2YT5A

Solution structure of the phd domain of metal-response element-binding transcription factor 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GSSGSSGVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PHD domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Metal-response element-binding transcription factor 2
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yt5A00
2IDAA 2VJFB 5KH9A 2YSJA 4L58A 2VPEA 1WGMA 4ZUXU 5G05B 3O34A 4LKAA 4QF3A 4GNDA 3SOXA 4C9ZA 5DINA 3N9OA 3U5OA 1ZBDB 1WEEA 4MSXA 2AN6A 3T6RA 2L5UA 5I3LA 5TRBA 4N3WA 2KIZA 1CHCA 5B79A 2RI7A 5DKAA 5FB1A 3MHSA 2KGGA 4FO9A 5AITA 3DQVR 4AUQB 3I2DA 3RPGB 1WEOA 3ZYQA 2ECIA 2ECWA 1Z2QA 2KU3A 3RTRB 4CCGX 2L80A 2YW8A 4YC9A 4YBSA 2G6QA 2HDPA 2QIZA 2KYUA 5C11A 5FEYA 2L43A 3PURA 1MM3A 3L1ZB 1WEQA 1WEUA 4WA6A 4PTBA 2KWNA 2LGVA 4TKPB 2LRIC 3QZVA 2BAYA 4AYCB 3SOUA 1U6GB 4FJCA 1JM7A 4AYCA 3U5NA 2RSDA 3ZTGA 4YAXA 5B77A 2KGIA 4GNFA 4R7EA 2LV9A 4I7CA 4B86C 5J3XA 4I7DA 1WESA 3IHPA 5LKUA 2G45A 2MD7B 5LKXA 5LKTA 2FUIA 2MD8C 1WE9A 3C6WA 4LADB 1V87A 1WEWA 3FL2A 1BORA 3ZNIA 1FBVA 2M6MA 3KNVA 2C2VS 2YQMA 2MA6A 5G04B 4PPEA 2LGKA 2YURA 3KV6A 1WEPA 3LQHA 2PUYA 4WZ0A 2F6NA 2K16A 4YBMA 5FERA 3M63A 2Y43A 4S3OB 2LXPC 3RPGC 3N9NA 3HCUA 3ZPV1 1VD4A 2M85A 2EODA 2G43A 5LCWB 1WEVA 2MT5A 4MVTA 4F52B 2YT5A 2KREA 2YYRA 3HTKC 3MHHA 5D1KB 3HCTA 2UZGA 5KH7A 2KE1A 2KFTA 1IYMA 4LJNA 2VJEA 2YU4A 3C5KA 2VJFA 5EYAF 4B7YC 2DX8A 1K2FA 2EGPA 2MIQA 3O7AA 2YQLA 3N9PA 1RMDA 1WILA 5B75A 5TDWA 1WEMA 2LDRA 4R8PK 2Y1MA 2LGLA 3M99A 1XWHA 3PHDA 2YREA 3NG2A 1MM2A 5B76A 2MNYA 4AP4A 4O64A 2ECGA 2JRJA 1JOCA 1HYJA 2C2LA 1T1HA 3U5MA 3HCSA 2VP7A 2ECTA 3O36A 1E4UA 4YBTA 2CSYA 4IC3A 1VYXA 3DPLR 3N9MA 5TDRA 3VK6A 3EB5A 5LKZA 4FIPA 4V3LC 2E6SA 4GNGA 3PUQA 2FSAA 2ZETC 2ECJA 5KH3A 2LGGA 2LN0A 2XB1A 1LDJB 3N9LA 5G0FA 2VJEB 2XEUA 3LQJA 1HYIA 2VPBA 3SOWA 1WFKA 1WIMA 1WENA 5D1LB 2MA5A 2K1JA 3L11A 3O37A 4UI9B 3GL6A 2FUUA 5C13A 1X4IA 5TBNA 4ZDTA 4S3OC 2CKLA 2EA6A 3ZVYA 3M62A 5AIUA 4GB0A 1LDKC 4V3KC 2JMDA 1FP0A 2NAAA 2QICA 2H0DA 4LK9A 5FB0A 1Z60A 4YATA 4YABA 2KWKA 2D8SA 2VNFA 3O35A 2I50A 4WZ3B 5D1MB 1G25A 2CKLB 1F62A 1JM7B 4A49A 4A4CA 2F42A 4A4BA 4A0CD 2CT2A 3O70A 3L1XA 4R2YA 5H9MA 4LLBA 3LRQA 2YUCA 4IC2A 4Q6FA 4P5OB 2ECVA 3KV5A 4L7XA 2F6JA 1DVPA 2YSMA 3LQIA 4BBQA 4N4FA 4YADA 3KQIA 4GNEA 4XI1A 2KWOA 2K4DA 2JMJA 5H1TA 2JMIA 4X3GA 4AVXA 3U5PA 2M1RA 4ZQLA 4WZ2A 4NN2A 2M3HA 2E6RA 2LQ6A 2CSZA 2VPGA 2LXHC 2Y1NA 2YHNA 4BHWA 2MNZA 4W4UA 1X4JA 5JG6A 5H1VA 2L0BA 5TABA 2K17A 5B78A 1VFYA 2VPDA 2MUMA 2OXQC 2ECNA 2PNXA 4QF2A 3T7LA 4UP5A 2KWJA 2KR4A 3ZPVE 4I7BA 4CA1A 3O33A 1Z6UA 2L75A 3V43A 2QJ0A 5B8DA 3EB6A 1X4UA 3ZVZB 1N87A 4UP0A 3GV4A 3SHBA 4FK5A 3ASLA 2HYED 2YHOA 3N9QA 5H1UA 2H0DB
chains in the Genus database with same CATH superfamily
2IDAA 2XOZA 2VJFB 5KH9A 2YSJA 4L58A 2VPEA 1WGMA 4ZUXU 5G05B 3O34A 4LKAA 4QF3A 2IQJA 4GNDA 2CSVA 3SOXA 1DCQA 4C9ZA 5DINA 3N9OA 3U5OA 2EXUA 1ZBDB 2CRWA 1WEEA 4MSXA 2AN6A 3T6RA 2L5UA 5I3LA 4O62A 5TRBA 4N3WA 2KIZA 1CHCA 5B79A 2RI7A 5SVXA 5DKAA 5FB1A 2RR4A 3MHSA 2KGGA 4FO9A 5AITA 3DQVR 4AUQB 2L7PA 2M13A 2KKYA 3I2DA 3RPGB 1WEOA 3ZYQA 2ECIA 2ECWA 1Z2QA 2KU3A 3RTRB 2CRRA 4CCGX 2L80A 2YW8A 1MBMA 4YC9A 3FANA 4YBSA 2G6QA 2HDPA 2QIZA 2KYUA 5C11A 5FEYA 2L43A 3PURA 1MM3A 3L1ZB 2FFWA 1WEQA 3LVRE 1WEUA 4WA6A 2XOCA 4PTBA 2KWNA 2DJAA 2LGVA 4TKPB 3DDTA 2LRIC 4OGCA 3QZVA 2BAYA 5SVIA 4AYCB 3SOUA 1U6GB 2YVRA 4FJCA 1JM7A 4AYCA 3U5NA 2RSDA 3ZTGA 4YAXA 5B77A 2KGIA 4GNFA 4R7EA 2LV9A 4I7CA 4B86C 5J3XA 4I7DA 1WESA 3IHPA 3LVQE 5LKUA 2XOYA 2G45A 2MD7B 5LKXA 5LKTA 2FUIA 2MD8C 1WE9A 3C6WA 4LADB 1V87A 1WEWA 3FL2A 1BORA 3ZNIA 1FBVA 2M6MA 3KNVA 2C2VS 4F1PA 2YQMA 2MA6A 5G04B 4PPEA 2LGKA 2YURA 3KV6A 1WEPA 3LQHA 2PUYA 4WZ0A 2F6NA 2K16A 4YBMA 5FERA 3M63A 2Y43A 4S3OB 2LXPC 3RPGC 3N9NA 3HCUA 3ZPV1 1VD4A 2M85A 2EODA 3E2DA 2G43A 5LCWB 1WEVA 2MT5A 4MVTA 4F52B 2YT5A 2KREA 2EGMA 2YYRA 3HTKC 3MHHA 5D1KB 3FJUB 3HCTA 3LJUX 2UZGA 5KH7A 2KE1A 3FEHA 3MDBC 2KFTA 1IYMA 4LJNA 2VJEA 2YU4A 3C5KA 2VJFA 5EYAF 4B7YC 2DX8A 3SUBA 1K2FA 2EGPA 2MIQA 3O7AA 2YQLA 3N9PA 1RMDA 3DWDA 1WILA 5B75A 5TDWA 1WEMA 2LDRA 4R8PK 2Y1MA 2LGLA 3M99A 3FM8C 2KKXA 1XWHA 3PHDA 2YREA 3NG2A 1MM2A 5B76A 2MNYA 4AP4A 4O64A 2ECGA 2JRJA 2D8UA 2FD4A 1JOCA 3PLWA 1HYJA 2C2LA 2MKEA 1T1HA 3U5MA 3HCSA 2VP7A 2ECTA 3O36A 1E4UA 4YBTA 3LDYA 2CSYA 4IC3A 1VYXA 3DPLR 3N9MA 4Z0RA 5TDRA 3VK6A 3EB5A 5LKZA 4FIPA 4V3LC 2E6SA 4GNGA 3PUQA 2LAUA 2FSAA 2ZETC 2ECJA 5KH3A 2LGGA 2LN0A 2XB1A 1LDJB 3N9LA 2VJEB 2XEUA 3LQJA 5G0FA 1HYIA 2E61A 2DSMA 2VPBA 3SOWA 3KDEC 1WFKA 1WIMA 1WENA 5D1LB 2MA5A 2K1JA 5K3QA 3L11A 3O37A 4UI9B 3GL6A 2FUUA 5C13A 1X4IA 2JUNA 5TBNA 4ZDTA 4S3OC 2CKLA 2EA6A 3ZVYA 3M62A 3FAOA 5AIUA 4GB0A 1LDKC 4V3KC 2JMDA 1FP0A 2NAAA 2QICA 2H0DA 4LK9A 5FB0A 4H9DA 1Z60A 3H7HA 4YATA 4YABA 2KWKA 2D8SA 2VNFA 3O35A 2I50A 2P57A 4WZ3B 5D1MB 1G25A 2CKLB 1F62A 1JM7B 4A49A 4A4CA 2XP0A 2CONA 2F42A 4A4BA 4A0CD 2CT2A 3O70A 3L1XA 4R2YA 5H9MA 4LLBA 3LRQA 2OWAA 2YUCA 3M7KA 4IC2A 4Q6FA 4P5OB 2ECVA 3KV5A 4L7XA 2F6JA 1DVPA 2YSMA 3JUEA 3LQIA 4BBQA 4N4FA 4YADA 3KQIA 4GNEA 4XI1A 2KWOA 2K4DA 2JMJA 4QQ4A 3Q1DA 5H1TA 2JMIA 4X3GA 4AVXA 3U5PA 2M1RA 4ZQLA 4WZ2A 3T9KA 3O47A 4NN2A 4Z0OA 2M3HA 2B0OE 2E6RA 2LQ6A 2CSZA 2VPGA 2LXHC 2Y1NA 2YHNA 4BHWA 5SVYA 2MNZA 4W4UA 1X4JA 5JG6A 5H1VA 2L0BA 5TABA 2K17A 5B78A 1VFYA 2VPDA 4OGEA 2MUMA 2OXQC 2ECNA 2PNXA 4QF2A 3T7LA 4UP5A 2KWJA 2KR4A 3ZPVE 4I7BA 4CA1A 3O33A 1Z6UA 2L75A 5SVIB 3V43A 2QJ0A 5B8DA 3EB6A 2JM3A 1X4UA 3ZVZB 1N87A 4UP0A 3GV4A 3SHBA 4FK5A 3ASLA 2HYED 2YHOA 3N9QA 5H1UA 2H0DB
chains in the Genus database with same CATH topology
2IDAA 2VJFB 5KH9A 2YSJA 4L58A 2VPEA 1WGMA 4ZUXU 5G05B 3O34A 4LKAA 4QF3A 4GNDA 3SOXA 4C9ZA 5DINA 3N9OA 3U5OA 1ZBDB 1WEEA 4MSXA 2AN6A 3T6RA 2L5UA 5I3LA 5TRBA 4N3WA 2KIZA 1CHCA 5B79A 2RI7A 5DKAA 5FB1A 3MHSA 2KGGA 4FO9A 5AITA 3DQVR 4AUQB 3I2DA 3RPGB 1WEOA 3ZYQA 2ECIA 2ECWA 1Z2QA 2KU3A 3RTRB 4CCGX 2L80A 2YW8A 4YC9A 4YBSA 2G6QA 2HDPA 2QIZA 2KYUA 5C11A 5FEYA 2L43A 3PURA 1MM3A 3L1ZB 1WEQA 1WEUA 4WA6A 4PTBA 2KWNA 2LGVA 4TKPB 2LRIC 3QZVA 2BAYA 4AYCB 3SOUA 1U6GB 4FJCA 1JM7A 4AYCA 3U5NA 2RSDA 3ZTGA 4YAXA 5B77A 2KGIA 4GNFA 4R7EA 2LV9A 4I7CA 4B86C 5J3XA 4I7DA 1WESA 3IHPA 5LKUA 2G45A 2MD7B 5LKXA 5LKTA 2FUIA 2MD8C 1WE9A 3C6WA 4LADB 1V87A 1WEWA 3FL2A 1BORA 3ZNIA 1FBVA 2M6MA 3KNVA 2C2VS 2YQMA 2MA6A 5G04B 4PPEA 2LGKA 2YURA 3KV6A 1WEPA 3LQHA 2PUYA 4WZ0A 2F6NA 2K16A 4YBMA 5FERA 3M63A 2Y43A 4S3OB 2LXPC 3RPGC 3N9NA 3HCUA 3ZPV1 1VD4A 2M85A 2EODA 2G43A 5LCWB 1WEVA 2MT5A 4MVTA 4F52B 2YT5A 2KREA 2YYRA 3HTKC 3MHHA 5D1KB 3HCTA 2UZGA 5KH7A 2KE1A 2KFTA 1IYMA 4LJNA 2VJEA 2YU4A 3C5KA 2VJFA 5EYAF 4B7YC 2DX8A 1K2FA 2EGPA 2MIQA 3O7AA 2YQLA 3N9PA 1RMDA 1WILA 5B75A 5TDWA 1WEMA 2LDRA 4R8PK 2Y1MA 2LGLA 3M99A 1XWHA 3PHDA 2YREA 3NG2A 1MM2A 5B76A 2MNYA 4AP4A 4O64A 2ECGA 2JRJA 1JOCA 1HYJA 2C2LA 1T1HA 3U5MA 3HCSA 2VP7A 2ECTA 3O36A 1E4UA 4YBTA 2CSYA 4IC3A 1VYXA 3DPLR 3N9MA 5TDRA 3VK6A 3EB5A 5LKZA 4FIPA 4V3LC 2E6SA 4GNGA 3PUQA 2FSAA 2ZETC 2ECJA 5KH3A 2LGGA 2LN0A 2XB1A 1LDJB 3N9LA 5G0FA 2VJEB 2XEUA 3LQJA 1HYIA 2VPBA 3SOWA 1WFKA 1WIMA 1WENA 5D1LB 2MA5A 2K1JA 3L11A 3O37A 4UI9B 3GL6A 2FUUA 5C13A 1X4IA 5TBNA 4ZDTA 4S3OC 2CKLA 2EA6A 3ZVYA 3M62A 5AIUA 4GB0A 1LDKC 4V3KC 2JMDA 1FP0A 2NAAA 2QICA 2H0DA 4LK9A 5FB0A 1Z60A 4YATA 4YABA 2KWKA 2D8SA 2VNFA 3O35A 2I50A 4WZ3B 5D1MB 1G25A 2CKLB 1F62A 1JM7B 4A49A 4A4CA 2F42A 4A4BA 4A0CD 2CT2A 3O70A 3L1XA 4R2YA 5H9MA 4LLBA 3LRQA 2YUCA 4IC2A 4Q6FA 4P5OB 2ECVA 3KV5A 4L7XA 2F6JA 1DVPA 2YSMA 3LQIA 4BBQA 4N4FA 4YADA 3KQIA 4GNEA 4XI1A 2KWOA 2K4DA 2JMJA 5H1TA 2JMIA 4X3GA 4AVXA 3U5PA 2M1RA 4ZQLA 4WZ2A 4NN2A 2M3HA 2E6RA 2LQ6A 2CSZA 2VPGA 2LXHC 2Y1NA 2YHNA 4BHWA 2MNZA 4W4UA 1X4JA 5JG6A 5H1VA 2L0BA 5TABA 2K17A 5B78A 1VFYA 2VPDA 2MUMA 2OXQC 2ECNA 2PNXA 4QF2A 3T7LA 4UP5A 2KWJA 2KR4A 3ZPVE 4I7BA 4CA1A 3O33A 1Z6UA 2L75A 3V43A 2QJ0A 5B8DA 3EB6A 1X4UA 3ZVZB 1N87A 4UP0A 3GV4A 3SHBA 4FK5A 3ASLA 2HYED 2YHOA 3N9QA 5H1UA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDA A;  2VJF B;  5KH9 A;  2YSJ A;  4L58 A;  2VPE A;  1WGM A;  4ZUX U;  5G05 B;  3O34 A;  4LKA A;  4QF3 A;  4GND A;  3SOX A;  4C9Z A;  5DIN A;  3N9O A;  3U5O A;  1ZBD B;  1WEE A;  4MSX A;  2AN6 A;  3T6R A;  2L5U A;  5I3L A;  5TRB A;  4N3W A;  2KIZ A;  1CHC A;  5B79 A;  2RI7 A;  5DKA A;  5FB1 A;  3MHS A;  2KGG A;  4FO9 A;  5AIT A;  3DQV R;  4AUQ B;  3I2D A;  3RPG B;  1WEO A;  3ZYQ A;  2ECI A;  2ECW A;  1Z2Q A;  2KU3 A;  3RTR B;  4CCG X;  2L80 A;  2YW8 A;  4YC9 A;  4YBS A;  2G6Q A;  2HDP A;  2QIZ A;  2KYU A;  5C11 A;  5FEY A;  2L43 A;  3PUR A;  1MM3 A;  3L1Z B;  1WEQ A;  1WEU A;  4WA6 A;  4PTB A;  2KWN A;  2LGV A;  4TKP B;  2LRI C;  3QZV A;  2BAY A;  4AYC B;  3SOU A;  1U6G B;  4FJC A;  1JM7 A;  4AYC A;  3U5N A;  2RSD A;  3ZTG A;  4YAX A;  5B77 A;  2KGI A;  4GNF A;  4R7E A;  2LV9 A;  4I7C A;  4B86 C;  5J3X A;  4I7D A;  1WES A;  3IHP A;  5LKU A;  2G45 A;  2MD7 B;  5LKX A;  5LKT A;  2FUI A;  2MD8 C;  1WE9 A;  3C6W A;  4LAD B;  1V87 A;  1WEW A;  3FL2 A;  1BOR A;  3ZNI A;  1FBV A;  2M6M A;  3KNV A;  2C2V S;  2YQM A;  2MA6 A;  5G04 B;  4PPE A;  2LGK A;  2YUR A;  3KV6 A;  1WEP A;  3LQH A;  2PUY A;  4WZ0 A;  2F6N A;  2K16 A;  4YBM A;  5FER A;  3M63 A;  2Y43 A;  4S3O B;  2LXP C;  3RPG C;  3N9N A;  3HCU A;  3ZPV 1;  1VD4 A;  2M85 A;  2EOD A;  2G43 A;  5LCW B;  1WEV A;  2MT5 A;  4MVT A;  4F52 B;  2YT5 A;  2KRE A;  2YYR A;  3HTK C;  3MHH A;  5D1K B;  3HCT A;  2UZG A;  5KH7 A;  2KE1 A;  2KFT A;  1IYM A;  4LJN A;  2VJE A;  2YU4 A;  3C5K A;  2VJF A;  5EYA F;  4B7Y C;  2DX8 A;  1K2F A;  2EGP A;  2MIQ A;  3O7A A;  2YQL A;  3N9P A;  1RMD A;  1WIL A;  5B75 A;  5TDW A;  1WEM A;  2LDR A;  4R8P K;  2Y1M A;  2LGL A;  3M99 A;  1XWH A;  3PHD A;  2YRE A;  3NG2 A;  1MM2 A;  5B76 A;  2MNY A;  4AP4 A;  4O64 A;  2ECG A;  2JRJ A;  1JOC A;  1HYJ A;  2C2L A;  1T1H A;  3U5M A;  3HCS A;  2VP7 A;  2ECT A;  3O36 A;  1E4U A;  4YBT A;  2CSY A;  4IC3 A;  1VYX A;  3DPL R;  3N9M A;  5TDR A;  3VK6 A;  3EB5 A;  5LKZ A;  4FIP A;  4V3L C;  2E6S A;  4GNG A;  3PUQ A;  2FSA A;  2ZET C;  2ECJ A;  5KH3 A;  2LGG A;  2LN0 A;  2XB1 A;  1LDJ B;  3N9L A;  5G0F A;  2VJE B;  2XEU A;  3LQJ A;  1HYI A;  2VPB A;  3SOW A;  1WFK A;  1WIM A;  1WEN A;  5D1L B;  2MA5 A;  2K1J A;  3L11 A;  3O37 A;  4UI9 B;  3GL6 A;  2FUU A;  5C13 A;  1X4I A;  5TBN A;  4ZDT A;  4S3O C;  2CKL A;  2EA6 A;  3ZVY A;  3M62 A;  5AIU A;  4GB0 A;  1LDK C;  4V3K C;  2JMD A;  1FP0 A;  2NAA A;  2QIC A;  2H0D A;  4LK9 A;  5FB0 A;  1Z60 A;  4YAT A;  4YAB A;  2KWK A;  2D8S A;  2VNF A;  3O35 A;  2I50 A;  4WZ3 B;  5D1M B;  1G25 A;  2CKL B;  1F62 A;  1JM7 B;  4A49 A;  4A4C A;  2F42 A;  4A4B A;  4A0C D;  2CT2 A;  3O70 A;  3L1X A;  4R2Y A;  5H9M A;  4LLB A;  3LRQ A;  2YUC A;  4IC2 A;  4Q6F A;  4P5O B;  2ECV A;  3KV5 A;  4L7X A;  2F6J A;  1DVP A;  2YSM A;  3LQI A;  4BBQ A;  4N4F A;  4YAD A;  3KQI A;  4GNE A;  4XI1 A;  2KWO A;  2K4D A;  2JMJ A;  5H1T A;  2JMI A;  4X3G A;  4AVX A;  3U5P A;  2M1R A;  4ZQL A;  4WZ2 A;  4NN2 A;  2M3H A;  2E6R A;  2LQ6 A;  2CSZ A;  2VPG A;  2LXH C;  2Y1N A;  2YHN A;  4BHW A;  2MNZ A;  4W4U A;  1X4J A;  5JG6 A;  5H1V A;  2L0B A;  5TAB A;  2K17 A;  5B78 A;  1VFY A;  2VPD A;  2MUM A;  2OXQ C;  2ECN A;  2PNX A;  4QF2 A;  3T7L A;  4UP5 A;  2KWJ A;  2KR4 A;  3ZPV E;  4I7B A;  4CA1 A;  3O33 A;  1Z6U A;  2L75 A;  3V43 A;  2QJ0 A;  5B8D A;  3EB6 A;  1X4U A;  3ZVZ B;  1N87 A;  4UP0 A;  3GV4 A;  3SHB A;  4FK5 A;  3ASL A;  2HYE D;  2YHO A;  3N9Q A;  5H1U A;  2H0D B; 
#chains in the Genus database with same CATH topology
 2IDA A;  2XOZ A;  2VJF B;  5KH9 A;  2YSJ A;  4L58 A;  2VPE A;  1WGM A;  4ZUX U;  5G05 B;  3O34 A;  4LKA A;  4QF3 A;  2IQJ A;  4GND A;  2CSV A;  3SOX A;  1DCQ A;  4C9Z A;  5DIN A;  3N9O A;  3U5O A;  2EXU A;  1ZBD B;  2CRW A;  1WEE A;  4MSX A;  2AN6 A;  3T6R A;  2L5U A;  5I3L A;  4O62 A;  5TRB A;  4N3W A;  2KIZ A;  1CHC A;  5B79 A;  2RI7 A;  5SVX A;  5DKA A;  5FB1 A;  2RR4 A;  3MHS A;  2KGG A;  4FO9 A;  5AIT A;  3DQV R;  4AUQ B;  2L7P A;  2M13 A;  2KKY A;  3I2D A;  3RPG B;  1WEO A;  3ZYQ A;  2ECI A;  2ECW A;  1Z2Q A;  2KU3 A;  3RTR B;  2CRR A;  4CCG X;  2L80 A;  2YW8 A;  1MBM A;  4YC9 A;  3FAN A;  4YBS A;  2G6Q A;  2HDP A;  2QIZ A;  2KYU A;  5C11 A;  5FEY A;  2L43 A;  3PUR A;  1MM3 A;  3L1Z B;  2FFW A;  1WEQ A;  3LVR E;  1WEU A;  4WA6 A;  2XOC A;  4PTB A;  2KWN A;  2DJA A;  2LGV A;  4TKP B;  3DDT A;  2LRI C;  4OGC A;  3QZV A;  2BAY A;  5SVI A;  4AYC B;  3SOU A;  1U6G B;  2YVR A;  4FJC A;  1JM7 A;  4AYC A;  3U5N A;  2RSD A;  3ZTG A;  4YAX A;  5B77 A;  2KGI A;  4GNF A;  4R7E A;  2LV9 A;  4I7C A;  4B86 C;  5J3X A;  4I7D A;  1WES A;  3IHP A;  3LVQ E;  5LKU A;  2XOY A;  2G45 A;  2MD7 B;  5LKX A;  5LKT A;  2FUI A;  2MD8 C;  1WE9 A;  3C6W A;  4LAD B;  1V87 A;  1WEW A;  3FL2 A;  1BOR A;  3ZNI A;  1FBV A;  2M6M A;  3KNV A;  2C2V S;  4F1P A;  2YQM A;  2MA6 A;  5G04 B;  4PPE A;  2LGK A;  2YUR A;  3KV6 A;  1WEP A;  3LQH A;  2PUY A;  4WZ0 A;  2F6N A;  2K16 A;  4YBM A;  5FER A;  3M63 A;  2Y43 A;  4S3O B;  2LXP C;  3RPG C;  3N9N A;  3HCU A;  3ZPV 1;  1VD4 A;  2M85 A;  2EOD A;  3E2D A;  2G43 A;  5LCW B;  1WEV A;  2MT5 A;  4MVT A;  4F52 B;  2YT5 A;  2KRE A;  2EGM A;  2YYR A;  3HTK C;  3MHH A;  5D1K B;  3FJU B;  3HCT A;  3LJU X;  2UZG A;  5KH7 A;  2KE1 A;  3FEH A;  3MDB C;  2KFT A;  1IYM A;  4LJN A;  2VJE A;  2YU4 A;  3C5K A;  2VJF A;  5EYA F;  4B7Y C;  2DX8 A;  3SUB A;  1K2F A;  2EGP A;  2MIQ A;  3O7A A;  2YQL A;  3N9P A;  1RMD A;  3DWD A;  1WIL A;  5B75 A;  5TDW A;  1WEM A;  2LDR A;  4R8P K;  2Y1M A;  2LGL A;  3M99 A;  3FM8 C;  2KKX A;  1XWH A;  3PHD A;  2YRE A;  3NG2 A;  1MM2 A;  5B76 A;  2MNY A;  4AP4 A;  4O64 A;  2ECG A;  2JRJ A;  2D8U A;  2FD4 A;  1JOC A;  3PLW A;  1HYJ A;  2C2L A;  2MKE A;  1T1H A;  3U5M A;  3HCS A;  2VP7 A;  2ECT A;  3O36 A;  1E4U A;  4YBT A;  3LDY A;  2CSY A;  4IC3 A;  1VYX A;  3DPL R;  3N9M A;  4Z0R A;  5TDR A;  3VK6 A;  3EB5 A;  5LKZ A;  4FIP A;  4V3L C;  2E6S A;  4GNG A;  3PUQ A;  2LAU A;  2FSA A;  2ZET C;  2ECJ A;  5KH3 A;  2LGG A;  2LN0 A;  2XB1 A;  1LDJ B;  3N9L A;  2VJE B;  2XEU A;  3LQJ A;  5G0F A;  1HYI A;  2E61 A;  2DSM A;  2VPB A;  3SOW A;  3KDE C;  1WFK A;  1WIM A;  1WEN A;  5D1L B;  2MA5 A;  2K1J A;  5K3Q A;  3L11 A;  3O37 A;  4UI9 B;  3GL6 A;  2FUU A;  5C13 A;  1X4I A;  2JUN A;  5TBN A;  4ZDT A;  4S3O C;  2CKL A;  2EA6 A;  3ZVY A;  3M62 A;  3FAO A;  5AIU A;  4GB0 A;  1LDK C;  4V3K C;  2JMD A;  1FP0 A;  2NAA A;  2QIC A;  2H0D A;  4LK9 A;  5FB0 A;  4H9D A;  1Z60 A;  3H7H A;  4YAT A;  4YAB A;  2KWK A;  2D8S A;  2VNF A;  3O35 A;  2I50 A;  2P57 A;  4WZ3 B;  5D1M B;  1G25 A;  2CKL B;  1F62 A;  1JM7 B;  4A49 A;  4A4C A;  2XP0 A;  2CON A;  2F42 A;  4A4B A;  4A0C D;  2CT2 A;  3O70 A;  3L1X A;  4R2Y A;  5H9M A;  4LLB A;  3LRQ A;  2OWA A;  2YUC A;  3M7K A;  4IC2 A;  4Q6F A;  4P5O B;  2ECV A;  3KV5 A;  4L7X A;  2F6J A;  1DVP A;  2YSM A;  3JUE A;  3LQI A;  4BBQ A;  4N4F A;  4YAD A;  3KQI A;  4GNE A;  4XI1 A;  2KWO A;  2K4D A;  2JMJ A;  4QQ4 A;  3Q1D A;  5H1T A;  2JMI A;  4X3G A;  4AVX A;  3U5P A;  2M1R A;  4ZQL A;  4WZ2 A;  3T9K A;  3O47 A;  4NN2 A;  4Z0O A;  2M3H A;  2B0O E;  2E6R A;  2LQ6 A;  2CSZ A;  2VPG A;  2LXH C;  2Y1N A;  2YHN A;  4BHW A;  5SVY A;  2MNZ A;  4W4U A;  1X4J A;  5JG6 A;  5H1V A;  2L0B A;  5TAB A;  2K17 A;  5B78 A;  1VFY A;  2VPD A;  4OGE A;  2MUM A;  2OXQ C;  2ECN A;  2PNX A;  4QF2 A;  3T7L A;  4UP5 A;  2KWJ A;  2KR4 A;  3ZPV E;  4I7B A;  4CA1 A;  3O33 A;  1Z6U A;  2L75 A;  5SVI B;  3V43 A;  2QJ0 A;  5B8D A;  3EB6 A;  2JM3 A;  1X4U A;  3ZVZ B;  1N87 A;  4UP0 A;  3GV4 A;  3SHB A;  4FK5 A;  3ASL A;  2HYE D;  2YHO A;  3N9Q A;  5H1U A;  2H0D B; 
#chains in the Genus database with same CATH homology
 2IDA A;  2VJF B;  5KH9 A;  2YSJ A;  4L58 A;  2VPE A;  1WGM A;  4ZUX U;  5G05 B;  3O34 A;  4LKA A;  4QF3 A;  4GND A;  3SOX A;  4C9Z A;  5DIN A;  3N9O A;  3U5O A;  1ZBD B;  1WEE A;  4MSX A;  2AN6 A;  3T6R A;  2L5U A;  5I3L A;  5TRB A;  4N3W A;  2KIZ A;  1CHC A;  5B79 A;  2RI7 A;  5DKA A;  5FB1 A;  3MHS A;  2KGG A;  4FO9 A;  5AIT A;  3DQV R;  4AUQ B;  3I2D A;  3RPG B;  1WEO A;  3ZYQ A;  2ECI A;  2ECW A;  1Z2Q A;  2KU3 A;  3RTR B;  4CCG X;  2L80 A;  2YW8 A;  4YC9 A;  4YBS A;  2G6Q A;  2HDP A;  2QIZ A;  2KYU A;  5C11 A;  5FEY A;  2L43 A;  3PUR A;  1MM3 A;  3L1Z B;  1WEQ A;  1WEU A;  4WA6 A;  4PTB A;  2KWN A;  2LGV A;  4TKP B;  2LRI C;  3QZV A;  2BAY A;  4AYC B;  3SOU A;  1U6G B;  4FJC A;  1JM7 A;  4AYC A;  3U5N A;  2RSD A;  3ZTG A;  4YAX A;  5B77 A;  2KGI A;  4GNF A;  4R7E A;  2LV9 A;  4I7C A;  4B86 C;  5J3X A;  4I7D A;  1WES A;  3IHP A;  5LKU A;  2G45 A;  2MD7 B;  5LKX A;  5LKT A;  2FUI A;  2MD8 C;  1WE9 A;  3C6W A;  4LAD B;  1V87 A;  1WEW A;  3FL2 A;  1BOR A;  3ZNI A;  1FBV A;  2M6M A;  3KNV A;  2C2V S;  2YQM A;  2MA6 A;  5G04 B;  4PPE A;  2LGK A;  2YUR A;  3KV6 A;  1WEP A;  3LQH A;  2PUY A;  4WZ0 A;  2F6N A;  2K16 A;  4YBM A;  5FER A;  3M63 A;  2Y43 A;  4S3O B;  2LXP C;  3RPG C;  3N9N A;  3HCU A;  3ZPV 1;  1VD4 A;  2M85 A;  2EOD A;  2G43 A;  5LCW B;  1WEV A;  2MT5 A;  4MVT A;  4F52 B;  2YT5 A;  2KRE A;  2YYR A;  3HTK C;  3MHH A;  5D1K B;  3HCT A;  2UZG A;  5KH7 A;  2KE1 A;  2KFT A;  1IYM A;  4LJN A;  2VJE A;  2YU4 A;  3C5K A;  2VJF A;  5EYA F;  4B7Y C;  2DX8 A;  1K2F A;  2EGP A;  2MIQ A;  3O7A A;  2YQL A;  3N9P A;  1RMD A;  1WIL A;  5B75 A;  5TDW A;  1WEM A;  2LDR A;  4R8P K;  2Y1M A;  2LGL A;  3M99 A;  1XWH A;  3PHD A;  2YRE A;  3NG2 A;  1MM2 A;  5B76 A;  2MNY A;  4AP4 A;  4O64 A;  2ECG A;  2JRJ A;  1JOC A;  1HYJ A;  2C2L A;  1T1H A;  3U5M A;  3HCS A;  2VP7 A;  2ECT A;  3O36 A;  1E4U A;  4YBT A;  2CSY A;  4IC3 A;  1VYX A;  3DPL R;  3N9M A;  5TDR A;  3VK6 A;  3EB5 A;  5LKZ A;  4FIP A;  4V3L C;  2E6S A;  4GNG A;  3PUQ A;  2FSA A;  2ZET C;  2ECJ A;  5KH3 A;  2LGG A;  2LN0 A;  2XB1 A;  1LDJ B;  3N9L A;  5G0F A;  2VJE B;  2XEU A;  3LQJ A;  1HYI A;  2VPB A;  3SOW A;  1WFK A;  1WIM A;  1WEN A;  5D1L B;  2MA5 A;  2K1J A;  3L11 A;  3O37 A;  4UI9 B;  3GL6 A;  2FUU A;  5C13 A;  1X4I A;  5TBN A;  4ZDT A;  4S3O C;  2CKL A;  2EA6 A;  3ZVY A;  3M62 A;  5AIU A;  4GB0 A;  1LDK C;  4V3K C;  2JMD A;  1FP0 A;  2NAA A;  2QIC A;  2H0D A;  4LK9 A;  5FB0 A;  1Z60 A;  4YAT A;  4YAB A;  2KWK A;  2D8S A;  2VNF A;  3O35 A;  2I50 A;  4WZ3 B;  5D1M B;  1G25 A;  2CKL B;  1F62 A;  1JM7 B;  4A49 A;  4A4C A;  2F42 A;  4A4B A;  4A0C D;  2CT2 A;  3O70 A;  3L1X A;  4R2Y A;  5H9M A;  4LLB A;  3LRQ A;  2YUC A;  4IC2 A;  4Q6F A;  4P5O B;  2ECV A;  3KV5 A;  4L7X A;  2F6J A;  1DVP A;  2YSM A;  3LQI A;  4BBQ A;  4N4F A;  4YAD A;  3KQI A;  4GNE A;  4XI1 A;  2KWO A;  2K4D A;  2JMJ A;  5H1T A;  2JMI A;  4X3G A;  4AVX A;  3U5P A;  2M1R A;  4ZQL A;  4WZ2 A;  4NN2 A;  2M3H A;  2E6R A;  2LQ6 A;  2CSZ A;  2VPG A;  2LXH C;  2Y1N A;  2YHN A;  4BHW A;  2MNZ A;  4W4U A;  1X4J A;  5JG6 A;  5H1V A;  2L0B A;  5TAB A;  2K17 A;  5B78 A;  1VFY A;  2VPD A;  2MUM A;  2OXQ C;  2ECN A;  2PNX A;  4QF2 A;  3T7L A;  4UP5 A;  2KWJ A;  2KR4 A;  3ZPV E;  4I7B A;  4CA1 A;  3O33 A;  1Z6U A;  2L75 A;  3V43 A;  2QJ0 A;  5B8D A;  3EB6 A;  1X4U A;  3ZVZ B;  1N87 A;  4UP0 A;  3GV4 A;  3SHB A;  4FK5 A;  3ASL A;  2HYE D;  2YHO A;  3N9Q A;  5H1U A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...