2YT5A

Solution structure of the phd domain of metal-response element-binding transcription factor 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
GSSGSSGVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal-response element-binding transcription factor 2
publication title Solution structure of the PHD domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yt5A00
3GL6A 1N87A 2F6JA 2D8SA 1ZBDB 2K16A 3L1ZB 5LCWB 2Y1NA 2VJFB 2KGIA 4YABA 1FBVA 4YBTA 1LDKC 2EGPA 2YYRA 2H0DA 2CKLB 5G0FA 2QIZA 2YW8A 5TDRA 2KWKA 2K4DA 5C13A 3EB6A 5B79A 4S3OB 2LGKA 2ECTA 2LGVA 1X4IA 5LKZA 3EB5A 2VJFA 4C9ZA 1WEUA 3O36A 2LXHC 2F6NA 5KH3A 4A49A 1WEEA 5FERA 4F52B 2YREA 4YAXA 4CCGX 2KWOA 4LK9A 1E4UA 2ZETC 2VPEA 3O34A 4WZ0A 4GNFA 4PTBA 3HCUA 5I3LA 5B76A 3LQHA 5KH9A 2QICA 3FL2A 4I7BA 4PPEA 5TBNA 5D1MB 2YQLA 3C6WA 1WESA 2YHOA 2CSYA 3M62A 2LN0A 2M3HA 3O70A 4LKAA 4BHWA 2JMDA 2RSDA 4FO9A 2YU4A 3RTRB 2RI7A 1VFYA 3HTKC 1IYMA 3O35A 5H1TA 1JOCA 3ASLA 3V43A 2MNYA 5G04B 4GNGA 2KU3A 4WZ2A 1X4UA 2KWNA 4A4CA 2F42A 2KGGA 3PURA 3L11A 2ECWA 4LADB 2AN6A 2EA6A 4L58A 2MD8C 2JRJA 5EYAF 4ZQLA 1VYXA 3KNVA 5G05B 4WZ3B 3ZVZB 4LLBA 1VD4A 3O37A 3MHHA 4R7EA 2Y1MA 1JM7B 2YURA 5TABA 4FK5A 1Z60A 3KV6A 3LRQA 2KIZA 5LKXA 5AIUA 4MVTA 2YQMA 5FB1A 1WEWA 3U5NA 4ZUXU 3ZYQA 2KYUA 4R2YA 1RMDA 2VPDA 1MM2A 3LQIA 1HYJA 4AVXA 2VPGA 1CHCA 2HDPA 3SOXA 2VNFA 2LXPC 3HCSA 3N9OA 1WGMA 4A4BA 4L7XA 4R8PK 2L80A 4Q6FA 1T1HA 4W4UA 1JM7A 4FIPA 1WE9A 2L43A 2YSMA 2CSZA 1Z6UA 4IC3A 1WEMA 2JMJA 3N9MA 2I50A 1DVPA 4XI1A 2IDAA 2HYED 2G6QA 1FP0A 2KR4A 4UP5A 2FUUA 3RPGC 4FJCA 5DKAA 5B77A 1WEVA 4V3LC 4MSXA 4B86C 2M6MA 3T7LA 4X3GA 4QF2A 3O33A 3L1XA 4N3WA 2LV9A 3M99A 1HYIA 3DPLR 2Y43A 1WIMA 2M85A 1LDJB 4BBQA 2BAYA 5LKUA 3N9QA 5JG6A 3GV4A 1WILA 2G43A 2G45A 3ZNIA 3KQIA 2PUYA 2EODA 5FB0A 3N9PA 2KWJA 3ZVYA 2LGGA 4GNEA 2JMIA 5B75A 3C5KA 2LRIC 5DINA 2E6SA 3ZTGA 2FUIA 3PHDA 3O7AA 4UI9B 4ZDTA 2MNZA 4QF3A 3KV5A 5FEYA 4B7YC 2UZGA 4P5OB 2K1JA 3U5MA 4NN2A 5H1VA 4O64A 5KH7A 5H1UA 5D1KB 2MD7B 3SOWA 5AITA 2ECJA 3SHBA 2NAAA 1U6GB 4YATA 1XWHA 3I2DA 2MT5A 4WA6A 1BORA 3DQVR 1MM3A 3U5OA 3ZPV1 2YUCA 3MHSA 4YC9A 4TKPB 3N9NA 2ECGA 3ZPVE 5J3XA 2M1RA 2VPBA 4UP0A 2VJEB 4GNDA 2YHNA 3QZVA 2E6RA 5TDWA 2MIQA 2CT2A 3HCTA 2OXQC 1V87A 3NG2A 4GB0A 2YT5A 5H9MA 2MUMA 2L5UA 1WFKA 2ECIA 3N9LA 2CKLA 3IHPA 4AP4A 2LQ6A 1F62A 2FSAA 3T6RA 4AYCB 4CA1A 5LKTA 3M63A 2KREA 5B8DA 3PUQA 1Z2QA 2VP7A 1WEQA 2MA6A 2YSJA 3VK6A 4I7DA 2QJ0A 1WEOA 5D1LB 4LJNA 2KFTA 2VJEA 4IC2A 1X4JA 2ECNA 2C2LA 2L0BA 4YBSA 4YBMA 4YADA 2C2VS 3U5PA 2DX8A 1WEPA 2H0DB 2KE1A 1G25A 1K2FA 1WENA 4A0CD 2MA5A 5TRBA 4AYCA 2LDRA 4V3KC 3RPGB 2L75A 2XB1A 5C11A 4N4FA 2XEUA 2PNXA 3SOUA 4AUQB 4I7CA 2K17A 5B78A 3LQJA 4S3OC 2LGLA 2ECVA
chains in the Genus database with same CATH superfamily
3GL6A 1N87A 2F6JA 2D8SA 1ZBDB 2K16A 3L1ZB 5LCWB 2Y1NA 2D8UA 3PLWA 2VJFB 4H9DA 2KGIA 4YABA 1FBVA 4YBTA 1LDKC 2EGPA 2YYRA 2H0DA 2CKLB 5G0FA 2QIZA 2YW8A 5TDRA 2KWKA 1DCQA 5SVIB 2K4DA 5C13A 2KKXA 3EB6A 3LJUX 2CRRA 5B79A 4S3OB 2LGKA 2ECTA 2LGVA 1X4IA 3T9KA 5LKZA 3EB5A 4Z0RA 2VJFA 4C9ZA 1WEUA 3O36A 2LXHC 2F6NA 5KH3A 4A49A 1WEEA 5FERA 4F52B 2YREA 4YAXA 4CCGX 3LVRE 2KWOA 5SVIA 4LK9A 1E4UA 4O62A 2ZETC 2VPEA 3O34A 4WZ0A 5K3QA 4GNFA 4PTBA 3HCUA 5I3LA 1MBMA 3FEHA 3FJUB 5B76A 3LQHA 5KH9A 2QICA 3MDBC 3FL2A 3JUEA 4I7BA 2KKYA 4PPEA 5TBNA 5D1MB 2YQLA 3C6WA 2IQJA 1WESA 2YHOA 2CSYA 3FANA 2MKEA 3M62A 2LN0A 2M3HA 3O70A 4LKAA 4BHWA 2JMDA 2RSDA 4FO9A 2YU4A 3RTRB 2RI7A 2XP0A 1VFYA 3HTKC 1IYMA 2XOZA 3O35A 4OGCA 5H1TA 1JOCA 3FM8C 3ASLA 3V43A 2MNYA 5G04B 4GNGA 2KU3A 4WZ2A 1X4UA 2KWNA 4A4CA 2F42A 2KGGA 3PURA 3L11A 2ECWA 4LADB 4Z0OA 2AN6A 2EA6A 4L58A 2MD8C 2JRJA 5EYAF 4ZQLA 2B0OE 1VYXA 3KNVA 5G05B 4WZ3B 3ZVZB 4LLBA 1VD4A 3O47A 3O37A 2DJAA 3MHHA 4R7EA 2Y1MA 1JM7B 2YURA 5TABA 4FK5A 1Z60A 3KV6A 3LRQA 2KIZA 5LKXA 5AIUA 4MVTA 2YQMA 3E2DA 5FB1A 1WEWA 3U5NA 4ZUXU 3ZYQA 2CSVA 2KYUA 3SUBA 3LDYA 4R2YA 1RMDA 2VPDA 1MM2A 3LQIA 2EGMA 1HYJA 4AVXA 2VPGA 1CHCA 2HDPA 3SOXA 2VNFA 2LXPC 3HCSA 3N9OA 1WGMA 4A4BA 4L7XA 4R8PK 2L80A 4Q6FA 1T1HA 4W4UA 1JM7A 4FIPA 1WE9A 2L43A 2YSMA 2CSZA 1Z6UA 4QQ4A 4IC3A 1WEMA 2JMJA 3N9MA 2I50A 1DVPA 4XI1A 2IDAA 2HYED 2DSMA 2G6QA 1FP0A 2KR4A 4UP5A 5SVXA 2FUUA 3RPGC 4FJCA 5DKAA 5B77A 1WEVA 4V3LC 4MSXA 4B86C 2M6MA 3T7LA 4X3GA 4QF2A 3O33A 3L1XA 4N3WA 2LV9A 2XOCA 3M99A 1HYIA 3DPLR 2Y43A 1WIMA 2M85A 1LDJB 4BBQA 2BAYA 5LKUA 3DDTA 3N9QA 5JG6A 3GV4A 1WILA 2G43A 2G45A 3ZNIA 2LAUA 3KQIA 2L7PA 2PUYA 2CONA 2E61A 2EODA 5FB0A 3N9PA 2KWJA 2FD4A 3ZVYA 2LGGA 4GNEA 2JMIA 5B75A 3C5KA 2LRIC 3FAOA 2FFWA 5DINA 2RR4A 2E6SA 3ZTGA 2FUIA 3PHDA 3O7AA 4UI9B 4ZDTA 2MNZA 4QF3A 3H7HA 3KV5A 5FEYA 4B7YC 2UZGA 4P5OB 2K1JA 3U5MA 4NN2A 3Q1DA 5H1VA 4O64A 5KH7A 5H1UA 5D1KB 2MD7B 3SOWA 5AITA 2ECJA 3SHBA 4OGEA 2NAAA 3KDEC 2M13A 1U6GB 4YATA 1XWHA 3I2DA 5SVYA 2MT5A 4WA6A 1BORA 3DQVR 2CRWA 1MM3A 3U5OA 3ZPV1 2YUCA 3MHSA 4YC9A 4TKPB 3DWDA 2ECGA 3N9NA 3ZPVE 5J3XA 2M1RA 2VPBA 4UP0A 2VJEB 4GNDA 2YHNA 3QZVA 2E6RA 5TDWA 2MIQA 2CT2A 3HCTA 2OXQC 1V87A 3NG2A 4GB0A 2YT5A 5H9MA 2MUMA 2L5UA 1WFKA 2ECIA 3N9LA 2CKLA 2JUNA 2P57A 3IHPA 4AP4A 2LQ6A 1F62A 2FSAA 3T6RA 4AYCB 4CA1A 5LKTA 3M63A 2KREA 5B8DA 3PUQA 1Z2QA 2VP7A 1WEQA 2MA6A 2YSJA 2YVRA 3VK6A 3M7KA 4I7DA 2QJ0A 1WEOA 5D1LB 4LJNA 4F1PA 2KFTA 2VJEA 4IC2A 1X4JA 2ECNA 2C2LA 2EXUA 2L0BA 4YBSA 2JM3A 4YBMA 4YADA 2C2VS 3U5PA 2DX8A 1WEPA 2H0DB 2KE1A 1G25A 1K2FA 1WENA 3LVQE 4A0CD 2XOYA 2MA5A 5TRBA 4AYCA 2LDRA 4V3KC 3RPGB 2L75A 2XB1A 5C11A 2OWAA 4N4FA 2XEUA 2PNXA 3SOUA 4AUQB 4I7CA 2K17A 5B78A 3LQJA 4S3OC 2LGLA 2ECVA
chains in the Genus database with same CATH topology
3GL6A 1N87A 2F6JA 2D8SA 1ZBDB 2K16A 3L1ZB 5LCWB 2Y1NA 2VJFB 2KGIA 4YABA 1FBVA 4YBTA 1LDKC 2EGPA 2YYRA 2H0DA 2CKLB 5G0FA 2QIZA 2YW8A 5TDRA 2KWKA 2K4DA 5C13A 3EB6A 5B79A 4S3OB 2LGKA 2ECTA 2LGVA 1X4IA 5LKZA 3EB5A 2VJFA 4C9ZA 1WEUA 3O36A 2LXHC 2F6NA 5KH3A 4A49A 1WEEA 5FERA 4F52B 2YREA 4YAXA 4CCGX 2KWOA 4LK9A 1E4UA 2ZETC 2VPEA 3O34A 4WZ0A 4GNFA 4PTBA 3HCUA 5I3LA 5B76A 3LQHA 5KH9A 2QICA 3FL2A 4I7BA 4PPEA 5TBNA 5D1MB 2YQLA 3C6WA 1WESA 2YHOA 2CSYA 3M62A 2LN0A 2M3HA 3O70A 4LKAA 4BHWA 2JMDA 2RSDA 4FO9A 2YU4A 3RTRB 2RI7A 1VFYA 3HTKC 1IYMA 3O35A 5H1TA 1JOCA 3ASLA 3V43A 2MNYA 5G04B 4GNGA 2KU3A 4WZ2A 1X4UA 2KWNA 4A4CA 2F42A 2KGGA 3PURA 3L11A 2ECWA 4LADB 2AN6A 2EA6A 4L58A 2MD8C 2JRJA 5EYAF 4ZQLA 1VYXA 3KNVA 5G05B 4WZ3B 3ZVZB 4LLBA 1VD4A 3O37A 3MHHA 4R7EA 2Y1MA 1JM7B 2YURA 5TABA 4FK5A 1Z60A 3KV6A 3LRQA 2KIZA 5LKXA 5AIUA 4MVTA 2YQMA 5FB1A 1WEWA 3U5NA 4ZUXU 3ZYQA 2KYUA 4R2YA 1RMDA 2VPDA 1MM2A 3LQIA 1HYJA 4AVXA 2VPGA 1CHCA 2HDPA 3SOXA 2VNFA 2LXPC 3HCSA 3N9OA 1WGMA 4A4BA 4L7XA 4R8PK 2L80A 4Q6FA 1T1HA 4W4UA 1JM7A 4FIPA 1WE9A 2L43A 2YSMA 2CSZA 1Z6UA 4IC3A 1WEMA 2JMJA 3N9MA 2I50A 1DVPA 4XI1A 2IDAA 2HYED 2G6QA 1FP0A 2KR4A 4UP5A 2FUUA 3RPGC 4FJCA 5DKAA 5B77A 1WEVA 4V3LC 4MSXA 4B86C 2M6MA 3T7LA 4X3GA 4QF2A 3O33A 3L1XA 4N3WA 2LV9A 3M99A 1HYIA 3DPLR 2Y43A 1WIMA 2M85A 1LDJB 4BBQA 2BAYA 5LKUA 3N9QA 5JG6A 3GV4A 1WILA 2G43A 2G45A 3ZNIA 3KQIA 2PUYA 2EODA 5FB0A 3N9PA 2KWJA 3ZVYA 2LGGA 4GNEA 2JMIA 5B75A 3C5KA 2LRIC 5DINA 2E6SA 3ZTGA 2FUIA 3PHDA 3O7AA 4UI9B 4ZDTA 2MNZA 4QF3A 3KV5A 5FEYA 4B7YC 2UZGA 4P5OB 2K1JA 3U5MA 4NN2A 5H1VA 4O64A 5KH7A 5H1UA 5D1KB 2MD7B 3SOWA 5AITA 2ECJA 3SHBA 2NAAA 1U6GB 4YATA 1XWHA 3I2DA 2MT5A 4WA6A 1BORA 3DQVR 1MM3A 3U5OA 3ZPV1 2YUCA 3MHSA 4YC9A 4TKPB 3N9NA 2ECGA 3ZPVE 5J3XA 2M1RA 2VPBA 4UP0A 2VJEB 4GNDA 2YHNA 3QZVA 2E6RA 5TDWA 2MIQA 2CT2A 3HCTA 2OXQC 1V87A 3NG2A 4GB0A 2YT5A 5H9MA 2MUMA 2L5UA 1WFKA 2ECIA 3N9LA 2CKLA 3IHPA 4AP4A 2LQ6A 1F62A 2FSAA 3T6RA 4AYCB 4CA1A 5LKTA 3M63A 2KREA 5B8DA 3PUQA 1Z2QA 2VP7A 1WEQA 2MA6A 2YSJA 3VK6A 4I7DA 2QJ0A 1WEOA 5D1LB 4LJNA 2KFTA 2VJEA 4IC2A 1X4JA 2ECNA 2C2LA 2L0BA 4YBSA 4YBMA 4YADA 2C2VS 3U5PA 2DX8A 1WEPA 2H0DB 2KE1A 1G25A 1K2FA 1WENA 4A0CD 2MA5A 5TRBA 4AYCA 2LDRA 4V3KC 3RPGB 2L75A 2XB1A 5C11A 4N4FA 2XEUA 2PNXA 3SOUA 4AUQB 4I7CA 2K17A 5B78A 3LQJA 4S3OC 2LGLA 2ECVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL6 A;  1N87 A;  2F6J A;  2D8S A;  1ZBD B;  2K16 A;  3L1Z B;  5LCW B;  2Y1N A;  2VJF B;  2KGI A;  4YAB A;  1FBV A;  4YBT A;  1LDK C;  2EGP A;  2YYR A;  2H0D A;  2CKL B;  5G0F A;  2QIZ A;  2YW8 A;  5TDR A;  2KWK A;  2K4D A;  5C13 A;  3EB6 A;  5B79 A;  4S3O B;  2LGK A;  2ECT A;  2LGV A;  1X4I A;  5LKZ A;  3EB5 A;  2VJF A;  4C9Z A;  1WEU A;  3O36 A;  2LXH C;  2F6N A;  5KH3 A;  4A49 A;  1WEE A;  5FER A;  4F52 B;  2YRE A;  4YAX A;  4CCG X;  2KWO A;  4LK9 A;  1E4U A;  2ZET C;  2VPE A;  3O34 A;  4WZ0 A;  4GNF A;  4PTB A;  3HCU A;  5I3L A;  5B76 A;  3LQH A;  5KH9 A;  2QIC A;  3FL2 A;  4I7B A;  4PPE A;  5TBN A;  5D1M B;  2YQL A;  3C6W A;  1WES A;  2YHO A;  2CSY A;  3M62 A;  2LN0 A;  2M3H A;  3O70 A;  4LKA A;  4BHW A;  2JMD A;  2RSD A;  4FO9 A;  2YU4 A;  3RTR B;  2RI7 A;  1VFY A;  3HTK C;  1IYM A;  3O35 A;  5H1T A;  1JOC A;  3ASL A;  3V43 A;  2MNY A;  5G04 B;  4GNG A;  2KU3 A;  4WZ2 A;  1X4U A;  2KWN A;  4A4C A;  2F42 A;  2KGG A;  3PUR A;  3L11 A;  2ECW A;  4LAD B;  2AN6 A;  2EA6 A;  4L58 A;  2MD8 C;  2JRJ A;  5EYA F;  4ZQL A;  1VYX A;  3KNV A;  5G05 B;  4WZ3 B;  3ZVZ B;  4LLB A;  1VD4 A;  3O37 A;  3MHH A;  4R7E A;  2Y1M A;  1JM7 B;  2YUR A;  5TAB A;  4FK5 A;  1Z60 A;  3KV6 A;  3LRQ A;  2KIZ A;  5LKX A;  5AIU A;  4MVT A;  2YQM A;  5FB1 A;  1WEW A;  3U5N A;  4ZUX U;  3ZYQ A;  2KYU A;  4R2Y A;  1RMD A;  2VPD A;  1MM2 A;  3LQI A;  1HYJ A;  4AVX A;  2VPG A;  1CHC A;  2HDP A;  3SOX A;  2VNF A;  2LXP C;  3HCS A;  3N9O A;  1WGM A;  4A4B A;  4L7X A;  4R8P K;  2L80 A;  4Q6F A;  1T1H A;  4W4U A;  1JM7 A;  4FIP A;  1WE9 A;  2L43 A;  2YSM A;  2CSZ A;  1Z6U A;  4IC3 A;  1WEM A;  2JMJ A;  3N9M A;  2I50 A;  1DVP A;  4XI1 A;  2IDA A;  2HYE D;  2G6Q A;  1FP0 A;  2KR4 A;  4UP5 A;  2FUU A;  3RPG C;  4FJC A;  5DKA A;  5B77 A;  1WEV A;  4V3L C;  4MSX A;  4B86 C;  2M6M A;  3T7L A;  4X3G A;  4QF2 A;  3O33 A;  3L1X A;  4N3W A;  2LV9 A;  3M99 A;  1HYI A;  3DPL R;  2Y43 A;  1WIM A;  2M85 A;  1LDJ B;  4BBQ A;  2BAY A;  5LKU A;  3N9Q A;  5JG6 A;  3GV4 A;  1WIL A;  2G43 A;  2G45 A;  3ZNI A;  3KQI A;  2PUY A;  2EOD A;  5FB0 A;  3N9P A;  2KWJ A;  3ZVY A;  2LGG A;  4GNE A;  2JMI A;  5B75 A;  3C5K A;  2LRI C;  5DIN A;  2E6S A;  3ZTG A;  2FUI A;  3PHD A;  3O7A A;  4UI9 B;  4ZDT A;  2MNZ A;  4QF3 A;  3KV5 A;  5FEY A;  4B7Y C;  2UZG A;  4P5O B;  2K1J A;  3U5M A;  4NN2 A;  5H1V A;  4O64 A;  5KH7 A;  5H1U A;  5D1K B;  2MD7 B;  3SOW A;  5AIT A;  2ECJ A;  3SHB A;  2NAA A;  1U6G B;  4YAT A;  1XWH A;  3I2D A;  2MT5 A;  4WA6 A;  1BOR A;  3DQV R;  1MM3 A;  3U5O A;  3ZPV 1;  2YUC A;  3MHS A;  4YC9 A;  4TKP B;  3N9N A;  2ECG A;  3ZPV E;  5J3X A;  2M1R A;  2VPB A;  4UP0 A;  2VJE B;  4GND A;  2YHN A;  3QZV A;  2E6R A;  5TDW A;  2MIQ A;  2CT2 A;  3HCT A;  2OXQ C;  1V87 A;  3NG2 A;  4GB0 A;  2YT5 A;  5H9M A;  2MUM A;  2L5U A;  1WFK A;  2ECI A;  3N9L A;  2CKL A;  3IHP A;  4AP4 A;  2LQ6 A;  1F62 A;  2FSA A;  3T6R A;  4AYC B;  4CA1 A;  5LKT A;  3M63 A;  2KRE A;  5B8D A;  3PUQ A;  1Z2Q A;  2VP7 A;  1WEQ A;  2MA6 A;  2YSJ A;  3VK6 A;  4I7D A;  2QJ0 A;  1WEO A;  5D1L B;  4LJN A;  2KFT A;  2VJE A;  4IC2 A;  1X4J A;  2ECN A;  2C2L A;  2L0B A;  4YBS A;  4YBM A;  4YAD A;  2C2V S;  3U5P A;  2DX8 A;  1WEP A;  2H0D B;  2KE1 A;  1G25 A;  1K2F A;  1WEN A;  4A0C D;  2MA5 A;  5TRB A;  4AYC A;  2LDR A;  4V3K C;  3RPG B;  2L75 A;  2XB1 A;  5C11 A;  4N4F A;  2XEU A;  2PNX A;  3SOU A;  4AUQ B;  4I7C A;  2K17 A;  5B78 A;  3LQJ A;  4S3O C;  2LGL A;  2ECV A; 
#chains in the Genus database with same CATH topology
 3GL6 A;  1N87 A;  2F6J A;  2D8S A;  1ZBD B;  2K16 A;  3L1Z B;  5LCW B;  2Y1N A;  2D8U A;  3PLW A;  2VJF B;  4H9D A;  2KGI A;  4YAB A;  1FBV A;  4YBT A;  1LDK C;  2EGP A;  2YYR A;  2H0D A;  2CKL B;  5G0F A;  2QIZ A;  2YW8 A;  5TDR A;  2KWK A;  1DCQ A;  5SVI B;  2K4D A;  5C13 A;  2KKX A;  3EB6 A;  3LJU X;  2CRR A;  5B79 A;  4S3O B;  2LGK A;  2ECT A;  2LGV A;  1X4I A;  3T9K A;  5LKZ A;  3EB5 A;  4Z0R A;  2VJF A;  4C9Z A;  1WEU A;  3O36 A;  2LXH C;  2F6N A;  5KH3 A;  4A49 A;  1WEE A;  5FER A;  4F52 B;  2YRE A;  4YAX A;  4CCG X;  3LVR E;  2KWO A;  5SVI A;  4LK9 A;  1E4U A;  4O62 A;  2ZET C;  2VPE A;  3O34 A;  4WZ0 A;  5K3Q A;  4GNF A;  4PTB A;  3HCU A;  5I3L A;  1MBM A;  3FEH A;  3FJU B;  5B76 A;  3LQH A;  5KH9 A;  2QIC A;  3MDB C;  3FL2 A;  3JUE A;  4I7B A;  2KKY A;  4PPE A;  5TBN A;  5D1M B;  2YQL A;  3C6W A;  2IQJ A;  1WES A;  2YHO A;  2CSY A;  3FAN A;  2MKE A;  3M62 A;  2LN0 A;  2M3H A;  3O70 A;  4LKA A;  4BHW A;  2JMD A;  2RSD A;  4FO9 A;  2YU4 A;  3RTR B;  2RI7 A;  2XP0 A;  1VFY A;  3HTK C;  1IYM A;  2XOZ A;  3O35 A;  4OGC A;  5H1T A;  1JOC A;  3FM8 C;  3ASL A;  3V43 A;  2MNY A;  5G04 B;  4GNG A;  2KU3 A;  4WZ2 A;  1X4U A;  2KWN A;  4A4C A;  2F42 A;  2KGG A;  3PUR A;  3L11 A;  2ECW A;  4LAD B;  4Z0O A;  2AN6 A;  2EA6 A;  4L58 A;  2MD8 C;  2JRJ A;  5EYA F;  4ZQL A;  2B0O E;  1VYX A;  3KNV A;  5G05 B;  4WZ3 B;  3ZVZ B;  4LLB A;  1VD4 A;  3O47 A;  3O37 A;  2DJA A;  3MHH A;  4R7E A;  2Y1M A;  1JM7 B;  2YUR A;  5TAB A;  4FK5 A;  1Z60 A;  3KV6 A;  3LRQ A;  2KIZ A;  5LKX A;  5AIU A;  4MVT A;  2YQM A;  3E2D A;  5FB1 A;  1WEW A;  3U5N A;  4ZUX U;  3ZYQ A;  2CSV A;  2KYU A;  3SUB A;  3LDY A;  4R2Y A;  1RMD A;  2VPD A;  1MM2 A;  3LQI A;  2EGM A;  1HYJ A;  4AVX A;  2VPG A;  1CHC A;  2HDP A;  3SOX A;  2VNF A;  2LXP C;  3HCS A;  3N9O A;  1WGM A;  4A4B A;  4L7X A;  4R8P K;  2L80 A;  4Q6F A;  1T1H A;  4W4U A;  1JM7 A;  4FIP A;  1WE9 A;  2L43 A;  2YSM A;  2CSZ A;  1Z6U A;  4QQ4 A;  4IC3 A;  1WEM A;  2JMJ A;  3N9M A;  2I50 A;  1DVP A;  4XI1 A;  2IDA A;  2HYE D;  2DSM A;  2G6Q A;  1FP0 A;  2KR4 A;  4UP5 A;  5SVX A;  2FUU A;  3RPG C;  4FJC A;  5DKA A;  5B77 A;  1WEV A;  4V3L C;  4MSX A;  4B86 C;  2M6M A;  3T7L A;  4X3G A;  4QF2 A;  3O33 A;  3L1X A;  4N3W A;  2LV9 A;  2XOC A;  3M99 A;  1HYI A;  3DPL R;  2Y43 A;  1WIM A;  2M85 A;  1LDJ B;  4BBQ A;  2BAY A;  5LKU A;  3DDT A;  3N9Q A;  5JG6 A;  3GV4 A;  1WIL A;  2G43 A;  2G45 A;  3ZNI A;  2LAU A;  3KQI A;  2L7P A;  2PUY A;  2CON A;  2E61 A;  2EOD A;  5FB0 A;  3N9P A;  2KWJ A;  2FD4 A;  3ZVY A;  2LGG A;  4GNE A;  2JMI A;  5B75 A;  3C5K A;  2LRI C;  3FAO A;  2FFW A;  5DIN A;  2RR4 A;  2E6S A;  3ZTG A;  2FUI A;  3PHD A;  3O7A A;  4UI9 B;  4ZDT A;  2MNZ A;  4QF3 A;  3H7H A;  3KV5 A;  5FEY A;  4B7Y C;  2UZG A;  4P5O B;  2K1J A;  3U5M A;  4NN2 A;  3Q1D A;  5H1V A;  4O64 A;  5KH7 A;  5H1U A;  5D1K B;  2MD7 B;  3SOW A;  5AIT A;  2ECJ A;  3SHB A;  4OGE A;  2NAA A;  3KDE C;  2M13 A;  1U6G B;  4YAT A;  1XWH A;  3I2D A;  5SVY A;  2MT5 A;  4WA6 A;  1BOR A;  3DQV R;  2CRW A;  1MM3 A;  3U5O A;  3ZPV 1;  2YUC A;  3MHS A;  4YC9 A;  4TKP B;  3DWD A;  2ECG A;  3N9N A;  3ZPV E;  5J3X A;  2M1R A;  2VPB A;  4UP0 A;  2VJE B;  4GND A;  2YHN A;  3QZV A;  2E6R A;  5TDW A;  2MIQ A;  2CT2 A;  3HCT A;  2OXQ C;  1V87 A;  3NG2 A;  4GB0 A;  2YT5 A;  5H9M A;  2MUM A;  2L5U A;  1WFK A;  2ECI A;  3N9L A;  2CKL A;  2JUN A;  2P57 A;  3IHP A;  4AP4 A;  2LQ6 A;  1F62 A;  2FSA A;  3T6R A;  4AYC B;  4CA1 A;  5LKT A;  3M63 A;  2KRE A;  5B8D A;  3PUQ A;  1Z2Q A;  2VP7 A;  1WEQ A;  2MA6 A;  2YSJ A;  2YVR A;  3VK6 A;  3M7K A;  4I7D A;  2QJ0 A;  1WEO A;  5D1L B;  4LJN A;  4F1P A;  2KFT A;  2VJE A;  4IC2 A;  1X4J A;  2ECN A;  2C2L A;  2EXU A;  2L0B A;  4YBS A;  2JM3 A;  4YBM A;  4YAD A;  2C2V S;  3U5P A;  2DX8 A;  1WEP A;  2H0D B;  2KE1 A;  1G25 A;  1K2F A;  1WEN A;  3LVQ E;  4A0C D;  2XOY A;  2MA5 A;  5TRB A;  4AYC A;  2LDR A;  4V3K C;  3RPG B;  2L75 A;  2XB1 A;  5C11 A;  2OWA A;  4N4F A;  2XEU A;  2PNX A;  3SOU A;  4AUQ B;  4I7C A;  2K17 A;  5B78 A;  3LQJ A;  4S3O C;  2LGL A;  2ECV A; 
#chains in the Genus database with same CATH homology
 3GL6 A;  1N87 A;  2F6J A;  2D8S A;  1ZBD B;  2K16 A;  3L1Z B;  5LCW B;  2Y1N A;  2VJF B;  2KGI A;  4YAB A;  1FBV A;  4YBT A;  1LDK C;  2EGP A;  2YYR A;  2H0D A;  2CKL B;  5G0F A;  2QIZ A;  2YW8 A;  5TDR A;  2KWK A;  2K4D A;  5C13 A;  3EB6 A;  5B79 A;  4S3O B;  2LGK A;  2ECT A;  2LGV A;  1X4I A;  5LKZ A;  3EB5 A;  2VJF A;  4C9Z A;  1WEU A;  3O36 A;  2LXH C;  2F6N A;  5KH3 A;  4A49 A;  1WEE A;  5FER A;  4F52 B;  2YRE A;  4YAX A;  4CCG X;  2KWO A;  4LK9 A;  1E4U A;  2ZET C;  2VPE A;  3O34 A;  4WZ0 A;  4GNF A;  4PTB A;  3HCU A;  5I3L A;  5B76 A;  3LQH A;  5KH9 A;  2QIC A;  3FL2 A;  4I7B A;  4PPE A;  5TBN A;  5D1M B;  2YQL A;  3C6W A;  1WES A;  2YHO A;  2CSY A;  3M62 A;  2LN0 A;  2M3H A;  3O70 A;  4LKA A;  4BHW A;  2JMD A;  2RSD A;  4FO9 A;  2YU4 A;  3RTR B;  2RI7 A;  1VFY A;  3HTK C;  1IYM A;  3O35 A;  5H1T A;  1JOC A;  3ASL A;  3V43 A;  2MNY A;  5G04 B;  4GNG A;  2KU3 A;  4WZ2 A;  1X4U A;  2KWN A;  4A4C A;  2F42 A;  2KGG A;  3PUR A;  3L11 A;  2ECW A;  4LAD B;  2AN6 A;  2EA6 A;  4L58 A;  2MD8 C;  2JRJ A;  5EYA F;  4ZQL A;  1VYX A;  3KNV A;  5G05 B;  4WZ3 B;  3ZVZ B;  4LLB A;  1VD4 A;  3O37 A;  3MHH A;  4R7E A;  2Y1M A;  1JM7 B;  2YUR A;  5TAB A;  4FK5 A;  1Z60 A;  3KV6 A;  3LRQ A;  2KIZ A;  5LKX A;  5AIU A;  4MVT A;  2YQM A;  5FB1 A;  1WEW A;  3U5N A;  4ZUX U;  3ZYQ A;  2KYU A;  4R2Y A;  1RMD A;  2VPD A;  1MM2 A;  3LQI A;  1HYJ A;  4AVX A;  2VPG A;  1CHC A;  2HDP A;  3SOX A;  2VNF A;  2LXP C;  3HCS A;  3N9O A;  1WGM A;  4A4B A;  4L7X A;  4R8P K;  2L80 A;  4Q6F A;  1T1H A;  4W4U A;  1JM7 A;  4FIP A;  1WE9 A;  2L43 A;  2YSM A;  2CSZ A;  1Z6U A;  4IC3 A;  1WEM A;  2JMJ A;  3N9M A;  2I50 A;  1DVP A;  4XI1 A;  2IDA A;  2HYE D;  2G6Q A;  1FP0 A;  2KR4 A;  4UP5 A;  2FUU A;  3RPG C;  4FJC A;  5DKA A;  5B77 A;  1WEV A;  4V3L C;  4MSX A;  4B86 C;  2M6M A;  3T7L A;  4X3G A;  4QF2 A;  3O33 A;  3L1X A;  4N3W A;  2LV9 A;  3M99 A;  1HYI A;  3DPL R;  2Y43 A;  1WIM A;  2M85 A;  1LDJ B;  4BBQ A;  2BAY A;  5LKU A;  3N9Q A;  5JG6 A;  3GV4 A;  1WIL A;  2G43 A;  2G45 A;  3ZNI A;  3KQI A;  2PUY A;  2EOD A;  5FB0 A;  3N9P A;  2KWJ A;  3ZVY A;  2LGG A;  4GNE A;  2JMI A;  5B75 A;  3C5K A;  2LRI C;  5DIN A;  2E6S A;  3ZTG A;  2FUI A;  3PHD A;  3O7A A;  4UI9 B;  4ZDT A;  2MNZ A;  4QF3 A;  3KV5 A;  5FEY A;  4B7Y C;  2UZG A;  4P5O B;  2K1J A;  3U5M A;  4NN2 A;  5H1V A;  4O64 A;  5KH7 A;  5H1U A;  5D1K B;  2MD7 B;  3SOW A;  5AIT A;  2ECJ A;  3SHB A;  2NAA A;  1U6G B;  4YAT A;  1XWH A;  3I2D A;  2MT5 A;  4WA6 A;  1BOR A;  3DQV R;  1MM3 A;  3U5O A;  3ZPV 1;  2YUC A;  3MHS A;  4YC9 A;  4TKP B;  3N9N A;  2ECG A;  3ZPV E;  5J3X A;  2M1R A;  2VPB A;  4UP0 A;  2VJE B;  4GND A;  2YHN A;  3QZV A;  2E6R A;  5TDW A;  2MIQ A;  2CT2 A;  3HCT A;  2OXQ C;  1V87 A;  3NG2 A;  4GB0 A;  2YT5 A;  5H9M A;  2MUM A;  2L5U A;  1WFK A;  2ECI A;  3N9L A;  2CKL A;  3IHP A;  4AP4 A;  2LQ6 A;  1F62 A;  2FSA A;  3T6R A;  4AYC B;  4CA1 A;  5LKT A;  3M63 A;  2KRE A;  5B8D A;  3PUQ A;  1Z2Q A;  2VP7 A;  1WEQ A;  2MA6 A;  2YSJ A;  3VK6 A;  4I7D A;  2QJ0 A;  1WEO A;  5D1L B;  4LJN A;  2KFT A;  2VJE A;  4IC2 A;  1X4J A;  2ECN A;  2C2L A;  2L0B A;  4YBS A;  4YBM A;  4YAD A;  2C2V S;  3U5P A;  2DX8 A;  1WEP A;  2H0D B;  2KE1 A;  1G25 A;  1K2F A;  1WEN A;  4A0C D;  2MA5 A;  5TRB A;  4AYC A;  2LDR A;  4V3K C;  3RPG B;  2L75 A;  2XB1 A;  5C11 A;  4N4F A;  2XEU A;  2PNX A;  3SOU A;  4AUQ B;  4I7C A;  2K17 A;  5B78 A;  3LQJ A;  4S3O C;  2LGL A;  2ECV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...