2YT5A

Solution structure of the phd domain of metal-response element-binding transcription factor 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
b'GSSGSSGVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal-response element-binding transcription factor 2
publication title Solution structure of the PHD domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yt5A00
2YURA 2L5UA 2YU4A 2EGPA 2YW8A 3HCSA 1V87A 3SOXA 2VJFA 3C6WA 4N3WA 2LDRA 1G25A 2YQLA 2L0BA 4AYCB 3HTKC 2VP7A 3RPGB 5JG6A 2YUCA 1ZBDB 5C11A 2CKLA 3KV6A 3N9LA 5FEYA 1X4UA 1K2FA 2K16A 4YABA 3PUQA 1CHCA 3NG2A 1BORA 3MHSA 4BBQA 2ECGA 2CSYA 3O37A 2QJ0A 4XI1A 3EB6A 4L7XA 2Y43A 4W4UA 2MIQA 5G05B 1E4UA 3ASLA 2M6MA 5LKXA 3LRQA 2H0DB 4UI9B 4MVTA 5J3XA 2KE1A 5DINA 2G45A 2JMDA 2KWNA 4I7CA 1Z2QA 3RPGC 1WENA 1HYJA 2L80A 5TDWA 2JRJA 2KWJA 4AVXA 4F52B 3T7LA 1VYXA 3L11A 5AIUA 3M99A 1FBVA 4V3KC 2VPEA 5TRBA 2YHOA 3PHDA 5FB0A 3QZVA 4A4CA 4O64A 4S3OB 1Z6UA 2VNFA 4UP0A 2MA6A 2YYRA 5TABA 3GV4A 4FIPA 4ZUXU 2MUMA 4NN2A 2UZGA 1HYIA 3EB5A 5H9MA 3O34A 4B7YC 2M3HA 2L43A 3O35A 2LXPC 1WILA 2F42A 1Z60A 2KYUA 4QF2A 2HYED 2F6JA 2RI7A 1MM2A 4TKPB 4UP5A 2YSJA 2CKLB 1WGMA 3HCUA 4YBMA 2YQMA 4GNFA 3M63A 2LN0A 5LKZA 4PTBA 1WIMA 4R7EA 2ECWA 4WZ3B 2KFTA 4S3OC 5DKAA 4CCGX 2ECVA 1RMDA 5B78A 4AP4A 2VJEA 4FJCA 3U5OA 2ECIA 4N4FA 5LKUA 3N9PA 2KIZA 2DX8A 3SHBA 1JM7A 4YADA 2M85A 3L1ZB 3LQHA 5H1VA 1FP0A 2OXQC 1WEEA 4ZDTA 3ZPVE 1X4IA 1WEVA 3RTRB 2BAYA 5D1LB 2XB1A 2LRIC 4AUQB 1WEQA 1XWHA 2QICA 4AYCA 2QIZA 1WFKA 5KH9A 3GL6A 5LKTA 2ZETC 5FERA 2YHNA 4MSXA 5TBNA 4WZ0A 2LGVA 2AN6A 3VK6A 2JMJA 5EYAF 2PNXA 4A0CD 3ZYQA 3ZNIA 5KH3A 4Q6FA 3C5KA 2L75A 2LGGA 2XEUA 2K17A 3ZTGA 2FUIA 5FB1A 2KGGA 5B77A 2IDAA 4ZQLA 3KQIA 3ZVYA 1IYMA 4B86C 1MM3A 2ECNA 5C13A 1WEMA 3DQVR 4P5OB 1F62A 1N87A 4I7BA 2KGIA 2VJFB 2MD8C 3V43A 4CA1A 4FK5A 2KR4A 4YAXA 1T1HA 1VD4A 2E6RA 2E6SA 2K1JA 2EODA 5D1KB 2ECJA 5B76A 2MT5A 2K4DA 2ECTA 4YC9A 3N9MA 4GNGA 5H1UA 4R8PK 2VPGA 2LGKA 5LCWB 3MHHA 4X3GA 3M62A 2FSAA 5D1MB 1X4JA 4IC2A 2VJEB 1VFYA 4GNEA 3O36A 2YREA 2MNZA 4LKAA 2G6QA 2M1RA 2MNYA 5B8DA 3KNVA 1WE9A 2EA6A 2NAAA 3O70A 1JM7B 3L1XA 4LK9A 2PUYA 4QF3A 3KV5A 5TDRA 3U5MA 5B79A 1WESA 2FUUA 2KU3A 1LDKC 3ZPV1 2Y1MA 3U5PA 3ZVZB 2F6NA 3N9QA 4I7DA 3LQIA 4R2YA 1U6GB 2I50A 4YBSA 2C2LA 2LV9A 2VPDA 1WEWA 3N9NA 2KREA 2LGLA 4C9ZA 2RSDA 5B75A 1DVPA 4A4BA 4LJNA 3DPLR 5AITA 4LADB 5KH7A 2CT2A 3FL2A 5I3LA 1WEUA 2D8SA 3SOWA 4BHWA 4GNDA 5H1TA 3U5NA 2MD7B 2LQ6A 2CSZA 2Y1NA 2HDPA 4FO9A 4WZ2A 3PURA 1WEOA 1WEPA 2H0DA 4GB0A 5G04B 2G43A 4YATA 2KWKA 2LXHC 2YT5A 3I2DA 4PPEA 1LDJB 3IHPA 3O7AA 3HCTA 4LLBA 4L58A 3O33A 1JOCA 3N9OA 2JMIA 2KWOA 4YBTA 3T6RA 2MA5A 2YSMA 4WA6A 2VPBA 4IC3A 3LQJA 4A49A 2C2VS 4V3LC 3SOUA 5G0FA
chains in the Genus database with same CATH superfamily
2YURA 2L5UA 2YU4A 2EGPA 3JUEA 3LJUX 2YW8A 3HCSA 1V87A 3SOXA 3FAOA 2DJAA 2VJFA 3C6WA 2IQJA 2KKXA 4N3WA 2XOCA 2LDRA 1G25A 2LAUA 3LVQE 2YQLA 2KKYA 2L0BA 4AYCB 3HTKC 2VP7A 3RPGB 5JG6A 2XOYA 2YUCA 1ZBDB 5SVIA 2E61A 5C11A 2CKLA 3KV6A 3N9LA 5FEYA 1X4UA 1K2FA 2K16A 4YABA 3PUQA 4Z0OA 1CHCA 3NG2A 1BORA 3MHSA 4BBQA 2ECGA 2CSYA 3O37A 2QJ0A 4XI1A 3EB6A 2JM3A 4L7XA 2Y43A 4W4UA 2MIQA 5G05B 1E4UA 3ASLA 3LVRE 2M6MA 5LKXA 3LRQA 2H0DB 4UI9B 4MVTA 5J3XA 2KE1A 5DINA 2G45A 2JMDA 2KWNA 4I7CA 1Z2QA 3RPGC 1WENA 1HYJA 2L80A 5TDWA 2JRJA 2KWJA 4AVXA 4F52B 3T7LA 1VYXA 3L11A 5AIUA 3M99A 1FBVA 4V3KC 2VPEA 5TRBA 2YHOA 3FM8C 3DWDA 3PHDA 5FB0A 4Z0RA 3QZVA 4A4CA 4F1PA 4H9DA 3E2DA 4O64A 4S3OB 1Z6UA 2VNFA 4UP0A 2EXUA 2MA6A 2YYRA 5TABA 3GV4A 4FIPA 4ZUXU 2MUMA 4NN2A 2UZGA 1HYIA 3EB5A 5H9MA 3O34A 4B7YC 2M3HA 2P57A 2L43A 3O35A 2LXPC 1WILA 2F42A 1Z60A 2KYUA 4QF2A 2HYED 2F6JA 2RI7A 1MM2A 4TKPB 5SVIB 4UP5A 2YSJA 2YVRA 2CKLB 2CRWA 1WGMA 3HCUA 4YBMA 2YQMA 4GNFA 3M63A 2LN0A 2DSMA 4OGEA 5LKZA 4PTBA 3Q1DA 1WIMA 4R7EA 2ECWA 4WZ3B 2KFTA 4S3OC 5DKAA 4CCGX 2ECVA 1RMDA 5B78A 4AP4A 3FANA 2VJEA 4FJCA 3U5OA 2ECIA 3DDTA 4N4FA 5LKUA 3N9PA 2KIZA 2DX8A 3SHBA 1JM7A 4YADA 2M85A 3L1ZB 3LQHA 5H1VA 1FP0A 3SUBA 2OXQC 1WEEA 4ZDTA 3ZPVE 1X4IA 1WEVA 3RTRB 2BAYA 5D1LB 2XB1A 2LRIC 4AUQB 1WEQA 1XWHA 2QICA 4AYCA 2QIZA 1WFKA 5KH9A 3GL6A 5LKTA 2ZETC 5FERA 2YHNA 4MSXA 5TBNA 4WZ0A 2LGVA 2AN6A 3VK6A 2JMJA 5EYAF 2PNXA 4A0CD 3H7HA 3ZYQA 3ZNIA 5KH3A 4Q6FA 3C5KA 2L75A 2LGGA 2D8UA 2XEUA 2K17A 3ZTGA 2MKEA 3PLWA 2FUIA 5FB1A 2KGGA 5B77A 2IDAA 4ZQLA 3KQIA 3ZVYA 1IYMA 4B86C 1MM3A 2ECNA 5C13A 1WEMA 3DQVR 4P5OB 1F62A 2XOZA 3O47A 1N87A 4I7BA 2KGIA 2VJFB 2MD8C 3V43A 4CA1A 4FK5A 2KR4A 4YAXA 1T1HA 1VD4A 3LDYA 2E6RA 2E6SA 2K1JA 3FEHA 2EODA 5D1KB 2ECJA 5B76A 2MT5A 2K4DA 2ECTA 4YC9A 3N9MA 4GNGA 5H1UA 4R8PK 2VPGA 2FD4A 3MDBC 2LGKA 3FJUB 5LCWB 3MHHA 4X3GA 3M62A 5K3QA 2FSAA 5D1MB 1X4JA 4IC2A 2VJEB 4OGCA 1VFYA 4GNEA 3O36A 2YREA 2MNZA 4LKAA 2G6QA 2M1RA 2MNYA 5B8DA 3KNVA 1WE9A 2EA6A 2NAAA 3O70A 1JM7B 3L1XA 2RR4A 4LK9A 2EGMA 2PUYA 4QF3A 4QQ4A 3KV5A 5TDRA 4O62A 2CSVA 3U5MA 3M7KA 5B79A 1WESA 2FUUA 2KU3A 1LDKC 3ZPV1 2Y1MA 3U5PA 3ZVZB 2F6NA 3N9QA 4I7DA 3LQIA 4R2YA 1U6GB 2I50A 4YBSA 2C2LA 2LV9A 2VPDA 1MBMA 1WEWA 3N9NA 2OWAA 2KREA 2LGLA 4C9ZA 2RSDA 5B75A 1DVPA 2CRRA 4A4BA 4LJNA 3DPLR 5AITA 4LADB 5KH7A 3KDEC 2CT2A 2CONA 3FL2A 5SVXA 5I3LA 1WEUA 2D8SA 3SOWA 4BHWA 4GNDA 5H1TA 3U5NA 2MD7B 2LQ6A 2CSZA 2XP0A 2Y1NA 3T9KA 2HDPA 4FO9A 4WZ2A 3PURA 1WEOA 1WEPA 2H0DA 4GB0A 5G04B 2G43A 4YATA 2KWKA 2LXHC 2M13A 2YT5A 2JUNA 3I2DA 4PPEA 1LDJB 3IHPA 3O7AA 3HCTA 2B0OE 4LLBA 4L58A 3O33A 1JOCA 3N9OA 2JMIA 2KWOA 4YBTA 3T6RA 5SVYA 2MA5A 2YSMA 2L7PA 4WA6A 2VPBA 2FFWA 4IC3A 3LQJA 4A49A 2C2VS 4V3LC 1DCQA 3SOUA 5G0FA
chains in the Genus database with same CATH topology
2YURA 2L5UA 2YU4A 2EGPA 2YW8A 3HCSA 1V87A 3SOXA 2VJFA 3C6WA 4N3WA 2LDRA 1G25A 2YQLA 2L0BA 4AYCB 3HTKC 2VP7A 3RPGB 5JG6A 2YUCA 1ZBDB 5C11A 2CKLA 3KV6A 3N9LA 5FEYA 1X4UA 1K2FA 2K16A 4YABA 3PUQA 1CHCA 3NG2A 1BORA 3MHSA 4BBQA 2ECGA 2CSYA 3O37A 2QJ0A 4XI1A 3EB6A 4L7XA 2Y43A 4W4UA 2MIQA 5G05B 1E4UA 3ASLA 2M6MA 5LKXA 3LRQA 2H0DB 4UI9B 4MVTA 5J3XA 2KE1A 5DINA 2G45A 2JMDA 2KWNA 4I7CA 1Z2QA 3RPGC 1WENA 1HYJA 2L80A 5TDWA 2JRJA 2KWJA 4AVXA 4F52B 3T7LA 1VYXA 3L11A 5AIUA 3M99A 1FBVA 4V3KC 2VPEA 5TRBA 2YHOA 3PHDA 5FB0A 3QZVA 4A4CA 4O64A 4S3OB 1Z6UA 2VNFA 4UP0A 2MA6A 2YYRA 5TABA 3GV4A 4FIPA 4ZUXU 2MUMA 4NN2A 2UZGA 1HYIA 3EB5A 5H9MA 3O34A 4B7YC 2M3HA 2L43A 3O35A 2LXPC 1WILA 2F42A 1Z60A 2KYUA 4QF2A 2HYED 2F6JA 2RI7A 1MM2A 4TKPB 4UP5A 2YSJA 2CKLB 1WGMA 3HCUA 4YBMA 2YQMA 4GNFA 3M63A 2LN0A 5LKZA 4PTBA 1WIMA 4R7EA 2ECWA 4WZ3B 2KFTA 4S3OC 5DKAA 4CCGX 2ECVA 1RMDA 5B78A 4AP4A 2VJEA 4FJCA 3U5OA 2ECIA 4N4FA 5LKUA 3N9PA 2KIZA 2DX8A 3SHBA 1JM7A 4YADA 2M85A 3L1ZB 3LQHA 5H1VA 1FP0A 2OXQC 1WEEA 4ZDTA 3ZPVE 1X4IA 1WEVA 3RTRB 2BAYA 5D1LB 2XB1A 2LRIC 4AUQB 1WEQA 1XWHA 2QICA 4AYCA 2QIZA 1WFKA 5KH9A 3GL6A 5LKTA 2ZETC 5FERA 2YHNA 4MSXA 5TBNA 4WZ0A 2LGVA 2AN6A 3VK6A 2JMJA 5EYAF 2PNXA 4A0CD 3ZYQA 3ZNIA 5KH3A 4Q6FA 3C5KA 2L75A 2LGGA 2XEUA 2K17A 3ZTGA 2FUIA 5FB1A 2KGGA 5B77A 2IDAA 4ZQLA 3KQIA 3ZVYA 1IYMA 4B86C 1MM3A 2ECNA 5C13A 1WEMA 3DQVR 4P5OB 1F62A 1N87A 4I7BA 2KGIA 2VJFB 2MD8C 3V43A 4CA1A 4FK5A 2KR4A 4YAXA 1T1HA 1VD4A 2E6RA 2E6SA 2K1JA 2EODA 5D1KB 2ECJA 5B76A 2MT5A 2K4DA 2ECTA 4YC9A 3N9MA 4GNGA 5H1UA 4R8PK 2VPGA 2LGKA 5LCWB 3MHHA 4X3GA 3M62A 2FSAA 5D1MB 1X4JA 4IC2A 2VJEB 1VFYA 4GNEA 3O36A 2YREA 2MNZA 4LKAA 2G6QA 2M1RA 2MNYA 5B8DA 3KNVA 1WE9A 2EA6A 2NAAA 3O70A 1JM7B 3L1XA 4LK9A 2PUYA 4QF3A 3KV5A 5TDRA 3U5MA 5B79A 1WESA 2FUUA 2KU3A 1LDKC 3ZPV1 2Y1MA 3U5PA 3ZVZB 2F6NA 3N9QA 4I7DA 3LQIA 4R2YA 1U6GB 2I50A 4YBSA 2C2LA 2LV9A 2VPDA 1WEWA 3N9NA 2KREA 2LGLA 4C9ZA 2RSDA 5B75A 1DVPA 4A4BA 4LJNA 3DPLR 5AITA 4LADB 5KH7A 2CT2A 3FL2A 5I3LA 1WEUA 2D8SA 3SOWA 4BHWA 4GNDA 5H1TA 3U5NA 2MD7B 2LQ6A 2CSZA 2Y1NA 2HDPA 4FO9A 4WZ2A 3PURA 1WEOA 1WEPA 2H0DA 4GB0A 5G04B 2G43A 4YATA 2KWKA 2LXHC 2YT5A 3I2DA 4PPEA 1LDJB 3IHPA 3O7AA 3HCTA 4LLBA 4L58A 3O33A 1JOCA 3N9OA 2JMIA 2KWOA 4YBTA 3T6RA 2MA5A 2YSMA 4WA6A 2VPBA 4IC3A 3LQJA 4A49A 2C2VS 4V3LC 3SOUA 5G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUR A;  2L5U A;  2YU4 A;  2EGP A;  2YW8 A;  3HCS A;  1V87 A;  3SOX A;  2VJF A;  3C6W A;  4N3W A;  2LDR A;  1G25 A;  2YQL A;  2L0B A;  4AYC B;  3HTK C;  2VP7 A;  3RPG B;  5JG6 A;  2YUC A;  1ZBD B;  5C11 A;  2CKL A;  3KV6 A;  3N9L A;  5FEY A;  1X4U A;  1K2F A;  2K16 A;  4YAB A;  3PUQ A;  1CHC A;  3NG2 A;  1BOR A;  3MHS A;  4BBQ A;  2ECG A;  2CSY A;  3O37 A;  2QJ0 A;  4XI1 A;  3EB6 A;  4L7X A;  2Y43 A;  4W4U A;  2MIQ A;  5G05 B;  1E4U A;  3ASL A;  2M6M A;  5LKX A;  3LRQ A;  2H0D B;  4UI9 B;  4MVT A;  5J3X A;  2KE1 A;  5DIN A;  2G45 A;  2JMD A;  2KWN A;  4I7C A;  1Z2Q A;  3RPG C;  1WEN A;  1HYJ A;  2L80 A;  5TDW A;  2JRJ A;  2KWJ A;  4AVX A;  4F52 B;  3T7L A;  1VYX A;  3L11 A;  5AIU A;  3M99 A;  1FBV A;  4V3K C;  2VPE A;  5TRB A;  2YHO A;  3PHD A;  5FB0 A;  3QZV A;  4A4C A;  4O64 A;  4S3O B;  1Z6U A;  2VNF A;  4UP0 A;  2MA6 A;  2YYR A;  5TAB A;  3GV4 A;  4FIP A;  4ZUX U;  2MUM A;  4NN2 A;  2UZG A;  1HYI A;  3EB5 A;  5H9M A;  3O34 A;  4B7Y C;  2M3H A;  2L43 A;  3O35 A;  2LXP C;  1WIL A;  2F42 A;  1Z60 A;  2KYU A;  4QF2 A;  2HYE D;  2F6J A;  2RI7 A;  1MM2 A;  4TKP B;  4UP5 A;  2YSJ A;  2CKL B;  1WGM A;  3HCU A;  4YBM A;  2YQM A;  4GNF A;  3M63 A;  2LN0 A;  5LKZ A;  4PTB A;  1WIM A;  4R7E A;  2ECW A;  4WZ3 B;  2KFT A;  4S3O C;  5DKA A;  4CCG X;  2ECV A;  1RMD A;  5B78 A;  4AP4 A;  2VJE A;  4FJC A;  3U5O A;  2ECI A;  4N4F A;  5LKU A;  3N9P A;  2KIZ A;  2DX8 A;  3SHB A;  1JM7 A;  4YAD A;  2M85 A;  3L1Z B;  3LQH A;  5H1V A;  1FP0 A;  2OXQ C;  1WEE A;  4ZDT A;  3ZPV E;  1X4I A;  1WEV A;  3RTR B;  2BAY A;  5D1L B;  2XB1 A;  2LRI C;  4AUQ B;  1WEQ A;  1XWH A;  2QIC A;  4AYC A;  2QIZ A;  1WFK A;  5KH9 A;  3GL6 A;  5LKT A;  2ZET C;  5FER A;  2YHN A;  4MSX A;  5TBN A;  4WZ0 A;  2LGV A;  2AN6 A;  3VK6 A;  2JMJ A;  5EYA F;  2PNX A;  4A0C D;  3ZYQ A;  3ZNI A;  5KH3 A;  4Q6F A;  3C5K A;  2L75 A;  2LGG A;  2XEU A;  2K17 A;  3ZTG A;  2FUI A;  5FB1 A;  2KGG A;  5B77 A;  2IDA A;  4ZQL A;  3KQI A;  3ZVY A;  1IYM A;  4B86 C;  1MM3 A;  2ECN A;  5C13 A;  1WEM A;  3DQV R;  4P5O B;  1F62 A;  1N87 A;  4I7B A;  2KGI A;  2VJF B;  2MD8 C;  3V43 A;  4CA1 A;  4FK5 A;  2KR4 A;  4YAX A;  1T1H A;  1VD4 A;  2E6R A;  2E6S A;  2K1J A;  2EOD A;  5D1K B;  2ECJ A;  5B76 A;  2MT5 A;  2K4D A;  2ECT A;  4YC9 A;  3N9M A;  4GNG A;  5H1U A;  4R8P K;  2VPG A;  2LGK A;  5LCW B;  3MHH A;  4X3G A;  3M62 A;  2FSA A;  5D1M B;  1X4J A;  4IC2 A;  2VJE B;  1VFY A;  4GNE A;  3O36 A;  2YRE A;  2MNZ A;  4LKA A;  2G6Q A;  2M1R A;  2MNY A;  5B8D A;  3KNV A;  1WE9 A;  2EA6 A;  2NAA A;  3O70 A;  1JM7 B;  3L1X A;  4LK9 A;  2PUY A;  4QF3 A;  3KV5 A;  5TDR A;  3U5M A;  5B79 A;  1WES A;  2FUU A;  2KU3 A;  1LDK C;  3ZPV 1;  2Y1M A;  3U5P A;  3ZVZ B;  2F6N A;  3N9Q A;  4I7D A;  3LQI A;  4R2Y A;  1U6G B;  2I50 A;  4YBS A;  2C2L A;  2LV9 A;  2VPD A;  1WEW A;  3N9N A;  2KRE A;  2LGL A;  4C9Z A;  2RSD A;  5B75 A;  1DVP A;  4A4B A;  4LJN A;  3DPL R;  5AIT A;  4LAD B;  5KH7 A;  2CT2 A;  3FL2 A;  5I3L A;  1WEU A;  2D8S A;  3SOW A;  4BHW A;  4GND A;  5H1T A;  3U5N A;  2MD7 B;  2LQ6 A;  2CSZ A;  2Y1N A;  2HDP A;  4FO9 A;  4WZ2 A;  3PUR A;  1WEO A;  1WEP A;  2H0D A;  4GB0 A;  5G04 B;  2G43 A;  4YAT A;  2KWK A;  2LXH C;  2YT5 A;  3I2D A;  4PPE A;  1LDJ B;  3IHP A;  3O7A A;  3HCT A;  4LLB A;  4L58 A;  3O33 A;  1JOC A;  3N9O A;  2JMI A;  2KWO A;  4YBT A;  3T6R A;  2MA5 A;  2YSM A;  4WA6 A;  2VPB A;  4IC3 A;  3LQJ A;  4A49 A;  2C2V S;  4V3L C;  3SOU A;  5G0F A; 
#chains in the Genus database with same CATH topology
 2YUR A;  2L5U A;  2YU4 A;  2EGP A;  3JUE A;  3LJU X;  2YW8 A;  3HCS A;  1V87 A;  3SOX A;  3FAO A;  2DJA A;  2VJF A;  3C6W A;  2IQJ A;  2KKX A;  4N3W A;  2XOC A;  2LDR A;  1G25 A;  2LAU A;  3LVQ E;  2YQL A;  2KKY A;  2L0B A;  4AYC B;  3HTK C;  2VP7 A;  3RPG B;  5JG6 A;  2XOY A;  2YUC A;  1ZBD B;  5SVI A;  2E61 A;  5C11 A;  2CKL A;  3KV6 A;  3N9L A;  5FEY A;  1X4U A;  1K2F A;  2K16 A;  4YAB A;  3PUQ A;  4Z0O A;  1CHC A;  3NG2 A;  1BOR A;  3MHS A;  4BBQ A;  2ECG A;  2CSY A;  3O37 A;  2QJ0 A;  4XI1 A;  3EB6 A;  2JM3 A;  4L7X A;  2Y43 A;  4W4U A;  2MIQ A;  5G05 B;  1E4U A;  3ASL A;  3LVR E;  2M6M A;  5LKX A;  3LRQ A;  2H0D B;  4UI9 B;  4MVT A;  5J3X A;  2KE1 A;  5DIN A;  2G45 A;  2JMD A;  2KWN A;  4I7C A;  1Z2Q A;  3RPG C;  1WEN A;  1HYJ A;  2L80 A;  5TDW A;  2JRJ A;  2KWJ A;  4AVX A;  4F52 B;  3T7L A;  1VYX A;  3L11 A;  5AIU A;  3M99 A;  1FBV A;  4V3K C;  2VPE A;  5TRB A;  2YHO A;  3FM8 C;  3DWD A;  3PHD A;  5FB0 A;  4Z0R A;  3QZV A;  4A4C A;  4F1P A;  4H9D A;  3E2D A;  4O64 A;  4S3O B;  1Z6U A;  2VNF A;  4UP0 A;  2EXU A;  2MA6 A;  2YYR A;  5TAB A;  3GV4 A;  4FIP A;  4ZUX U;  2MUM A;  4NN2 A;  2UZG A;  1HYI A;  3EB5 A;  5H9M A;  3O34 A;  4B7Y C;  2M3H A;  2P57 A;  2L43 A;  3O35 A;  2LXP C;  1WIL A;  2F42 A;  1Z60 A;  2KYU A;  4QF2 A;  2HYE D;  2F6J A;  2RI7 A;  1MM2 A;  4TKP B;  5SVI B;  4UP5 A;  2YSJ A;  2YVR A;  2CKL B;  2CRW A;  1WGM A;  3HCU A;  4YBM A;  2YQM A;  4GNF A;  3M63 A;  2LN0 A;  2DSM A;  4OGE A;  5LKZ A;  4PTB A;  3Q1D A;  1WIM A;  4R7E A;  2ECW A;  4WZ3 B;  2KFT A;  4S3O C;  5DKA A;  4CCG X;  2ECV A;  1RMD A;  5B78 A;  4AP4 A;  3FAN A;  2VJE A;  4FJC A;  3U5O A;  2ECI A;  3DDT A;  4N4F A;  5LKU A;  3N9P A;  2KIZ A;  2DX8 A;  3SHB A;  1JM7 A;  4YAD A;  2M85 A;  3L1Z B;  3LQH A;  5H1V A;  1FP0 A;  3SUB A;  2OXQ C;  1WEE A;  4ZDT A;  3ZPV E;  1X4I A;  1WEV A;  3RTR B;  2BAY A;  5D1L B;  2XB1 A;  2LRI C;  4AUQ B;  1WEQ A;  1XWH A;  2QIC A;  4AYC A;  2QIZ A;  1WFK A;  5KH9 A;  3GL6 A;  5LKT A;  2ZET C;  5FER A;  2YHN A;  4MSX A;  5TBN A;  4WZ0 A;  2LGV A;  2AN6 A;  3VK6 A;  2JMJ A;  5EYA F;  2PNX A;  4A0C D;  3H7H A;  3ZYQ A;  3ZNI A;  5KH3 A;  4Q6F A;  3C5K A;  2L75 A;  2LGG A;  2D8U A;  2XEU A;  2K17 A;  3ZTG A;  2MKE A;  3PLW A;  2FUI A;  5FB1 A;  2KGG A;  5B77 A;  2IDA A;  4ZQL A;  3KQI A;  3ZVY A;  1IYM A;  4B86 C;  1MM3 A;  2ECN A;  5C13 A;  1WEM A;  3DQV R;  4P5O B;  1F62 A;  2XOZ A;  3O47 A;  1N87 A;  4I7B A;  2KGI A;  2VJF B;  2MD8 C;  3V43 A;  4CA1 A;  4FK5 A;  2KR4 A;  4YAX A;  1T1H A;  1VD4 A;  3LDY A;  2E6R A;  2E6S A;  2K1J A;  3FEH A;  2EOD A;  5D1K B;  2ECJ A;  5B76 A;  2MT5 A;  2K4D A;  2ECT A;  4YC9 A;  3N9M A;  4GNG A;  5H1U A;  4R8P K;  2VPG A;  2FD4 A;  3MDB C;  2LGK A;  3FJU B;  5LCW B;  3MHH A;  4X3G A;  3M62 A;  5K3Q A;  2FSA A;  5D1M B;  1X4J A;  4IC2 A;  2VJE B;  4OGC A;  1VFY A;  4GNE A;  3O36 A;  2YRE A;  2MNZ A;  4LKA A;  2G6Q A;  2M1R A;  2MNY A;  5B8D A;  3KNV A;  1WE9 A;  2EA6 A;  2NAA A;  3O70 A;  1JM7 B;  3L1X A;  2RR4 A;  4LK9 A;  2EGM A;  2PUY A;  4QF3 A;  4QQ4 A;  3KV5 A;  5TDR A;  4O62 A;  2CSV A;  3U5M A;  3M7K A;  5B79 A;  1WES A;  2FUU A;  2KU3 A;  1LDK C;  3ZPV 1;  2Y1M A;  3U5P A;  3ZVZ B;  2F6N A;  3N9Q A;  4I7D A;  3LQI A;  4R2Y A;  1U6G B;  2I50 A;  4YBS A;  2C2L A;  2LV9 A;  2VPD A;  1MBM A;  1WEW A;  3N9N A;  2OWA A;  2KRE A;  2LGL A;  4C9Z A;  2RSD A;  5B75 A;  1DVP A;  2CRR A;  4A4B A;  4LJN A;  3DPL R;  5AIT A;  4LAD B;  5KH7 A;  3KDE C;  2CT2 A;  2CON A;  3FL2 A;  5SVX A;  5I3L A;  1WEU A;  2D8S A;  3SOW A;  4BHW A;  4GND A;  5H1T A;  3U5N A;  2MD7 B;  2LQ6 A;  2CSZ A;  2XP0 A;  2Y1N A;  3T9K A;  2HDP A;  4FO9 A;  4WZ2 A;  3PUR A;  1WEO A;  1WEP A;  2H0D A;  4GB0 A;  5G04 B;  2G43 A;  4YAT A;  2KWK A;  2LXH C;  2M13 A;  2YT5 A;  2JUN A;  3I2D A;  4PPE A;  1LDJ B;  3IHP A;  3O7A A;  3HCT A;  2B0O E;  4LLB A;  4L58 A;  3O33 A;  1JOC A;  3N9O A;  2JMI A;  2KWO A;  4YBT A;  3T6R A;  5SVY A;  2MA5 A;  2YSM A;  2L7P A;  4WA6 A;  2VPB A;  2FFW A;  4IC3 A;  3LQJ A;  4A49 A;  2C2V S;  4V3L C;  1DCQ A;  3SOU A;  5G0F A; 
#chains in the Genus database with same CATH homology
 2YUR A;  2L5U A;  2YU4 A;  2EGP A;  2YW8 A;  3HCS A;  1V87 A;  3SOX A;  2VJF A;  3C6W A;  4N3W A;  2LDR A;  1G25 A;  2YQL A;  2L0B A;  4AYC B;  3HTK C;  2VP7 A;  3RPG B;  5JG6 A;  2YUC A;  1ZBD B;  5C11 A;  2CKL A;  3KV6 A;  3N9L A;  5FEY A;  1X4U A;  1K2F A;  2K16 A;  4YAB A;  3PUQ A;  1CHC A;  3NG2 A;  1BOR A;  3MHS A;  4BBQ A;  2ECG A;  2CSY A;  3O37 A;  2QJ0 A;  4XI1 A;  3EB6 A;  4L7X A;  2Y43 A;  4W4U A;  2MIQ A;  5G05 B;  1E4U A;  3ASL A;  2M6M A;  5LKX A;  3LRQ A;  2H0D B;  4UI9 B;  4MVT A;  5J3X A;  2KE1 A;  5DIN A;  2G45 A;  2JMD A;  2KWN A;  4I7C A;  1Z2Q A;  3RPG C;  1WEN A;  1HYJ A;  2L80 A;  5TDW A;  2JRJ A;  2KWJ A;  4AVX A;  4F52 B;  3T7L A;  1VYX A;  3L11 A;  5AIU A;  3M99 A;  1FBV A;  4V3K C;  2VPE A;  5TRB A;  2YHO A;  3PHD A;  5FB0 A;  3QZV A;  4A4C A;  4O64 A;  4S3O B;  1Z6U A;  2VNF A;  4UP0 A;  2MA6 A;  2YYR A;  5TAB A;  3GV4 A;  4FIP A;  4ZUX U;  2MUM A;  4NN2 A;  2UZG A;  1HYI A;  3EB5 A;  5H9M A;  3O34 A;  4B7Y C;  2M3H A;  2L43 A;  3O35 A;  2LXP C;  1WIL A;  2F42 A;  1Z60 A;  2KYU A;  4QF2 A;  2HYE D;  2F6J A;  2RI7 A;  1MM2 A;  4TKP B;  4UP5 A;  2YSJ A;  2CKL B;  1WGM A;  3HCU A;  4YBM A;  2YQM A;  4GNF A;  3M63 A;  2LN0 A;  5LKZ A;  4PTB A;  1WIM A;  4R7E A;  2ECW A;  4WZ3 B;  2KFT A;  4S3O C;  5DKA A;  4CCG X;  2ECV A;  1RMD A;  5B78 A;  4AP4 A;  2VJE A;  4FJC A;  3U5O A;  2ECI A;  4N4F A;  5LKU A;  3N9P A;  2KIZ A;  2DX8 A;  3SHB A;  1JM7 A;  4YAD A;  2M85 A;  3L1Z B;  3LQH A;  5H1V A;  1FP0 A;  2OXQ C;  1WEE A;  4ZDT A;  3ZPV E;  1X4I A;  1WEV A;  3RTR B;  2BAY A;  5D1L B;  2XB1 A;  2LRI C;  4AUQ B;  1WEQ A;  1XWH A;  2QIC A;  4AYC A;  2QIZ A;  1WFK A;  5KH9 A;  3GL6 A;  5LKT A;  2ZET C;  5FER A;  2YHN A;  4MSX A;  5TBN A;  4WZ0 A;  2LGV A;  2AN6 A;  3VK6 A;  2JMJ A;  5EYA F;  2PNX A;  4A0C D;  3ZYQ A;  3ZNI A;  5KH3 A;  4Q6F A;  3C5K A;  2L75 A;  2LGG A;  2XEU A;  2K17 A;  3ZTG A;  2FUI A;  5FB1 A;  2KGG A;  5B77 A;  2IDA A;  4ZQL A;  3KQI A;  3ZVY A;  1IYM A;  4B86 C;  1MM3 A;  2ECN A;  5C13 A;  1WEM A;  3DQV R;  4P5O B;  1F62 A;  1N87 A;  4I7B A;  2KGI A;  2VJF B;  2MD8 C;  3V43 A;  4CA1 A;  4FK5 A;  2KR4 A;  4YAX A;  1T1H A;  1VD4 A;  2E6R A;  2E6S A;  2K1J A;  2EOD A;  5D1K B;  2ECJ A;  5B76 A;  2MT5 A;  2K4D A;  2ECT A;  4YC9 A;  3N9M A;  4GNG A;  5H1U A;  4R8P K;  2VPG A;  2LGK A;  5LCW B;  3MHH A;  4X3G A;  3M62 A;  2FSA A;  5D1M B;  1X4J A;  4IC2 A;  2VJE B;  1VFY A;  4GNE A;  3O36 A;  2YRE A;  2MNZ A;  4LKA A;  2G6Q A;  2M1R A;  2MNY A;  5B8D A;  3KNV A;  1WE9 A;  2EA6 A;  2NAA A;  3O70 A;  1JM7 B;  3L1X A;  4LK9 A;  2PUY A;  4QF3 A;  3KV5 A;  5TDR A;  3U5M A;  5B79 A;  1WES A;  2FUU A;  2KU3 A;  1LDK C;  3ZPV 1;  2Y1M A;  3U5P A;  3ZVZ B;  2F6N A;  3N9Q A;  4I7D A;  3LQI A;  4R2Y A;  1U6G B;  2I50 A;  4YBS A;  2C2L A;  2LV9 A;  2VPD A;  1WEW A;  3N9N A;  2KRE A;  2LGL A;  4C9Z A;  2RSD A;  5B75 A;  1DVP A;  4A4B A;  4LJN A;  3DPL R;  5AIT A;  4LAD B;  5KH7 A;  2CT2 A;  3FL2 A;  5I3L A;  1WEU A;  2D8S A;  3SOW A;  4BHW A;  4GND A;  5H1T A;  3U5N A;  2MD7 B;  2LQ6 A;  2CSZ A;  2Y1N A;  2HDP A;  4FO9 A;  4WZ2 A;  3PUR A;  1WEO A;  1WEP A;  2H0D A;  4GB0 A;  5G04 B;  2G43 A;  4YAT A;  2KWK A;  2LXH C;  2YT5 A;  3I2D A;  4PPE A;  1LDJ B;  3IHP A;  3O7A A;  3HCT A;  4LLB A;  4L58 A;  3O33 A;  1JOC A;  3N9O A;  2JMI A;  2KWO A;  4YBT A;  3T6R A;  2MA5 A;  2YSM A;  4WA6 A;  2VPB A;  4IC3 A;  3LQJ A;  4A49 A;  2C2V S;  4V3L C;  3SOU A;  5G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...