4CA1A 2K1JA 2ZETC 2MA6A 3LQHA 2HYED 1WEPA 5KH7A 4S3OB 2FSAA 4FO9A 2PUYA 4PTBA 1F62A 1MM2A 4L58A 3SHBA 4I7CA 2L75A 2ECNA 5D1LB 3EB6A 3EB5A 2G6QA 2NAAA 5SVYA 5LKUA 5TRBA 5TDRA 2VPDA 2ECVA 2JM3A 4X3GA 2VPGA 1WEOA 2QICA 2KU3A 3HCTA 2PNXA 4FJCA 4UP0A 2XOCA 2E6SA 3LRQA 3O36A 2FUIA 2YREA 1WESA 5LCWB 2MD8C 2L0BA 2CSVA 4GNFA 3O7AA 1XWHA 4Q6FA 4UI9B 5SVIA 2IDAA 3SOUA 3KV6A 1X4IA 2MT5A 3MHHA 4R8PK 2OXQC 3LQIA 3N9MA 2YU4A 3U5OA 2YSMA 3V43A 2LAUA 1WEVA 3PUQA 2QJ0A 3JUEA 3PLWA 2JUNA 3ZYQA 2VJEA 1WENA 2FFWA 2EGMA 2JRJA 3PHDA 3RPGC 2VPBA 3M99A 2D8SA 3VK6A 2H0DA 2L43A 3T6RA 1WE9A 2KGGA 5H1TA 3C6WA 2RI7A 1X4JA 3L1XA 4AYCA 4YATA 2LN0A 3LVRE 4A4BA 3N9QA 5G04B 5DINA 3QZVA 2KFTA 2MNYA 5D1KB 2Y1MA 1V87A 5KH9A 4R7EA 5FB1A 1ZBDB 3FJUB 2YURA 4A49A 2CSYA 4LJNA 2EA6A 2Y43A 3RPGB 5FB0A 2XOZA 2C2VS 3DWDA 2YSJA 4GNEA 2YHOA 1JM7A 3M63A 4BBQA 4L7XA 4YABA 2LXHC 1Z60A 1FBVA 2VJFB 3U5NA 2EXUA 4NN2A 2JMIA 4BHWA 3N9NA 5C11A 4P5OB 3FEHA 4CCGX 4YBSA 2LV9A 5G0FA 2CRRA 2KWNA 3O47A 4W4UA 2MIQA 3GV4A 3M7KA 5B79A 5I3LA 5G05B 4QF2A 4F52B 5TABA 2LGLA 2KWOA 4OGCA 2LGVA 5LKXA 4PPEA 3FAOA 3L1ZB 2KGIA 2I50A 4V3LC 1WEQA 5B75A 2FUUA 5C13A 1IYMA 2UZGA 1WGMA 3SUBA 4MVTA 3DDTA 3LVQE 2VP7A 1LDKC 1VFYA 1E4UA 1G25A 3T7LA 2E61A 1WEEA 2EGPA 2G45A 2YT5A 4QQ4A 2M1RA 3GL6A 2ECTA 2ECIA 5JG6A 1WILA 3N9PA 2M3HA 2DX8A 5EYAF 2L7PA 2XOYA 2YHNA 5H9MA 1RMDA 3C5KA 4GNGA 5D1MB 3SOWA 3O33A 5LKZA 1U6GB 2VJFA 2VNFA 3H7HA 2CRWA 2C2LA 2MUMA 3L11A 1Z6UA 1CHCA 4OGEA 4LK9A 2YYRA 5H1UA 5B78A 2E6RA 2XP0A 2YVRA 4GB0A 2KYUA 2F42A 2KE1A 2CKLB 3LDYA 5K3QA 2KREA 4H9DA 2JMDA 5DKAA 2M13A 1LDJB 3E2DA 3U5MA 4B7YC 5H1VA 2M85A 1JOCA 4YADA 2MA5A 3RTRB 5FERA 2QIZA 2RR4A 4LLBA 4C9ZA 2YUCA 4B86C
chains in the Genus database with same CATH topology
1X4UA 3I2DA 3ZPVE 3HCSA 4A4CA 3DQVR 3ZVYA 4TKPB 4IC3A 2LXPC 5FEYA 3M62A 2KR4A 3KV5A 4I7BA 2ECJA 4AP4A 4YBMA 2CT2A 2RSDA 1WEWA 1T1HA 4IC2A 2H0DB 2F6JA 3ZNIA 2LGGA 5TDWA 1WEUA 3HTKC 3O37A 2HDPA 2YQMA 4AYCB 2LRIC 3O70A 2L80A 3NG2A 2G43A 4XI1A 2L5UA 2LGKA 3N9OA 3O34A 3U5PA 2Y1NA 3ZVZB 3LQJA 5KH3A 1VYXA 2CKLA 3KNVA 5AIUA 3O35A 3PURA 2ECWA 5B77A 2KWJA 3DPLR 2KWKA 2M6MA 2VPEA 2K4DA 2K17A 2XEUA 4GNDA 1JM7B 4R2YA 2YQLA 4AVXA 3ASLA 3IHPA 2EODA 4FK5A 5LKTA 1FP0A 4WZ3B 3ZPV1 4A0CD 4ZUXU 5B76A 3ZTGA 2K16A 2BAYA 4AUQB 3MHSA 1WIMA 4WZ2A 4V3KC 1MM3A 2XB1A 3KQIA 1Z2QA 4LKAA 3SOXA 5B8DA 4QF3A 5TBNA 1N87A 4MSXA 4ZDTA 4FIPA 2CSZA 5J3XA 1HYIA 1K2FA 4ZQLA 4LADB 4YAXA 2LQ6A 2LDRA 1BORA 4S3OC 2YW8A 1WEMA 5AITA 4I7DA 2MD7B 4YBTA 4WZ0A 1DVPA 2MNZA 1VD4A 2F6NA 2AN6A 4O64A 4N3WA 4YC9A 2JMJA 2KIZA 4WA6A 1HYJA 3HCUA 3N9LA 4UP5A 1WFKA 2VJEB 4N4FA 3FL2A 2ECGA 4CA1A 2K1JA 2ZETC 2MA6A 3LQHA 2HYED 1WEPA 5KH7A 4S3OB 2FSAA 4FO9A 2PUYA 4PTBA 1F62A 1MM2A 4L58A 3SHBA 4I7CA 2L75A 2ECNA 5D1LB 3EB6A 3EB5A 2G6QA 2NAAA 5LKUA 5TRBA 5TDRA 2VPDA 2ECVA 4X3GA 2VPGA 1WEOA 2QICA 2KU3A 3HCTA 2PNXA 4FJCA 4UP0A 2E6SA 3LRQA 3O36A 2FUIA 2YREA 1WESA 5LCWB 2MD8C 2L0BA 4GNFA 3O7AA 1XWHA 4Q6FA 4UI9B 2IDAA 3SOUA 3KV6A 1X4IA 2MT5A 3MHHA 4R8PK 2OXQC 3LQIA 3N9MA 2YU4A 3U5OA 2YSMA 3V43A 1WEVA 3PUQA 2QJ0A 3ZYQA 2VJEA 1WENA 2JRJA 3PHDA 3RPGC 2VPBA 3M99A 2D8SA 3VK6A 2H0DA 2L43A 3T6RA 1WE9A 2KGGA 5H1TA 3C6WA 2RI7A 1X4JA 3L1XA 4AYCA 4YATA 2LN0A 4A4BA 3N9QA 5G04B 5DINA 3QZVA 2KFTA 2MNYA 5D1KB 2Y1MA 1V87A 5KH9A 4R7EA 5FB1A 1ZBDB 2YURA 4A49A 2CSYA 4LJNA 2EA6A 2Y43A 3RPGB 5FB0A 2C2VS 2YSJA 4GNEA 2YHOA 1JM7A 3M63A 4BBQA 4L7XA 4YABA 2LXHC 1Z60A 1FBVA 2VJFB 3U5NA 4NN2A 2JMIA 4BHWA 3N9NA 5C11A 4P5OB 4CCGX 4YBSA 2LV9A 5G0FA 2KWNA 4W4UA 2MIQA 3GV4A 5B79A 5I3LA 5G05B 4QF2A 4F52B 5TABA 2LGLA 2KWOA 2LGVA 5LKXA 4PPEA 3L1ZB 2KGIA 2I50A 4V3LC 1WEQA 5B75A 2FUUA 5C13A 1IYMA 2UZGA 1WGMA 4MVTA 2VP7A 1LDKC 1VFYA 1E4UA 1G25A 3T7LA 1WEEA 2EGPA 2G45A 2YT5A 2M1RA 3GL6A 2ECTA 2ECIA 5JG6A 1WILA 3N9PA 2M3HA 2DX8A 5EYAF 2YHNA 5H9MA 1RMDA 5D1MB 3C5KA 4GNGA 3SOWA 3O33A 5LKZA 1U6GB 2VJFA 2VNFA 2C2LA 2MUMA 3L11A 1Z6UA 1CHCA 4LK9A 2YYRA 5H1UA 5B78A 2E6RA 4GB0A 2KYUA 2F42A 2KE1A 2CKLB 2KREA 2JMDA 5DKAA 1LDJB 3U5MA 4B7YC 5H1VA 2M85A 1JOCA 4YADA 2MA5A 3RTRB 5FERA 2QIZA 4LLBA 4C9ZA 2YUCA 4B86C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4U A;  3I2D A;  3ZPV E;  3HCS A;  4A4C A;  3DQV R;  3ZVY A;  4TKP B;  4IC3 A;  2LXP C;  5FEY A;  3M62 A;  2KR4 A;  3KV5 A;  4I7B A;  2ECJ A;  4AP4 A;  4YBM A;  2CT2 A;  2RSD A;  1WEW A;  1T1H A;  4IC2 A;  2H0D B;  2F6J A;  3ZNI A;  2LGG A;  5TDW A;  1WEU A;  3HTK C;  3O37 A;  2HDP A;  2YQM A;  4AYC B;  2LRI C;  3O70 A;  2L80 A;  3NG2 A;  2G43 A;  4XI1 A;  2L5U A;  2LGK A;  3N9O A;  3O34 A;  3U5P A;  2Y1N A;  3ZVZ B;  3LQJ A;  5KH3 A;  1VYX A;  2CKL A;  3KNV A;  5AIU A;  3O35 A;  3PUR A;  2ECW A;  5B77 A;  2KWJ A;  3DPL R;  2KWK A;  2M6M A;  2VPE A;  2K4D A;  2K17 A;  2XEU A;  4GND A;  1JM7 B;  4R2Y A;  2YQL A;  4AVX A;  3ASL A;  3IHP A;  2EOD A;  4FK5 A;  5LKT A;  1FP0 A;  4WZ3 B;  3ZPV 1;  4A0C D;  4ZUX U;  5B76 A;  3ZTG A;  2K16 A;  2BAY A;  4AUQ B;  3MHS A;  1WIM A;  4WZ2 A;  4V3K C;  1MM3 A;  2XB1 A;  3KQI A;  1Z2Q A;  4LKA A;  3SOX A;  5B8D A;  4QF3 A;  5TBN A;  1N87 A;  4MSX A;  4ZDT A;  4FIP A;  2CSZ A;  5J3X A;  1HYI A;  1K2F A;  4ZQL A;  4LAD B;  4YAX A;  2LQ6 A;  2LDR A;  1BOR A;  4S3O C;  2YW8 A;  1WEM A;  5AIT A;  4I7D A;  2MD7 B;  4YBT A;  4WZ0 A;  1DVP A;  2MNZ A;  1VD4 A;  2F6N A;  2AN6 A;  4O64 A;  4N3W A;  4YC9 A;  2JMJ A;  2KIZ A;  4WA6 A;  1HYJ A;  3HCU A;  3N9L A;  4UP5 A;  1WFK A;  2VJE B;  4N4F A;  3FL2 A;  2ECG A;  4CA1 A;  2K1J A;  2ZET C;  2MA6 A;  3LQH A;  2HYE D;  1WEP A;  5KH7 A;  4S3O B;  2FSA A;  4FO9 A;  2PUY A;  4PTB A;  1F62 A;  1MM2 A;  4L58 A;  3SHB A;  4I7C A;  2L75 A;  2ECN A;  5D1L B;  3EB6 A;  3EB5 A;  2G6Q A;  2NAA A;  5LKU A;  5TRB A;  5TDR A;  2VPD A;  2ECV A;  4X3G A;  2VPG A;  1WEO A;  2QIC A;  2KU3 A;  3HCT A;  2PNX A;  4FJC A;  4UP0 A;  2E6S A;  3LRQ A;  3O36 A;  2FUI A;  2YRE A;  1WES A;  5LCW B;  2MD8 C;  2L0B A;  4GNF A;  3O7A A;  1XWH A;  4Q6F A;  4UI9 B;  2IDA A;  3SOU A;  3KV6 A;  1X4I A;  2MT5 A;  3MHH A;  4R8P K;  2OXQ C;  3LQI A;  3N9M A;  2YU4 A;  3U5O A;  2YSM A;  3V43 A;  1WEV A;  3PUQ A;  2QJ0 A;  3ZYQ A;  2VJE A;  1WEN A;  2JRJ A;  3PHD A;  3RPG C;  2VPB A;  3M99 A;  2D8S A;  3VK6 A;  2H0D A;  2L43 A;  3T6R A;  1WE9 A;  2KGG A;  5H1T A;  3C6W A;  2RI7 A;  1X4J A;  3L1X A;  4AYC A;  4YAT A;  2LN0 A;  4A4B A;  3N9Q A;  5G04 B;  5DIN A;  3QZV A;  2KFT A;  2MNY A;  5D1K B;  2Y1M A;  1V87 A;  5KH9 A;  4R7E A;  5FB1 A;  1ZBD B;  2YUR A;  4A49 A;  2CSY A;  4LJN A;  2EA6 A;  2Y43 A;  3RPG B;  5FB0 A;  2C2V S;  2YSJ A;  4GNE A;  2YHO A;  1JM7 A;  3M63 A;  4BBQ A;  4L7X A;  4YAB A;  2LXH C;  1Z60 A;  1FBV A;  2VJF B;  3U5N A;  4NN2 A;  2JMI A;  4BHW A;  3N9N A;  5C11 A;  4P5O B;  4CCG X;  4YBS A;  2LV9 A;  5G0F A;  2KWN A;  4W4U A;  2MIQ A;  3GV4 A;  5B79 A;  5I3L A;  5G05 B;  4QF2 A;  4F52 B;  5TAB A;  2LGL A;  2KWO A;  2LGV A;  5LKX A;  4PPE A;  3L1Z B;  2KGI A;  2I50 A;  4V3L C;  1WEQ A;  5B75 A;  2FUU A;  5C13 A;  1IYM A;  2UZG A;  1WGM A;  4MVT A;  2VP7 A;  1LDK C;  1VFY A;  1E4U A;  1G25 A;  3T7L A;  1WEE A;  2EGP A;  2G45 A;  2YT5 A;  2M1R A;  3GL6 A;  2ECT A;  2ECI A;  5JG6 A;  1WIL A;  3N9P A;  2M3H A;  2DX8 A;  5EYA F;  2YHN A;  5H9M A;  1RMD A;  5D1M B;  3C5K A;  4GNG A;  3SOW A;  3O33 A;  5LKZ A;  1U6G B;  2VJF A;  2VNF A;  2C2L A;  2MUM A;  3L11 A;  1Z6U A;  1CHC A;  4LK9 A;  2YYR A;  5H1U A;  5B78 A;  2E6R A;  4GB0 A;  2KYU A;  2F42 A;  2KE1 A;  2CKL B;  2KRE A;  2JMD A;  5DKA A;  1LDJ B;  3U5M A;  4B7Y C;  5H1V A;  2M85 A;  1JOC A;  4YAD A;  2MA5 A;  3RTR B;  5FER A;  2QIZ A;  4LLB A;  4C9Z A;  2YUC A;  4B86 C; 
#chains in the Genus database with same CATH topology
 1X4U A;  3I2D A;  3ZPV E;  3HCS A;  4A4C A;  3DQV R;  3ZVY A;  4TKP B;  4IC3 A;  2LXP C;  5FEY A;  3M62 A;  2KR4 A;  3KV5 A;  4I7B A;  2ECJ A;  4AP4 A;  4YBM A;  2CT2 A;  2RSD A;  1WEW A;  1T1H A;  4IC2 A;  2H0D B;  2F6J A;  3ZNI A;  2LGG A;  5TDW A;  1WEU A;  3HTK C;  3O37 A;  2MKE A;  2KKY A;  2HDP A;  2YQM A;  4AYC B;  2LRI C;  3MDB C;  3O70 A;  2L80 A;  3NG2 A;  3Q1D A;  2G43 A;  4XI1 A;  2L5U A;  2LGK A;  3N9O A;  3O34 A;  1MBM A;  3U5P A;  2Y1N A;  3FAN A;  3ZVZ B;  1DCQ A;  3LQJ A;  5SVX A;  5KH3 A;  1VYX A;  2CKL A;  3KNV A;  5AIU A;  3O35 A;  3PUR A;  2ECW A;  5B77 A;  2D8U A;  2B0O E;  2KWJ A;  3DPL R;  2KWK A;  2M6M A;  2VPE A;  2K4D A;  4Z0R A;  2K17 A;  2XEU A;  4GND A;  1JM7 B;  4R2Y A;  2YQL A;  4AVX A;  3ASL A;  3IHP A;  2EOD A;  2DSM A;  2OWA A;  4FK5 A;  5LKT A;  1FP0 A;  4WZ3 B;  3ZPV 1;  4A0C D;  3LJU X;  4ZUX U;  5B76 A;  3ZTG A;  2K16 A;  4O62 A;  2BAY A;  4AUQ B;  3MHS A;  2KKX A;  1WIM A;  2FD4 A;  2XB1 A;  4V3K C;  1MM3 A;  4WZ2 A;  3KQI A;  1Z2Q A;  4LKA A;  3SOX A;  5B8D A;  2DJA A;  4QF3 A;  5TBN A;  1N87 A;  4MSX A;  4ZDT A;  4FIP A;  2CSZ A;  5J3X A;  3T9K A;  1K2F A;  1HYI A;  4ZQL A;  4LAD B;  2CON A;  4YAX A;  2LQ6 A;  2LDR A;  1BOR A;  4S3O C;  2YW8 A;  1WEM A;  5AIT A;  4I7D A;  2P57 A;  2MD7 B;  4YBT A;  4WZ0 A;  1DVP A;  2MNZ A;  5SVI B;  1VD4 A;  2F6N A;  2AN6 A;  4O64 A;  4N3W A;  2IQJ A;  4YC9 A;  3FM8 C;  3KDE C;  2JMJ A;  2KIZ A;  4WA6 A;  1HYJ A;  3HCU A;  3N9L A;  4UP5 A;  1WFK A;  2VJE B;  4N4F A;  4Z0O A;  3FL2 A;  4F1P A;  2ECG A;  4CA1 A;  2K1J A;  2ZET C;  2MA6 A;  3LQH A;  2HYE D;  1WEP A;  5KH7 A;  4S3O B;  2FSA A;  4FO9 A;  2PUY A;  4PTB A;  1F62 A;  1MM2 A;  4L58 A;  3SHB A;  4I7C A;  2L75 A;  2ECN A;  5D1L B;  3EB6 A;  3EB5 A;  2G6Q A;  2NAA A;  5SVY A;  5LKU A;  5TRB A;  5TDR A;  2VPD A;  2ECV A;  2JM3 A;  4X3G A;  2VPG A;  1WEO A;  2QIC A;  2KU3 A;  3HCT A;  2PNX A;  4FJC A;  4UP0 A;  2XOC A;  2E6S A;  3LRQ A;  3O36 A;  2FUI A;  2YRE A;  1WES A;  5LCW B;  2MD8 C;  2L0B A;  2CSV A;  4GNF A;  3O7A A;  1XWH A;  4Q6F A;  4UI9 B;  5SVI A;  2IDA A;  3SOU A;  3KV6 A;  1X4I A;  2MT5 A;  3MHH A;  4R8P K;  2OXQ C;  3LQI A;  3N9M A;  2YU4 A;  3U5O A;  2YSM A;  3V43 A;  2LAU A;  1WEV A;  3PUQ A;  2QJ0 A;  3JUE A;  3PLW A;  2JUN A;  3ZYQ A;  2VJE A;  1WEN A;  2FFW A;  2EGM A;  2JRJ A;  3PHD A;  3RPG C;  2VPB A;  3M99 A;  2D8S A;  3VK6 A;  2H0D A;  2L43 A;  3T6R A;  1WE9 A;  2KGG A;  5H1T A;  3C6W A;  2RI7 A;  1X4J A;  3L1X A;  4AYC A;  4YAT A;  2LN0 A;  3LVR E;  4A4B A;  3N9Q A;  5G04 B;  5DIN A;  3QZV A;  2KFT A;  2MNY A;  5D1K B;  2Y1M A;  1V87 A;  5KH9 A;  4R7E A;  5FB1 A;  1ZBD B;  3FJU B;  2YUR A;  4A49 A;  2CSY A;  4LJN A;  2EA6 A;  2Y43 A;  3RPG B;  5FB0 A;  2XOZ A;  2C2V S;  3DWD A;  2YSJ A;  4GNE A;  2YHO A;  1JM7 A;  3M63 A;  4BBQ A;  4L7X A;  4YAB A;  2LXH C;  1Z60 A;  1FBV A;  2VJF B;  3U5N A;  2EXU A;  4NN2 A;  2JMI A;  4BHW A;  3N9N A;  5C11 A;  4P5O B;  3FEH A;  4CCG X;  4YBS A;  2LV9 A;  5G0F A;  2CRR A;  2KWN A;  3O47 A;  4W4U A;  2MIQ A;  3GV4 A;  3M7K A;  5B79 A;  5I3L A;  5G05 B;  4QF2 A;  4F52 B;  5TAB A;  2LGL A;  2KWO A;  4OGC A;  2LGV A;  5LKX A;  4PPE A;  3FAO A;  3L1Z B;  2KGI A;  2I50 A;  4V3L C;  1WEQ A;  5B75 A;  2FUU A;  5C13 A;  1IYM A;  2UZG A;  1WGM A;  3SUB A;  4MVT A;  3DDT A;  3LVQ E;  2VP7 A;  1LDK C;  1VFY A;  1E4U A;  1G25 A;  3T7L A;  2E61 A;  1WEE A;  2EGP A;  2G45 A;  2YT5 A;  4QQ4 A;  2M1R A;  3GL6 A;  2ECT A;  2ECI A;  5JG6 A;  1WIL A;  3N9P A;  2M3H A;  2DX8 A;  5EYA F;  2L7P A;  2XOY A;  2YHN A;  5H9M A;  1RMD A;  3C5K A;  4GNG A;  5D1M B;  3SOW A;  3O33 A;  5LKZ A;  1U6G B;  2VJF A;  2VNF A;  3H7H A;  2CRW A;  2C2L A;  2MUM A;  3L11 A;  1Z6U A;  1CHC A;  4OGE A;  4LK9 A;  2YYR A;  5H1U A;  5B78 A;  2E6R A;  2XP0 A;  2YVR A;  4GB0 A;  2KYU A;  2F42 A;  2KE1 A;  2CKL B;  3LDY A;  5K3Q A;  2KRE A;  4H9D A;  2JMD A;  5DKA A;  2M13 A;  1LDJ B;  3E2D A;  3U5M A;  4B7Y C;  5H1V A;  2M85 A;  1JOC A;  4YAD A;  2MA5 A;  3RTR B;  5FER A;  2QIZ A;  2RR4 A;  4LLB A;  4C9Z A;  2YUC A;  4B86 C; 
#chains in the Genus database with same CATH homology
 1X4U A;  3I2D A;  3ZPV E;  3HCS A;  4A4C A;  3DQV R;  3ZVY A;  4TKP B;  4IC3 A;  2LXP C;  5FEY A;  3M62 A;  2KR4 A;  3KV5 A;  4I7B A;  2ECJ A;  4AP4 A;  4YBM A;  2CT2 A;  2RSD A;  1WEW A;  1T1H A;  4IC2 A;  2H0D B;  2F6J A;  3ZNI A;  2LGG A;  5TDW A;  1WEU A;  3HTK C;  3O37 A;  2HDP A;  2YQM A;  4AYC B;  2LRI C;  3O70 A;  2L80 A;  3NG2 A;  2G43 A;  4XI1 A;  2L5U A;  2LGK A;  3N9O A;  3O34 A;  3U5P A;  2Y1N A;  3ZVZ B;  3LQJ A;  5KH3 A;  1VYX A;  2CKL A;  3KNV A;  5AIU A;  3O35 A;  3PUR A;  2ECW A;  5B77 A;  2KWJ A;  3DPL R;  2KWK A;  2M6M A;  2VPE A;  2K4D A;  2K17 A;  2XEU A;  4GND A;  1JM7 B;  4R2Y A;  2YQL A;  4AVX A;  3ASL A;  3IHP A;  2EOD A;  4FK5 A;  5LKT A;  1FP0 A;  4WZ3 B;  3ZPV 1;  4A0C D;  4ZUX U;  5B76 A;  3ZTG A;  2K16 A;  2BAY A;  4AUQ B;  3MHS A;  1WIM A;  4WZ2 A;  4V3K C;  1MM3 A;  2XB1 A;  3KQI A;  1Z2Q A;  4LKA A;  3SOX A;  5B8D A;  4QF3 A;  5TBN A;  1N87 A;  4MSX A;  4ZDT A;  4FIP A;  2CSZ A;  5J3X A;  1HYI A;  1K2F A;  4ZQL A;  4LAD B;  4YAX A;  2LQ6 A;  2LDR A;  1BOR A;  4S3O C;  2YW8 A;  1WEM A;  5AIT A;  4I7D A;  2MD7 B;  4YBT A;  4WZ0 A;  1DVP A;  2MNZ A;  1VD4 A;  2F6N A;  2AN6 A;  4O64 A;  4N3W A;  4YC9 A;  2JMJ A;  2KIZ A;  4WA6 A;  1HYJ A;  3HCU A;  3N9L A;  4UP5 A;  1WFK A;  2VJE B;  4N4F A;  3FL2 A;  2ECG A;  4CA1 A;  2K1J A;  2ZET C;  2MA6 A;  3LQH A;  2HYE D;  1WEP A;  5KH7 A;  4S3O B;  2FSA A;  4FO9 A;  2PUY A;  4PTB A;  1F62 A;  1MM2 A;  4L58 A;  3SHB A;  4I7C A;  2L75 A;  2ECN A;  5D1L B;  3EB6 A;  3EB5 A;  2G6Q A;  2NAA A;  5LKU A;  5TRB A;  5TDR A;  2VPD A;  2ECV A;  4X3G A;  2VPG A;  1WEO A;  2QIC A;  2KU3 A;  3HCT A;  2PNX A;  4FJC A;  4UP0 A;  2E6S A;  3LRQ A;  3O36 A;  2FUI A;  2YRE A;  1WES A;  5LCW B;  2MD8 C;  2L0B A;  4GNF A;  3O7A A;  1XWH A;  4Q6F A;  4UI9 B;  2IDA A;  3SOU A;  3KV6 A;  1X4I A;  2MT5 A;  3MHH A;  4R8P K;  2OXQ C;  3LQI A;  3N9M A;  2YU4 A;  3U5O A;  2YSM A;  3V43 A;  1WEV A;  3PUQ A;  2QJ0 A;  3ZYQ A;  2VJE A;  1WEN A;  2JRJ A;  3PHD A;  3RPG C;  2VPB A;  3M99 A;  2D8S A;  3VK6 A;  2H0D A;  2L43 A;  3T6R A;  1WE9 A;  2KGG A;  5H1T A;  3C6W A;  2RI7 A;  1X4J A;  3L1X A;  4AYC A;  4YAT A;  2LN0 A;  4A4B A;  3N9Q A;  5G04 B;  5DIN A;  3QZV A;  2KFT A;  2MNY A;  5D1K B;  2Y1M A;  1V87 A;  5KH9 A;  4R7E A;  5FB1 A;  1ZBD B;  2YUR A;  4A49 A;  2CSY A;  4LJN A;  2EA6 A;  2Y43 A;  3RPG B;  5FB0 A;  2C2V S;  2YSJ A;  4GNE A;  2YHO A;  1JM7 A;  3M63 A;  4BBQ A;  4L7X A;  4YAB A;  2LXH C;  1Z60 A;  1FBV A;  2VJF B;  3U5N A;  4NN2 A;  2JMI A;  4BHW A;  3N9N A;  5C11 A;  4P5O B;  4CCG X;  4YBS A;  2LV9 A;  5G0F A;  2KWN A;  4W4U A;  2MIQ A;  3GV4 A;  5B79 A;  5I3L A;  5G05 B;  4QF2 A;  4F52 B;  5TAB A;  2LGL A;  2KWO A;  2LGV A;  5LKX A;  4PPE A;  3L1Z B;  2KGI A;  2I50 A;  4V3L C;  1WEQ A;  5B75 A;  2FUU A;  5C13 A;  1IYM A;  2UZG A;  1WGM A;  4MVT A;  2VP7 A;  1LDK C;  1VFY A;  1E4U A;  1G25 A;  3T7L A;  1WEE A;  2EGP A;  2G45 A;  2YT5 A;  2M1R A;  3GL6 A;  2ECT A;  2ECI A;  5JG6 A;  1WIL A;  3N9P A;  2M3H A;  2DX8 A;  5EYA F;  2YHN A;  5H9M A;  1RMD A;  5D1M B;  3C5K A;  4GNG A;  3SOW A;  3O33 A;  5LKZ A;  1U6G B;  2VJF A;  2VNF A;  2C2L A;  2MUM A;  3L11 A;  1Z6U A;  1CHC A;  4LK9 A;  2YYR A;  5H1U A;  5B78 A;  2E6R A;  4GB0 A;  2KYU A;  2F42 A;  2KE1 A;  2CKL B;  2KRE A;  2JMD A;  5DKA A;  1LDJ B;  3U5M A;  4B7Y C;  5H1V A;  2M85 A;  1JOC A;  4YAD A;  2MA5 A;  3RTR B;  5FER A;  2QIZ A;  4LLB A;  4C9Z A;  2YUC A;  4B86 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...