2YQLA

Solution structure of the phd domain in phd finger protein 21a
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
56
structure length
56
Chain Sequence
GSSGSSGHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 21A
publication title Solution structure of the PHD domain in PHD finger protein 21A
rcsb
source organism Homo sapiens
molecule tags Transcription
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yqlA00
4W4UA 2KE1A 2ECVA 2HDPA 5C13A 3PUQA 2VPGA 1V87A 4BBQA 2MA5A 3ZPVE 3ZVYA 3O34A 4PTBA 3ZPV1 4YATA 4C9ZA 2YQLA 2M6MA 2KREA 2L75A 5LCWB 3PURA 2ECJA 1X4JA 1WEOA 5D1LB 5LKXA 3LQJA 3N9PA 2JMIA 2BAYA 2VJEB 2Y43A 1WESA 1MM3A 4P5OB 4F52B 4WA6A 2LDRA 4I7CA 5D1KB 4AYCA 2LXPC 4LLBA 3V43A 2RSDA 2H0DB 1G25A 3GL6A 3EB5A 1X4IA 5B79A 2YU4A 3VK6A 2Y1MA 2FUIA 5DKAA 4R2YA 3ZVZB 2YURA 3MHHA 2PUYA 1WGMA 2EA6A 4R8PK 5AITA 3KV5A 2EODA 2MD8C 4L7XA 4A49A 5G04B 2M3HA 3N9LA 4YBMA 2MIQA 1BORA 2MUMA 2VPEA 1WEEA 2ECWA 4ZQLA 1WE9A 2JRJA 5B8DA 1LDKC 5LKUA 5EYAF 3LQHA 2LV9A 4AVXA 5JG6A 5FB1A 3C6WA 3ZTGA 2MA6A 5G05B 2Y1NA 3O36A 2MNZA 2UZGA 1WIMA 2K17A 3HCUA 5TBNA 1RMDA 5H9MA 2CSYA 2M85A 4YABA 3DQVR 2YW8A 5FERA 2LXHC 2YQMA 1WILA 2QICA 2JMJA 3N9NA 2KIZA 3QZVA 5KH9A 2VPBA 1Z6UA 1Z2QA 4A4BA 2YT5A 3HCTA 4QF3A 2KYUA 2PNXA 2VJFB 3KQIA 2CSZA 2LGLA 4LADB 2KWNA 5KH7A 4GNEA 3KV6A 2YREA 1VFYA 2MT5A 4Q6FA 4R7EA 2G6QA 1WFKA 2KWOA 2L0BA 1T1HA 4X3GA 5B76A 1WEUA 5KH3A 4I7DA 2K1JA 3RTRB 5H1TA 2OXQC 2C2LA 1WEVA 2IDAA 2CKLB 4A0CD 3SOWA 3FL2A 2KR4A 5G0FA 2QIZA 2VNFA 2AN6A 4GB0A 4N3WA 5FB0A 1E4UA 3M62A 4B86C 3M99A 4BHWA 3LRQA 1JOCA 2RI7A 2KU3A 2M1RA 3U5MA 2G45A 4GNDA 1N87A 1WEMA 2VJFA 4WZ0A 3ZYQA 4AUQB 4I7BA 4QF2A 2F42A 4YAXA 3DPLR 5B77A 4MVTA 3O7AA 1F62A 4N4FA 4NN2A 5J3XA 4LKAA 2KWKA 2XEUA 3PHDA 2K4DA 2F6NA 2VJEA 5LKTA 2HYED 3SOXA 2F6JA 5D1MB 3M63A 3C5KA 2YSJA 3O37A 2YSMA 1WEQA 2YHNA 4GNFA 2H0DA 2LN0A 3HTKC 2LQ6A 4FJCA 4LJNA 2YYRA 2QJ0A 3T6RA 2I50A 3SOUA 4ZUXU 1FBVA 4MSXA 3SHBA 2C2VS 2KWJA 4WZ3B 4YBSA 4FO9A 2KGGA 3MHSA 2E6RA 5FEYA 3GV4A 1VYXA 1HYJA 4AYCB 4A4CA 4UP0A 2L5UA 3HCSA 1DVPA 2VPDA 5H1UA 2KFTA 2K16A 2ECNA 3N9QA 5C11A 1K2FA 4LK9A 5DINA 1IYMA 4PPEA 4ZDTA 4CCGX 5H1VA 5TRBA 1ZBDB 2L80A 2LGKA 4V3KC 2XB1A 3RPGB 2G43A 4WZ2A 2LGGA 3LQIA 2L43A 2LRIC 3N9OA 5I3LA 4CA1A 4FIPA 3L1ZB 3ASLA 2FSAA 1FP0A 3KNVA 1WEPA 5B78A 4FK5A 4B7YC 3ZNIA 1HYIA 4O64A 1WENA 1JM7B 2DX8A 4UP5A 2LGVA 4IC3A 4S3OB 2KGIA 3NG2A 2CT2A 3IHPA 2YUCA 2MNYA 2D8SA 2ZETC 2ECGA 3RPGC 2ECIA 1LDJB 3O35A 4V3LC 2MD7B 1X4UA 1U6GB 2JMDA 1WEWA 5AIUA 4TKPB 3U5NA 4GNGA 2CKLA 2VP7A 1MM2A 5TABA 3U5PA 2FUUA 5LKZA 5B75A 1JM7A 3O33A 5TDRA 4YBTA 2YHOA 4UI9B 4S3OC 4AP4A 2ECTA 4IC2A 5TDWA 4YADA 2EGPA 3L1XA 3U5OA 3T7LA 1XWHA 3EB6A 1Z60A 4XI1A 1CHCA 2NAAA 4YC9A 3N9MA 3O70A 1VD4A 3L11A 2E6SA 4L58A 3I2DA
chains in the Genus database with same CATH superfamily
4W4UA 2KE1A 2ECVA 2HDPA 5C13A 3PUQA 3DWDA 4Z0RA 2VPGA 1V87A 3LVRE 4BBQA 2MA5A 3ZPVE 3ZVYA 3O34A 4PTBA 3ZPV1 4YATA 4C9ZA 2YQLA 2M6MA 3FAOA 2KREA 2L75A 5K3QA 5LCWB 3PURA 2ECJA 1X4JA 1WEOA 5D1LB 5LKXA 3LQJA 3N9PA 2JMIA 3E2DA 2BAYA 2VJEB 2Y43A 1WESA 3LVQE 1MM3A 4P5OB 4F52B 4WA6A 2LDRA 4I7CA 5D1KB 4AYCA 2LXPC 4LLBA 3V43A 2RSDA 2JM3A 2H0DB 1G25A 3GL6A 3EB5A 1X4IA 4F1PA 3JUEA 5B79A 2YU4A 3VK6A 1MBMA 2Y1MA 2FUIA 5DKAA 4R2YA 2B0OE 3ZVZB 2YURA 3MHHA 2PUYA 1WGMA 2EA6A 4R8PK 5AITA 3KV5A 2EODA 2MD8C 4L7XA 4A49A 5G04B 2M3HA 3N9LA 4YBMA 2MIQA 2EGMA 1BORA 2MUMA 2DSMA 2VPEA 1WEEA 2ECWA 4ZQLA 1WE9A 2JRJA 5B8DA 1LDKC 5LKUA 5EYAF 3LQHA 2LV9A 4AVXA 3T9KA 5JG6A 2CRWA 5FB1A 3C6WA 3SUBA 3ZTGA 2MA6A 5G05B 3Q1DA 3M7KA 2Y1NA 3O36A 2MNZA 2UZGA 1WIMA 2K17A 3HCUA 2CSVA 5TBNA 3KDEC 1RMDA 5H9MA 2RR4A 2CSYA 2M85A 2MKEA 4YABA 3FM8C 3DQVR 4OGCA 2YW8A 5FERA 2E61A 2LXHC 2YQMA 1WILA 2QICA 2JMJA 3N9NA 1DCQA 2KIZA 3QZVA 5KH9A 2VPBA 4Z0OA 1Z6UA 1Z2QA 2L7PA 4A4BA 2YT5A 3HCTA 4QF3A 2KYUA 2PNXA 2VJFB 3KQIA 2JUNA 2CSZA 2LGLA 4LADB 2KWNA 5KH7A 4GNEA 2M13A 3KV6A 2YREA 1VFYA 2MT5A 4Q6FA 4R7EA 2G6QA 3FEHA 1WFKA 2KWOA 2L0BA 1T1HA 4X3GA 5B76A 1WEUA 5KH3A 4I7DA 2K1JA 3RTRB 5H1TA 2OXQC 2C2LA 1WEVA 2IDAA 2CKLB 4A0CD 3SOWA 2D8UA 3FL2A 2KR4A 2XOZA 5G0FA 2QIZA 2VNFA 2AN6A 4GB0A 4N3WA 4OGEA 5FB0A 1E4UA 3M62A 4B86C 3M99A 4BHWA 3LRQA 1JOCA 2RI7A 2KU3A 2M1RA 3U5MA 2G45A 4GNDA 1N87A 1WEMA 2VJFA 4WZ0A 3ZYQA 4AUQB 4I7BA 4QF2A 2F42A 5SVIB 3FJUB 4YAXA 3DPLR 5B77A 4MVTA 3O7AA 3H7HA 1F62A 4N4FA 4NN2A 5J3XA 4LKAA 2KWKA 2CONA 2XEUA 3PHDA 2K4DA 2F6NA 2VJEA 3PLWA 3DDTA 5LKTA 2HYED 3SOXA 2F6JA 2XOYA 2OWAA 5D1MB 3O47A 3M63A 2KKYA 3C5KA 3FANA 2YSJA 3O37A 2YSMA 1WEQA 2YHNA 4GNFA 2H0DA 2LN0A 3HTKC 2LQ6A 4FJCA 4LJNA 2YYRA 2QJ0A 2CRRA 3T6RA 2I50A 3SOUA 4ZUXU 1FBVA 4MSXA 3SHBA 2C2VS 2KWJA 4WZ3B 4YBSA 4FO9A 2KGGA 3MHSA 2E6RA 5FEYA 3GV4A 2LAUA 1VYXA 1HYJA 4AYCB 4A4CA 4UP0A 2L5UA 3HCSA 1DVPA 2VPDA 2IQJA 5H1UA 4H9DA 2KFTA 2K16A 2ECNA 3N9QA 5C11A 1K2FA 5SVYA 4LK9A 5DINA 1IYMA 4PPEA 4ZDTA 4CCGX 5H1VA 5TRBA 1ZBDB 2L80A 2LGKA 4V3KC 2XB1A 3RPGB 2G43A 4WZ2A 2LGGA 3LDYA 3LQIA 2L43A 2LRIC 3N9OA 5I3LA 4CA1A 4FIPA 3L1ZB 2EXUA 3ASLA 2FSAA 2DJAA 4O62A 1FP0A 2YVRA 3MDBC 3KNVA 1WEPA 2P57A 4FK5A 4B7YC 5B78A 3ZNIA 1HYIA 4O64A 1WENA 1JM7B 2DX8A 2KKXA 4UP5A 2LGVA 4IC3A 4S3OB 2KGIA 3NG2A 2CT2A 3IHPA 2YUCA 2MNYA 2D8SA 2XP0A 2ZETC 2ECGA 3RPGC 2ECIA 1LDJB 3O35A 4V3LC 2FFWA 2MD7B 1X4UA 1U6GB 2JMDA 1WEWA 5AIUA 4TKPB 3U5NA 4GNGA 2CKLA 2VP7A 1MM2A 5TABA 3U5PA 2FUUA 3LJUX 5LKZA 5B75A 1JM7A 3O33A 5TDRA 4YBTA 2YHOA 4UI9B 4S3OC 4AP4A 4QQ4A 2ECTA 4IC2A 5TDWA 4YADA 2EGPA 3L1XA 2FD4A 5SVXA 3U5OA 3T7LA 1XWHA 3EB6A 1Z60A 4XI1A 1CHCA 2NAAA 5SVIA 4YC9A 3N9MA 3O70A 1VD4A 2XOCA 3L11A 2E6SA 4L58A 3I2DA
chains in the Genus database with same CATH topology
4W4UA 2KE1A 2ECVA 2HDPA 5C13A 3PUQA 2VPGA 1V87A 4BBQA 2MA5A 3ZPVE 3ZVYA 3O34A 4PTBA 3ZPV1 4YATA 4C9ZA 2YQLA 2M6MA 2KREA 2L75A 5LCWB 3PURA 2ECJA 1X4JA 1WEOA 5D1LB 5LKXA 3LQJA 3N9PA 2JMIA 2BAYA 2VJEB 2Y43A 1WESA 1MM3A 4P5OB 4F52B 4WA6A 2LDRA 4I7CA 5D1KB 4AYCA 2LXPC 4LLBA 3V43A 2RSDA 2H0DB 1G25A 3GL6A 3EB5A 1X4IA 5B79A 2YU4A 3VK6A 2Y1MA 2FUIA 5DKAA 4R2YA 3ZVZB 2YURA 3MHHA 2PUYA 1WGMA 2EA6A 4R8PK 5AITA 3KV5A 2EODA 2MD8C 4L7XA 4A49A 5G04B 2M3HA 3N9LA 4YBMA 2MIQA 1BORA 2MUMA 2VPEA 1WEEA 2ECWA 4ZQLA 1WE9A 2JRJA 5B8DA 1LDKC 5LKUA 5EYAF 3LQHA 2LV9A 4AVXA 5JG6A 5FB1A 3C6WA 3ZTGA 2MA6A 5G05B 2Y1NA 3O36A 2MNZA 2UZGA 1WIMA 2K17A 3HCUA 5TBNA 1RMDA 5H9MA 2CSYA 2M85A 4YABA 3DQVR 2YW8A 5FERA 2LXHC 2YQMA 1WILA 2QICA 2JMJA 3N9NA 2KIZA 3QZVA 5KH9A 2VPBA 1Z6UA 1Z2QA 4A4BA 2YT5A 3HCTA 4QF3A 2KYUA 2PNXA 2VJFB 3KQIA 2CSZA 2LGLA 4LADB 2KWNA 5KH7A 4GNEA 3KV6A 2YREA 1VFYA 2MT5A 4Q6FA 4R7EA 2G6QA 1WFKA 2KWOA 2L0BA 1T1HA 4X3GA 5B76A 1WEUA 5KH3A 4I7DA 2K1JA 3RTRB 5H1TA 2OXQC 2C2LA 1WEVA 2IDAA 2CKLB 4A0CD 3SOWA 3FL2A 2KR4A 5G0FA 2QIZA 2VNFA 2AN6A 4GB0A 4N3WA 5FB0A 1E4UA 3M62A 4B86C 3M99A 4BHWA 3LRQA 1JOCA 2RI7A 2KU3A 2M1RA 3U5MA 2G45A 4GNDA 1N87A 1WEMA 2VJFA 4WZ0A 3ZYQA 4AUQB 4I7BA 4QF2A 2F42A 4YAXA 3DPLR 5B77A 4MVTA 3O7AA 1F62A 4N4FA 4NN2A 5J3XA 4LKAA 2KWKA 2XEUA 3PHDA 2K4DA 2F6NA 2VJEA 5LKTA 2HYED 3SOXA 2F6JA 5D1MB 3M63A 3C5KA 2YSJA 3O37A 2YSMA 1WEQA 2YHNA 4GNFA 2H0DA 2LN0A 3HTKC 2LQ6A 4FJCA 4LJNA 2YYRA 2QJ0A 3T6RA 2I50A 3SOUA 4ZUXU 1FBVA 4MSXA 3SHBA 2C2VS 2KWJA 4WZ3B 4YBSA 4FO9A 2KGGA 3MHSA 2E6RA 5FEYA 3GV4A 1VYXA 1HYJA 4AYCB 4A4CA 4UP0A 2L5UA 3HCSA 1DVPA 2VPDA 5H1UA 2KFTA 2K16A 2ECNA 3N9QA 5C11A 1K2FA 4LK9A 5DINA 1IYMA 4PPEA 4ZDTA 4CCGX 5H1VA 5TRBA 1ZBDB 2L80A 2LGKA 4V3KC 2XB1A 3RPGB 2G43A 4WZ2A 2LGGA 3LQIA 2L43A 2LRIC 3N9OA 5I3LA 4CA1A 4FIPA 3L1ZB 3ASLA 2FSAA 1FP0A 3KNVA 1WEPA 5B78A 4FK5A 4B7YC 3ZNIA 1HYIA 4O64A 1WENA 1JM7B 2DX8A 4UP5A 2LGVA 4IC3A 4S3OB 2KGIA 3NG2A 2CT2A 3IHPA 2YUCA 2MNYA 2D8SA 2ZETC 2ECGA 3RPGC 2ECIA 1LDJB 3O35A 4V3LC 2MD7B 1X4UA 1U6GB 2JMDA 1WEWA 5AIUA 4TKPB 3U5NA 4GNGA 2CKLA 2VP7A 1MM2A 5TABA 3U5PA 2FUUA 5LKZA 5B75A 1JM7A 3O33A 5TDRA 4YBTA 2YHOA 4UI9B 4S3OC 4AP4A 2ECTA 4IC2A 5TDWA 4YADA 2EGPA 3L1XA 3U5OA 3T7LA 1XWHA 3EB6A 1Z60A 4XI1A 1CHCA 2NAAA 4YC9A 3N9MA 3O70A 1VD4A 3L11A 2E6SA 4L58A 3I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  2KE1 A;  2ECV A;  2HDP A;  5C13 A;  3PUQ A;  2VPG A;  1V87 A;  4BBQ A;  2MA5 A;  3ZPV E;  3ZVY A;  3O34 A;  4PTB A;  3ZPV 1;  4YAT A;  4C9Z A;  2YQL A;  2M6M A;  2KRE A;  2L75 A;  5LCW B;  3PUR A;  2ECJ A;  1X4J A;  1WEO A;  5D1L B;  5LKX A;  3LQJ A;  3N9P A;  2JMI A;  2BAY A;  2VJE B;  2Y43 A;  1WES A;  1MM3 A;  4P5O B;  4F52 B;  4WA6 A;  2LDR A;  4I7C A;  5D1K B;  4AYC A;  2LXP C;  4LLB A;  3V43 A;  2RSD A;  2H0D B;  1G25 A;  3GL6 A;  3EB5 A;  1X4I A;  5B79 A;  2YU4 A;  3VK6 A;  2Y1M A;  2FUI A;  5DKA A;  4R2Y A;  3ZVZ B;  2YUR A;  3MHH A;  2PUY A;  1WGM A;  2EA6 A;  4R8P K;  5AIT A;  3KV5 A;  2EOD A;  2MD8 C;  4L7X A;  4A49 A;  5G04 B;  2M3H A;  3N9L A;  4YBM A;  2MIQ A;  1BOR A;  2MUM A;  2VPE A;  1WEE A;  2ECW A;  4ZQL A;  1WE9 A;  2JRJ A;  5B8D A;  1LDK C;  5LKU A;  5EYA F;  3LQH A;  2LV9 A;  4AVX A;  5JG6 A;  5FB1 A;  3C6W A;  3ZTG A;  2MA6 A;  5G05 B;  2Y1N A;  3O36 A;  2MNZ A;  2UZG A;  1WIM A;  2K17 A;  3HCU A;  5TBN A;  1RMD A;  5H9M A;  2CSY A;  2M85 A;  4YAB A;  3DQV R;  2YW8 A;  5FER A;  2LXH C;  2YQM A;  1WIL A;  2QIC A;  2JMJ A;  3N9N A;  2KIZ A;  3QZV A;  5KH9 A;  2VPB A;  1Z6U A;  1Z2Q A;  4A4B A;  2YT5 A;  3HCT A;  4QF3 A;  2KYU A;  2PNX A;  2VJF B;  3KQI A;  2CSZ A;  2LGL A;  4LAD B;  2KWN A;  5KH7 A;  4GNE A;  3KV6 A;  2YRE A;  1VFY A;  2MT5 A;  4Q6F A;  4R7E A;  2G6Q A;  1WFK A;  2KWO A;  2L0B A;  1T1H A;  4X3G A;  5B76 A;  1WEU A;  5KH3 A;  4I7D A;  2K1J A;  3RTR B;  5H1T A;  2OXQ C;  2C2L A;  1WEV A;  2IDA A;  2CKL B;  4A0C D;  3SOW A;  3FL2 A;  2KR4 A;  5G0F A;  2QIZ A;  2VNF A;  2AN6 A;  4GB0 A;  4N3W A;  5FB0 A;  1E4U A;  3M62 A;  4B86 C;  3M99 A;  4BHW A;  3LRQ A;  1JOC A;  2RI7 A;  2KU3 A;  2M1R A;  3U5M A;  2G45 A;  4GND A;  1N87 A;  1WEM A;  2VJF A;  4WZ0 A;  3ZYQ A;  4AUQ B;  4I7B A;  4QF2 A;  2F42 A;  4YAX A;  3DPL R;  5B77 A;  4MVT A;  3O7A A;  1F62 A;  4N4F A;  4NN2 A;  5J3X A;  4LKA A;  2KWK A;  2XEU A;  3PHD A;  2K4D A;  2F6N A;  2VJE A;  5LKT A;  2HYE D;  3SOX A;  2F6J A;  5D1M B;  3M63 A;  3C5K A;  2YSJ A;  3O37 A;  2YSM A;  1WEQ A;  2YHN A;  4GNF A;  2H0D A;  2LN0 A;  3HTK C;  2LQ6 A;  4FJC A;  4LJN A;  2YYR A;  2QJ0 A;  3T6R A;  2I50 A;  3SOU A;  4ZUX U;  1FBV A;  4MSX A;  3SHB A;  2C2V S;  2KWJ A;  4WZ3 B;  4YBS A;  4FO9 A;  2KGG A;  3MHS A;  2E6R A;  5FEY A;  3GV4 A;  1VYX A;  1HYJ A;  4AYC B;  4A4C A;  4UP0 A;  2L5U A;  3HCS A;  1DVP A;  2VPD A;  5H1U A;  2KFT A;  2K16 A;  2ECN A;  3N9Q A;  5C11 A;  1K2F A;  4LK9 A;  5DIN A;  1IYM A;  4PPE A;  4ZDT A;  4CCG X;  5H1V A;  5TRB A;  1ZBD B;  2L80 A;  2LGK A;  4V3K C;  2XB1 A;  3RPG B;  2G43 A;  4WZ2 A;  2LGG A;  3LQI A;  2L43 A;  2LRI C;  3N9O A;  5I3L A;  4CA1 A;  4FIP A;  3L1Z B;  3ASL A;  2FSA A;  1FP0 A;  3KNV A;  1WEP A;  5B78 A;  4FK5 A;  4B7Y C;  3ZNI A;  1HYI A;  4O64 A;  1WEN A;  1JM7 B;  2DX8 A;  4UP5 A;  2LGV A;  4IC3 A;  4S3O B;  2KGI A;  3NG2 A;  2CT2 A;  3IHP A;  2YUC A;  2MNY A;  2D8S A;  2ZET C;  2ECG A;  3RPG C;  2ECI A;  1LDJ B;  3O35 A;  4V3L C;  2MD7 B;  1X4U A;  1U6G B;  2JMD A;  1WEW A;  5AIU A;  4TKP B;  3U5N A;  4GNG A;  2CKL A;  2VP7 A;  1MM2 A;  5TAB A;  3U5P A;  2FUU A;  5LKZ A;  5B75 A;  1JM7 A;  3O33 A;  5TDR A;  4YBT A;  2YHO A;  4UI9 B;  4S3O C;  4AP4 A;  2ECT A;  4IC2 A;  5TDW A;  4YAD A;  2EGP A;  3L1X A;  3U5O A;  3T7L A;  1XWH A;  3EB6 A;  1Z60 A;  4XI1 A;  1CHC A;  2NAA A;  4YC9 A;  3N9M A;  3O70 A;  1VD4 A;  3L11 A;  2E6S A;  4L58 A;  3I2D A; 
#chains in the Genus database with same CATH topology
 4W4U A;  2KE1 A;  2ECV A;  2HDP A;  5C13 A;  3PUQ A;  3DWD A;  4Z0R A;  2VPG A;  1V87 A;  3LVR E;  4BBQ A;  2MA5 A;  3ZPV E;  3ZVY A;  3O34 A;  4PTB A;  3ZPV 1;  4YAT A;  4C9Z A;  2YQL A;  2M6M A;  3FAO A;  2KRE A;  2L75 A;  5K3Q A;  5LCW B;  3PUR A;  2ECJ A;  1X4J A;  1WEO A;  5D1L B;  5LKX A;  3LQJ A;  3N9P A;  2JMI A;  3E2D A;  2BAY A;  2VJE B;  2Y43 A;  1WES A;  3LVQ E;  1MM3 A;  4P5O B;  4F52 B;  4WA6 A;  2LDR A;  4I7C A;  5D1K B;  4AYC A;  2LXP C;  4LLB A;  3V43 A;  2RSD A;  2JM3 A;  2H0D B;  1G25 A;  3GL6 A;  3EB5 A;  1X4I A;  4F1P A;  3JUE A;  5B79 A;  2YU4 A;  3VK6 A;  1MBM A;  2Y1M A;  2FUI A;  5DKA A;  4R2Y A;  2B0O E;  3ZVZ B;  2YUR A;  3MHH A;  2PUY A;  1WGM A;  2EA6 A;  4R8P K;  5AIT A;  3KV5 A;  2EOD A;  2MD8 C;  4L7X A;  4A49 A;  5G04 B;  2M3H A;  3N9L A;  4YBM A;  2MIQ A;  2EGM A;  1BOR A;  2MUM A;  2DSM A;  2VPE A;  1WEE A;  2ECW A;  4ZQL A;  1WE9 A;  2JRJ A;  5B8D A;  1LDK C;  5LKU A;  5EYA F;  3LQH A;  2LV9 A;  4AVX A;  3T9K A;  5JG6 A;  2CRW A;  5FB1 A;  3C6W A;  3SUB A;  3ZTG A;  2MA6 A;  5G05 B;  3Q1D A;  3M7K A;  2Y1N A;  3O36 A;  2MNZ A;  2UZG A;  1WIM A;  2K17 A;  3HCU A;  2CSV A;  5TBN A;  3KDE C;  1RMD A;  5H9M A;  2RR4 A;  2CSY A;  2M85 A;  2MKE A;  4YAB A;  3FM8 C;  3DQV R;  4OGC A;  2YW8 A;  5FER A;  2E61 A;  2LXH C;  2YQM A;  1WIL A;  2QIC A;  2JMJ A;  3N9N A;  1DCQ A;  2KIZ A;  3QZV A;  5KH9 A;  2VPB A;  4Z0O A;  1Z6U A;  1Z2Q A;  2L7P A;  4A4B A;  2YT5 A;  3HCT A;  4QF3 A;  2KYU A;  2PNX A;  2VJF B;  3KQI A;  2JUN A;  2CSZ A;  2LGL A;  4LAD B;  2KWN A;  5KH7 A;  4GNE A;  2M13 A;  3KV6 A;  2YRE A;  1VFY A;  2MT5 A;  4Q6F A;  4R7E A;  2G6Q A;  3FEH A;  1WFK A;  2KWO A;  2L0B A;  1T1H A;  4X3G A;  5B76 A;  1WEU A;  5KH3 A;  4I7D A;  2K1J A;  3RTR B;  5H1T A;  2OXQ C;  2C2L A;  1WEV A;  2IDA A;  2CKL B;  4A0C D;  3SOW A;  2D8U A;  3FL2 A;  2KR4 A;  2XOZ A;  5G0F A;  2QIZ A;  2VNF A;  2AN6 A;  4GB0 A;  4N3W A;  4OGE A;  5FB0 A;  1E4U A;  3M62 A;  4B86 C;  3M99 A;  4BHW A;  3LRQ A;  1JOC A;  2RI7 A;  2KU3 A;  2M1R A;  3U5M A;  2G45 A;  4GND A;  1N87 A;  1WEM A;  2VJF A;  4WZ0 A;  3ZYQ A;  4AUQ B;  4I7B A;  4QF2 A;  2F42 A;  5SVI B;  3FJU B;  4YAX A;  3DPL R;  5B77 A;  4MVT A;  3O7A A;  3H7H A;  1F62 A;  4N4F A;  4NN2 A;  5J3X A;  4LKA A;  2KWK A;  2CON A;  2XEU A;  3PHD A;  2K4D A;  2F6N A;  2VJE A;  3PLW A;  3DDT A;  5LKT A;  2HYE D;  3SOX A;  2F6J A;  2XOY A;  2OWA A;  5D1M B;  3O47 A;  3M63 A;  2KKY A;  3C5K A;  3FAN A;  2YSJ A;  3O37 A;  2YSM A;  1WEQ A;  2YHN A;  4GNF A;  2H0D A;  2LN0 A;  3HTK C;  2LQ6 A;  4FJC A;  4LJN A;  2YYR A;  2QJ0 A;  2CRR A;  3T6R A;  2I50 A;  3SOU A;  4ZUX U;  1FBV A;  4MSX A;  3SHB A;  2C2V S;  2KWJ A;  4WZ3 B;  4YBS A;  4FO9 A;  2KGG A;  3MHS A;  2E6R A;  5FEY A;  3GV4 A;  2LAU A;  1VYX A;  1HYJ A;  4AYC B;  4A4C A;  4UP0 A;  2L5U A;  3HCS A;  1DVP A;  2VPD A;  2IQJ A;  5H1U A;  4H9D A;  2KFT A;  2K16 A;  2ECN A;  3N9Q A;  5C11 A;  1K2F A;  5SVY A;  4LK9 A;  5DIN A;  1IYM A;  4PPE A;  4ZDT A;  4CCG X;  5H1V A;  5TRB A;  1ZBD B;  2L80 A;  2LGK A;  4V3K C;  2XB1 A;  3RPG B;  2G43 A;  4WZ2 A;  2LGG A;  3LDY A;  3LQI A;  2L43 A;  2LRI C;  3N9O A;  5I3L A;  4CA1 A;  4FIP A;  3L1Z B;  2EXU A;  3ASL A;  2FSA A;  2DJA A;  4O62 A;  1FP0 A;  2YVR A;  3MDB C;  3KNV A;  1WEP A;  2P57 A;  4FK5 A;  4B7Y C;  5B78 A;  3ZNI A;  1HYI A;  4O64 A;  1WEN A;  1JM7 B;  2DX8 A;  2KKX A;  4UP5 A;  2LGV A;  4IC3 A;  4S3O B;  2KGI A;  3NG2 A;  2CT2 A;  3IHP A;  2YUC A;  2MNY A;  2D8S A;  2XP0 A;  2ZET C;  2ECG A;  3RPG C;  2ECI A;  1LDJ B;  3O35 A;  4V3L C;  2FFW A;  2MD7 B;  1X4U A;  1U6G B;  2JMD A;  1WEW A;  5AIU A;  4TKP B;  3U5N A;  4GNG A;  2CKL A;  2VP7 A;  1MM2 A;  5TAB A;  3U5P A;  2FUU A;  3LJU X;  5LKZ A;  5B75 A;  1JM7 A;  3O33 A;  5TDR A;  4YBT A;  2YHO A;  4UI9 B;  4S3O C;  4AP4 A;  4QQ4 A;  2ECT A;  4IC2 A;  5TDW A;  4YAD A;  2EGP A;  3L1X A;  2FD4 A;  5SVX A;  3U5O A;  3T7L A;  1XWH A;  3EB6 A;  1Z60 A;  4XI1 A;  1CHC A;  2NAA A;  5SVI A;  4YC9 A;  3N9M A;  3O70 A;  1VD4 A;  2XOC A;  3L11 A;  2E6S A;  4L58 A;  3I2D A; 
#chains in the Genus database with same CATH homology
 4W4U A;  2KE1 A;  2ECV A;  2HDP A;  5C13 A;  3PUQ A;  2VPG A;  1V87 A;  4BBQ A;  2MA5 A;  3ZPV E;  3ZVY A;  3O34 A;  4PTB A;  3ZPV 1;  4YAT A;  4C9Z A;  2YQL A;  2M6M A;  2KRE A;  2L75 A;  5LCW B;  3PUR A;  2ECJ A;  1X4J A;  1WEO A;  5D1L B;  5LKX A;  3LQJ A;  3N9P A;  2JMI A;  2BAY A;  2VJE B;  2Y43 A;  1WES A;  1MM3 A;  4P5O B;  4F52 B;  4WA6 A;  2LDR A;  4I7C A;  5D1K B;  4AYC A;  2LXP C;  4LLB A;  3V43 A;  2RSD A;  2H0D B;  1G25 A;  3GL6 A;  3EB5 A;  1X4I A;  5B79 A;  2YU4 A;  3VK6 A;  2Y1M A;  2FUI A;  5DKA A;  4R2Y A;  3ZVZ B;  2YUR A;  3MHH A;  2PUY A;  1WGM A;  2EA6 A;  4R8P K;  5AIT A;  3KV5 A;  2EOD A;  2MD8 C;  4L7X A;  4A49 A;  5G04 B;  2M3H A;  3N9L A;  4YBM A;  2MIQ A;  1BOR A;  2MUM A;  2VPE A;  1WEE A;  2ECW A;  4ZQL A;  1WE9 A;  2JRJ A;  5B8D A;  1LDK C;  5LKU A;  5EYA F;  3LQH A;  2LV9 A;  4AVX A;  5JG6 A;  5FB1 A;  3C6W A;  3ZTG A;  2MA6 A;  5G05 B;  2Y1N A;  3O36 A;  2MNZ A;  2UZG A;  1WIM A;  2K17 A;  3HCU A;  5TBN A;  1RMD A;  5H9M A;  2CSY A;  2M85 A;  4YAB A;  3DQV R;  2YW8 A;  5FER A;  2LXH C;  2YQM A;  1WIL A;  2QIC A;  2JMJ A;  3N9N A;  2KIZ A;  3QZV A;  5KH9 A;  2VPB A;  1Z6U A;  1Z2Q A;  4A4B A;  2YT5 A;  3HCT A;  4QF3 A;  2KYU A;  2PNX A;  2VJF B;  3KQI A;  2CSZ A;  2LGL A;  4LAD B;  2KWN A;  5KH7 A;  4GNE A;  3KV6 A;  2YRE A;  1VFY A;  2MT5 A;  4Q6F A;  4R7E A;  2G6Q A;  1WFK A;  2KWO A;  2L0B A;  1T1H A;  4X3G A;  5B76 A;  1WEU A;  5KH3 A;  4I7D A;  2K1J A;  3RTR B;  5H1T A;  2OXQ C;  2C2L A;  1WEV A;  2IDA A;  2CKL B;  4A0C D;  3SOW A;  3FL2 A;  2KR4 A;  5G0F A;  2QIZ A;  2VNF A;  2AN6 A;  4GB0 A;  4N3W A;  5FB0 A;  1E4U A;  3M62 A;  4B86 C;  3M99 A;  4BHW A;  3LRQ A;  1JOC A;  2RI7 A;  2KU3 A;  2M1R A;  3U5M A;  2G45 A;  4GND A;  1N87 A;  1WEM A;  2VJF A;  4WZ0 A;  3ZYQ A;  4AUQ B;  4I7B A;  4QF2 A;  2F42 A;  4YAX A;  3DPL R;  5B77 A;  4MVT A;  3O7A A;  1F62 A;  4N4F A;  4NN2 A;  5J3X A;  4LKA A;  2KWK A;  2XEU A;  3PHD A;  2K4D A;  2F6N A;  2VJE A;  5LKT A;  2HYE D;  3SOX A;  2F6J A;  5D1M B;  3M63 A;  3C5K A;  2YSJ A;  3O37 A;  2YSM A;  1WEQ A;  2YHN A;  4GNF A;  2H0D A;  2LN0 A;  3HTK C;  2LQ6 A;  4FJC A;  4LJN A;  2YYR A;  2QJ0 A;  3T6R A;  2I50 A;  3SOU A;  4ZUX U;  1FBV A;  4MSX A;  3SHB A;  2C2V S;  2KWJ A;  4WZ3 B;  4YBS A;  4FO9 A;  2KGG A;  3MHS A;  2E6R A;  5FEY A;  3GV4 A;  1VYX A;  1HYJ A;  4AYC B;  4A4C A;  4UP0 A;  2L5U A;  3HCS A;  1DVP A;  2VPD A;  5H1U A;  2KFT A;  2K16 A;  2ECN A;  3N9Q A;  5C11 A;  1K2F A;  4LK9 A;  5DIN A;  1IYM A;  4PPE A;  4ZDT A;  4CCG X;  5H1V A;  5TRB A;  1ZBD B;  2L80 A;  2LGK A;  4V3K C;  2XB1 A;  3RPG B;  2G43 A;  4WZ2 A;  2LGG A;  3LQI A;  2L43 A;  2LRI C;  3N9O A;  5I3L A;  4CA1 A;  4FIP A;  3L1Z B;  3ASL A;  2FSA A;  1FP0 A;  3KNV A;  1WEP A;  5B78 A;  4FK5 A;  4B7Y C;  3ZNI A;  1HYI A;  4O64 A;  1WEN A;  1JM7 B;  2DX8 A;  4UP5 A;  2LGV A;  4IC3 A;  4S3O B;  2KGI A;  3NG2 A;  2CT2 A;  3IHP A;  2YUC A;  2MNY A;  2D8S A;  2ZET C;  2ECG A;  3RPG C;  2ECI A;  1LDJ B;  3O35 A;  4V3L C;  2MD7 B;  1X4U A;  1U6G B;  2JMD A;  1WEW A;  5AIU A;  4TKP B;  3U5N A;  4GNG A;  2CKL A;  2VP7 A;  1MM2 A;  5TAB A;  3U5P A;  2FUU A;  5LKZ A;  5B75 A;  1JM7 A;  3O33 A;  5TDR A;  4YBT A;  2YHO A;  4UI9 B;  4S3O C;  4AP4 A;  2ECT A;  4IC2 A;  5TDW A;  4YAD A;  2EGP A;  3L1X A;  3U5O A;  3T7L A;  1XWH A;  3EB6 A;  1Z60 A;  4XI1 A;  1CHC A;  2NAA A;  4YC9 A;  3N9M A;  3O70 A;  1VD4 A;  3L11 A;  2E6S A;  4L58 A;  3I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...