5I3LA

Dpf3b in complex with h3k14ac peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
VIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Zinc finger protein DPF3
publication title Crystal structure of DPF3b in complex with an acetylated histone peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5i3lA00
1X4UA 5G04B 1WESA 2YREA 5D1LB 3O70A 2L5UA 3RPGC 3PUQA 2ECTA 5J3XA 2BAYA 1DVPA 3EB6A 2FSAA 4WZ0A 5I3LA 4V3KC 2VJFA 2IDAA 2Y1NA 1T1HA 2KWNA 1VD4A 2JMIA 3FL2A 3O7AA 2H0DA 5DINA 5G05B 1WEVA 2LGVA 2LDRA 4N3WA 4L58A 4R8PK 2KR4A 2K1JA 4WA6A 2VJEA 3GV4A 3N9LA 2Y43A 2UZGA 1WEEA 5B78A 2YQLA 4YAXA 4GNEA 1N87A 3HCTA 3O36A 2G43A 4MSXA 2KE1A 2KFTA 4YADA 3T7LA 4A4BA 3DPLR 3NG2A 4MVTA 3IHPA 2VPBA 1LDKC 1F62A 1MM2A 3LQHA 1FP0A 2ECWA 3VK6A 3KQIA 2MA5A 2LGKA 1MM3A 3L11A 3V43A 1U6GB 2JRJA 2MNYA 2CT2A 2CSZA 3MHHA 2VPEA 2C2VS 2MT5A 3N9MA 2QJ0A 4AUQB 1X4IA 3U5MA 3O34A 2ECVA 2LGLA 2L0BA 5JG6A 4BBQA 5AITA 1LDJB 3M63A 2K16A 1BORA 2FUIA 2FUUA 5LKUA 4CA1A 3N9OA 1G25A 4ZQLA 3SOWA 4O64A 2JMJA 1WEQA 2KWJA 4YBSA 2I50A 2YU4A 3GL6A 5TRBA 3HCUA 2CKLA 4UP5A 4S3OB 3ZPVE 4CCGX 2KGGA 1WEPA 2L43A 4BHWA 2KWKA 2QICA 3PURA 2PUYA 5G0FA 3ZPV1 4AVXA 2K17A 1WIMA 4WZ2A 4YATA 4QF2A 1JOCA 2YSMA 2ZETC 1Z6UA 4LADB 2YSJA 2LQ6A 5FB1A 4P5OB 2MIQA 4LK9A 4C9ZA 5DKAA 5LKXA 3O35A 4N4FA 4QF3A 2F6NA 4B86C 4I7BA 1K2FA 3O37A 2NAAA 3ZVYA 2Y1MA 3KV5A 5FB0A 2OXQC 2LXPC 2DX8A 2G6QA 3O33A 4AYCA 4YABA 2KYUA 2M85A 2VJEB 4YBTA 2L75A 2LV9A 4R7EA 3EB5A 2ECJA 3C6WA 3N9PA 4A4CA 1FBVA 4FJCA 5LCWB 2F6JA 3QZVA 3U5PA 1CHCA 2VPDA 3N9NA 1XWHA 4GNFA 3HTKC 3SHBA 5KH7A 1JM7B 3SOXA 2XEUA 2LN0A 2C2LA 2ECGA 1Z2QA 4NN2A 2EODA 5B76A 4PPEA 3ZTGA 3U5OA 1Z60A 3I2DA 1E4UA 4ZDTA 2K4DA 4YBMA 2YT5A 2MUMA 2RI7A 1VYXA 4XI1A 5B75A 4A0CD 2EA6A 5B79A 4LJNA 5TABA 4ZUXU 4GNGA 2YQMA 3ZVZB 5AIUA 1ZBDB 2F42A 1WE9A 5LKZA 2YUCA 1WILA 5H1TA 3M62A 2KGIA 4IC3A 4IC2A 3LQJA 3L1ZB 5LKTA 4TKPB 3DQVR 2YW8A 3N9QA 2M3HA 2LGGA 5EYAF 1WFKA 2D8SA 2M6MA 5H1UA 1WEWA 2AN6A 2PNXA 1IYMA 2QIZA 2KREA 4B7YC 2MD7B 1X4JA 2ECNA 1V87A 4GNDA 2CKLB 3HCSA 3ZYQA 5D1KB 4GB0A 3MHSA 3KNVA 2LRIC 3L1XA 2VJFB 3KV6A 2LXHC 1WENA 2H0DB 4LKAA 3U5NA 5H1VA 2L80A 3ASLA 3RTRB 4LLBA 5TBNA 5TDRA 2VP7A 4AP4A 2CSYA 2RSDA 2KIZA 4F52B 3PHDA 1HYJA 4S3OC 5KH9A 2KWOA 1RMDA 5KH3A 5FERA 2VPGA 5B8DA 2YHOA 4AYCB 2XB1A 4UP0A 3ZNIA 1JM7A 2YURA 2HDPA 3M99A 4R2YA 2MNZA 5TDWA 4FK5A 3RPGB 1WEOA 4FIPA 4YC9A 5B77A 1VFYA 4L7XA 4UI9B 4X3GA 5FEYA 2KU3A 1WGMA 4FO9A 4PTBA 2M1RA 3LQIA 2ECIA 2MA6A 2E6RA 2JMDA 3LRQA 4I7CA 2VNFA 2E6SA 4W4UA 4V3LC 2EGPA 4Q6FA 5H9MA 2MD8C 1WEMA 2G45A 5D1MB 3C5KA 3T6RA 2YYRA 5C11A 4I7DA 4A49A 1WEUA 4WZ3B 1HYIA 2YHNA 3SOUA 2HYED 5C13A
chains in the Genus database with same CATH superfamily
1X4UA 5G04B 1WESA 2YREA 5D1LB 3O70A 2L5UA 3RPGC 3PUQA 2ECTA 5J3XA 3E2DA 2BAYA 1DVPA 3EB6A 2FSAA 4WZ0A 5I3LA 4V3KC 2VJFA 2IDAA 2JM3A 1T1HA 2KWNA 2Y1NA 1VD4A 2JMIA 3FL2A 3O7AA 2H0DA 5DINA 5G05B 2L7PA 1WEVA 2LGVA 2LDRA 4N3WA 2YVRA 4L58A 4R8PK 2KR4A 4F1PA 2K1JA 4WA6A 2VJEA 3GV4A 3N9LA 2Y43A 2UZGA 1WEEA 2CRRA 5B78A 2YQLA 2XOCA 4YAXA 4GNEA 1N87A 3HCTA 3O36A 2G43A 4MSXA 2KE1A 2KFTA 4YADA 3T7LA 4A4BA 3DPLR 3NG2A 4MVTA 3IHPA 2VPBA 1LDKC 2EXUA 1F62A 3M7KA 5K3QA 1MM2A 3T9KA 3LQHA 3LJUX 1FP0A 2ECWA 3VK6A 3KQIA 3FAOA 2MA5A 2LGKA 1MM3A 2IQJA 3L11A 3V43A 1U6GB 5SVIB 2JRJA 2MNYA 3O47A 2DSMA 3FANA 2CT2A 2CSZA 2XOYA 2CONA 3MHHA 2VPEA 2KKXA 2C2VS 2MT5A 2DJAA 3N9MA 2QJ0A 2CRWA 4AUQB 1X4IA 3FJUB 3U5MA 3O34A 2ECVA 2LGLA 2L0BA 3FEHA 5JG6A 5SVYA 4BBQA 2FFWA 5AITA 1LDJB 3M63A 2K16A 2P57A 1BORA 2FUIA 3JUEA 2FUUA 3H7HA 5LKUA 4CA1A 3N9OA 1G25A 4ZQLA 3SOWA 4O64A 2JMJA 1WEQA 2KWJA 4YBSA 2I50A 2YU4A 3GL6A 5TRBA 3HCUA 2CSVA 2CKLA 2FD4A 4UP5A 2LAUA 4S3OB 3ZPVE 4CCGX 2KGGA 2RR4A 1WEPA 4OGCA 2L43A 4BHWA 2KWKA 2QICA 2XOZA 3PURA 2PUYA 5G0FA 3LVRE 3ZPV1 4AVXA 2K17A 1WIMA 4WZ2A 4O62A 4YATA 4QF2A 1JOCA 2YSMA 2ZETC 4Z0OA 1Z6UA 4LADB 2YSJA 2LQ6A 5FB1A 4P5OB 2MIQA 4LK9A 4C9ZA 5DKAA 5LKXA 3O35A 4N4FA 4QF3A 2F6NA 4B86C 4I7BA 1K2FA 2B0OE 3O37A 2NAAA 3ZVYA 2Y1MA 3KV5A 5FB0A 2OXQC 2LXPC 2DX8A 2G6QA 3LVQE 3O33A 4AYCA 4YABA 2KYUA 2M85A 1MBMA 2VJEB 4YBTA 2L75A 2LV9A 4R7EA 3EB5A 2ECJA 3C6WA 3N9PA 4A4CA 1FBVA 4FJCA 5LCWB 2F6JA 3QZVA 3U5PA 1CHCA 2VPDA 3N9NA 4OGEA 2XP0A 1XWHA 4GNFA 3HTKC 3SHBA 5KH7A 1JM7B 3SOXA 2XEUA 2LN0A 3LDYA 2C2LA 2ECGA 1Z2QA 4NN2A 3PLWA 2EODA 5B76A 4PPEA 3ZTGA 3U5OA 1Z60A 3I2DA 1E4UA 4ZDTA 2K4DA 4YBMA 2YT5A 2MUMA 2RI7A 1VYXA 2EGMA 4XI1A 5B75A 4A0CD 2EA6A 5B79A 4LJNA 5TABA 4ZUXU 4GNGA 2YQMA 3ZVZB 5AIUA 1ZBDB 2F42A 1WE9A 2KKYA 5LKZA 2YUCA 1WILA 5H1TA 3M62A 2KGIA 2JUNA 3SUBA 4IC3A 4IC2A 3LQJA 3L1ZB 4H9DA 5LKTA 4TKPB 3DQVR 2YW8A 3N9QA 2M3HA 2LGGA 5EYAF 1WFKA 2D8SA 2M6MA 5H1UA 4QQ4A 1WEWA 2AN6A 2PNXA 1IYMA 2QIZA 3KDEC 2D8UA 2KREA 4B7YC 2MD7B 1X4JA 2ECNA 1V87A 4GNDA 2MKEA 2CKLB 3HCSA 3ZYQA 4Z0RA 5D1KB 4GB0A 3MHSA 3KNVA 2LRIC 3L1XA 2VJFB 3KV6A 2LXHC 1WENA 2H0DB 4LKAA 3U5NA 5H1VA 2L80A 3ASLA 3RTRB 4LLBA 5TBNA 5TDRA 2VP7A 3DDTA 2E61A 4AP4A 2CSYA 2RSDA 5SVXA 1DCQA 2KIZA 4F52B 3PHDA 1HYJA 4S3OC 5KH9A 2KWOA 1RMDA 5KH3A 5FERA 2VPGA 5SVIA 5B8DA 2YHOA 4AYCB 2XB1A 4UP0A 3ZNIA 1JM7A 2YURA 2HDPA 3M99A 4R2YA 2MNZA 5TDWA 3MDBC 4FK5A 3RPGB 1WEOA 4FIPA 4YC9A 5B77A 3FM8C 1VFYA 4L7XA 4UI9B 2M13A 4X3GA 5FEYA 2KU3A 1WGMA 4FO9A 4PTBA 3Q1DA 2M1RA 3LQIA 2ECIA 2MA6A 2E6RA 2OWAA 2JMDA 3LRQA 4I7CA 2VNFA 2E6SA 4W4UA 4V3LC 2EGPA 4Q6FA 5H9MA 2MD8C 1WEMA 2G45A 5D1MB 3C5KA 3T6RA 2YYRA 5C11A 4I7DA 4A49A 1WEUA 3DWDA 4WZ3B 1HYIA 2YHNA 3SOUA 2HYED 5C13A
chains in the Genus database with same CATH topology
1X4UA 5G04B 1WESA 2YREA 5D1LB 3O70A 2L5UA 3RPGC 3PUQA 2ECTA 5J3XA 2BAYA 1DVPA 3EB6A 2FSAA 4WZ0A 5I3LA 4V3KC 2VJFA 2IDAA 2Y1NA 1T1HA 2KWNA 1VD4A 2JMIA 3FL2A 3O7AA 2H0DA 5DINA 5G05B 1WEVA 2LGVA 2LDRA 4N3WA 4L58A 4R8PK 2KR4A 2K1JA 4WA6A 2VJEA 3GV4A 3N9LA 2Y43A 2UZGA 1WEEA 5B78A 2YQLA 4YAXA 4GNEA 1N87A 3HCTA 3O36A 2G43A 4MSXA 2KE1A 2KFTA 4YADA 3T7LA 4A4BA 3DPLR 3NG2A 4MVTA 3IHPA 2VPBA 1LDKC 1F62A 1MM2A 3LQHA 1FP0A 2ECWA 3VK6A 3KQIA 2MA5A 2LGKA 1MM3A 3L11A 3V43A 1U6GB 2JRJA 2MNYA 2CT2A 2CSZA 3MHHA 2VPEA 2C2VS 2MT5A 3N9MA 2QJ0A 4AUQB 1X4IA 3U5MA 3O34A 2ECVA 2LGLA 2L0BA 5JG6A 4BBQA 5AITA 1LDJB 3M63A 2K16A 1BORA 2FUIA 2FUUA 5LKUA 4CA1A 3N9OA 1G25A 4ZQLA 3SOWA 4O64A 2JMJA 1WEQA 2KWJA 4YBSA 2I50A 2YU4A 3GL6A 5TRBA 3HCUA 2CKLA 4UP5A 4S3OB 3ZPVE 4CCGX 2KGGA 1WEPA 2L43A 4BHWA 2KWKA 2QICA 3PURA 2PUYA 5G0FA 3ZPV1 4AVXA 2K17A 1WIMA 4WZ2A 4YATA 4QF2A 1JOCA 2YSMA 2ZETC 1Z6UA 4LADB 2YSJA 2LQ6A 5FB1A 4P5OB 2MIQA 4LK9A 4C9ZA 5DKAA 5LKXA 3O35A 4N4FA 4QF3A 2F6NA 4B86C 4I7BA 1K2FA 3O37A 2NAAA 3ZVYA 2Y1MA 3KV5A 5FB0A 2OXQC 2LXPC 2DX8A 2G6QA 3O33A 4AYCA 4YABA 2KYUA 2M85A 2VJEB 4YBTA 2L75A 2LV9A 4R7EA 3EB5A 2ECJA 3C6WA 3N9PA 4A4CA 1FBVA 4FJCA 5LCWB 2F6JA 3QZVA 3U5PA 1CHCA 2VPDA 3N9NA 1XWHA 4GNFA 3HTKC 3SHBA 5KH7A 1JM7B 3SOXA 2XEUA 2LN0A 2C2LA 2ECGA 1Z2QA 4NN2A 2EODA 5B76A 4PPEA 3ZTGA 3U5OA 1Z60A 3I2DA 1E4UA 4ZDTA 2K4DA 4YBMA 2YT5A 2MUMA 2RI7A 1VYXA 4XI1A 5B75A 4A0CD 2EA6A 5B79A 4LJNA 5TABA 4ZUXU 4GNGA 2YQMA 3ZVZB 5AIUA 1ZBDB 2F42A 1WE9A 5LKZA 2YUCA 1WILA 5H1TA 3M62A 2KGIA 4IC3A 4IC2A 3LQJA 3L1ZB 5LKTA 4TKPB 3DQVR 2YW8A 3N9QA 2M3HA 2LGGA 5EYAF 1WFKA 2D8SA 2M6MA 5H1UA 1WEWA 2AN6A 2PNXA 1IYMA 2QIZA 2KREA 4B7YC 2MD7B 1X4JA 2ECNA 1V87A 4GNDA 2CKLB 3HCSA 3ZYQA 5D1KB 4GB0A 3MHSA 3KNVA 2LRIC 3L1XA 2VJFB 3KV6A 2LXHC 1WENA 2H0DB 4LKAA 3U5NA 5H1VA 2L80A 3ASLA 3RTRB 4LLBA 5TBNA 5TDRA 2VP7A 4AP4A 2CSYA 2RSDA 2KIZA 4F52B 3PHDA 1HYJA 4S3OC 5KH9A 2KWOA 1RMDA 5KH3A 5FERA 2VPGA 5B8DA 2YHOA 4AYCB 2XB1A 4UP0A 3ZNIA 1JM7A 2YURA 2HDPA 3M99A 4R2YA 2MNZA 5TDWA 4FK5A 3RPGB 1WEOA 4FIPA 4YC9A 5B77A 1VFYA 4L7XA 4UI9B 4X3GA 5FEYA 2KU3A 1WGMA 4FO9A 4PTBA 2M1RA 3LQIA 2ECIA 2MA6A 2E6RA 2JMDA 3LRQA 4I7CA 2VNFA 2E6SA 4W4UA 4V3LC 2EGPA 4Q6FA 5H9MA 2MD8C 1WEMA 2G45A 5D1MB 3C5KA 3T6RA 2YYRA 5C11A 4I7DA 4A49A 1WEUA 4WZ3B 1HYIA 2YHNA 3SOUA 2HYED 5C13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4U A;  5G04 B;  1WES A;  2YRE A;  5D1L B;  3O70 A;  2L5U A;  3RPG C;  3PUQ A;  2ECT A;  5J3X A;  2BAY A;  1DVP A;  3EB6 A;  2FSA A;  4WZ0 A;  5I3L A;  4V3K C;  2VJF A;  2IDA A;  2Y1N A;  1T1H A;  2KWN A;  1VD4 A;  2JMI A;  3FL2 A;  3O7A A;  2H0D A;  5DIN A;  5G05 B;  1WEV A;  2LGV A;  2LDR A;  4N3W A;  4L58 A;  4R8P K;  2KR4 A;  2K1J A;  4WA6 A;  2VJE A;  3GV4 A;  3N9L A;  2Y43 A;  2UZG A;  1WEE A;  5B78 A;  2YQL A;  4YAX A;  4GNE A;  1N87 A;  3HCT A;  3O36 A;  2G43 A;  4MSX A;  2KE1 A;  2KFT A;  4YAD A;  3T7L A;  4A4B A;  3DPL R;  3NG2 A;  4MVT A;  3IHP A;  2VPB A;  1LDK C;  1F62 A;  1MM2 A;  3LQH A;  1FP0 A;  2ECW A;  3VK6 A;  3KQI A;  2MA5 A;  2LGK A;  1MM3 A;  3L11 A;  3V43 A;  1U6G B;  2JRJ A;  2MNY A;  2CT2 A;  2CSZ A;  3MHH A;  2VPE A;  2C2V S;  2MT5 A;  3N9M A;  2QJ0 A;  4AUQ B;  1X4I A;  3U5M A;  3O34 A;  2ECV A;  2LGL A;  2L0B A;  5JG6 A;  4BBQ A;  5AIT A;  1LDJ B;  3M63 A;  2K16 A;  1BOR A;  2FUI A;  2FUU A;  5LKU A;  4CA1 A;  3N9O A;  1G25 A;  4ZQL A;  3SOW A;  4O64 A;  2JMJ A;  1WEQ A;  2KWJ A;  4YBS A;  2I50 A;  2YU4 A;  3GL6 A;  5TRB A;  3HCU A;  2CKL A;  4UP5 A;  4S3O B;  3ZPV E;  4CCG X;  2KGG A;  1WEP A;  2L43 A;  4BHW A;  2KWK A;  2QIC A;  3PUR A;  2PUY A;  5G0F A;  3ZPV 1;  4AVX A;  2K17 A;  1WIM A;  4WZ2 A;  4YAT A;  4QF2 A;  1JOC A;  2YSM A;  2ZET C;  1Z6U A;  4LAD B;  2YSJ A;  2LQ6 A;  5FB1 A;  4P5O B;  2MIQ A;  4LK9 A;  4C9Z A;  5DKA A;  5LKX A;  3O35 A;  4N4F A;  4QF3 A;  2F6N A;  4B86 C;  4I7B A;  1K2F A;  3O37 A;  2NAA A;  3ZVY A;  2Y1M A;  3KV5 A;  5FB0 A;  2OXQ C;  2LXP C;  2DX8 A;  2G6Q A;  3O33 A;  4AYC A;  4YAB A;  2KYU A;  2M85 A;  2VJE B;  4YBT A;  2L75 A;  2LV9 A;  4R7E A;  3EB5 A;  2ECJ A;  3C6W A;  3N9P A;  4A4C A;  1FBV A;  4FJC A;  5LCW B;  2F6J A;  3QZV A;  3U5P A;  1CHC A;  2VPD A;  3N9N A;  1XWH A;  4GNF A;  3HTK C;  3SHB A;  5KH7 A;  1JM7 B;  3SOX A;  2XEU A;  2LN0 A;  2C2L A;  2ECG A;  1Z2Q A;  4NN2 A;  2EOD A;  5B76 A;  4PPE A;  3ZTG A;  3U5O A;  1Z60 A;  3I2D A;  1E4U A;  4ZDT A;  2K4D A;  4YBM A;  2YT5 A;  2MUM A;  2RI7 A;  1VYX A;  4XI1 A;  5B75 A;  4A0C D;  2EA6 A;  5B79 A;  4LJN A;  5TAB A;  4ZUX U;  4GNG A;  2YQM A;  3ZVZ B;  5AIU A;  1ZBD B;  2F42 A;  1WE9 A;  5LKZ A;  2YUC A;  1WIL A;  5H1T A;  3M62 A;  2KGI A;  4IC3 A;  4IC2 A;  3LQJ A;  3L1Z B;  5LKT A;  4TKP B;  3DQV R;  2YW8 A;  3N9Q A;  2M3H A;  2LGG A;  5EYA F;  1WFK A;  2D8S A;  2M6M A;  5H1U A;  1WEW A;  2AN6 A;  2PNX A;  1IYM A;  2QIZ A;  2KRE A;  4B7Y C;  2MD7 B;  1X4J A;  2ECN A;  1V87 A;  4GND A;  2CKL B;  3HCS A;  3ZYQ A;  5D1K B;  4GB0 A;  3MHS A;  3KNV A;  2LRI C;  3L1X A;  2VJF B;  3KV6 A;  2LXH C;  1WEN A;  2H0D B;  4LKA A;  3U5N A;  5H1V A;  2L80 A;  3ASL A;  3RTR B;  4LLB A;  5TBN A;  5TDR A;  2VP7 A;  4AP4 A;  2CSY A;  2RSD A;  2KIZ A;  4F52 B;  3PHD A;  1HYJ A;  4S3O C;  5KH9 A;  2KWO A;  1RMD A;  5KH3 A;  5FER A;  2VPG A;  5B8D A;  2YHO A;  4AYC B;  2XB1 A;  4UP0 A;  3ZNI A;  1JM7 A;  2YUR A;  2HDP A;  3M99 A;  4R2Y A;  2MNZ A;  5TDW A;  4FK5 A;  3RPG B;  1WEO A;  4FIP A;  4YC9 A;  5B77 A;  1VFY A;  4L7X A;  4UI9 B;  4X3G A;  5FEY A;  2KU3 A;  1WGM A;  4FO9 A;  4PTB A;  2M1R A;  3LQI A;  2ECI A;  2MA6 A;  2E6R A;  2JMD A;  3LRQ A;  4I7C A;  2VNF A;  2E6S A;  4W4U A;  4V3L C;  2EGP A;  4Q6F A;  5H9M A;  2MD8 C;  1WEM A;  2G45 A;  5D1M B;  3C5K A;  3T6R A;  2YYR A;  5C11 A;  4I7D A;  4A49 A;  1WEU A;  4WZ3 B;  1HYI A;  2YHN A;  3SOU A;  2HYE D;  5C13 A; 
#chains in the Genus database with same CATH topology
 1X4U A;  5G04 B;  1WES A;  2YRE A;  5D1L B;  3O70 A;  2L5U A;  3RPG C;  3PUQ A;  2ECT A;  5J3X A;  3E2D A;  2BAY A;  1DVP A;  3EB6 A;  2FSA A;  4WZ0 A;  5I3L A;  4V3K C;  2VJF A;  2IDA A;  2JM3 A;  1T1H A;  2KWN A;  2Y1N A;  1VD4 A;  2JMI A;  3FL2 A;  3O7A A;  2H0D A;  5DIN A;  5G05 B;  2L7P A;  1WEV A;  2LGV A;  2LDR A;  4N3W A;  2YVR A;  4L58 A;  4R8P K;  2KR4 A;  4F1P A;  2K1J A;  4WA6 A;  2VJE A;  3GV4 A;  3N9L A;  2Y43 A;  2UZG A;  1WEE A;  2CRR A;  5B78 A;  2YQL A;  2XOC A;  4YAX A;  4GNE A;  1N87 A;  3HCT A;  3O36 A;  2G43 A;  4MSX A;  2KE1 A;  2KFT A;  4YAD A;  3T7L A;  4A4B A;  3DPL R;  3NG2 A;  4MVT A;  3IHP A;  2VPB A;  1LDK C;  2EXU A;  1F62 A;  3M7K A;  5K3Q A;  1MM2 A;  3T9K A;  3LQH A;  3LJU X;  1FP0 A;  2ECW A;  3VK6 A;  3KQI A;  3FAO A;  2MA5 A;  2LGK A;  1MM3 A;  2IQJ A;  3L11 A;  3V43 A;  1U6G B;  5SVI B;  2JRJ A;  2MNY A;  3O47 A;  2DSM A;  3FAN A;  2CT2 A;  2CSZ A;  2XOY A;  2CON A;  3MHH A;  2VPE A;  2KKX A;  2C2V S;  2MT5 A;  2DJA A;  3N9M A;  2QJ0 A;  2CRW A;  4AUQ B;  1X4I A;  3FJU B;  3U5M A;  3O34 A;  2ECV A;  2LGL A;  2L0B A;  3FEH A;  5JG6 A;  5SVY A;  4BBQ A;  2FFW A;  5AIT A;  1LDJ B;  3M63 A;  2K16 A;  2P57 A;  1BOR A;  2FUI A;  3JUE A;  2FUU A;  3H7H A;  5LKU A;  4CA1 A;  3N9O A;  1G25 A;  4ZQL A;  3SOW A;  4O64 A;  2JMJ A;  1WEQ A;  2KWJ A;  4YBS A;  2I50 A;  2YU4 A;  3GL6 A;  5TRB A;  3HCU A;  2CSV A;  2CKL A;  2FD4 A;  4UP5 A;  2LAU A;  4S3O B;  3ZPV E;  4CCG X;  2KGG A;  2RR4 A;  1WEP A;  4OGC A;  2L43 A;  4BHW A;  2KWK A;  2QIC A;  2XOZ A;  3PUR A;  2PUY A;  5G0F A;  3LVR E;  3ZPV 1;  4AVX A;  2K17 A;  1WIM A;  4WZ2 A;  4O62 A;  4YAT A;  4QF2 A;  1JOC A;  2YSM A;  2ZET C;  4Z0O A;  1Z6U A;  4LAD B;  2YSJ A;  2LQ6 A;  5FB1 A;  4P5O B;  2MIQ A;  4LK9 A;  4C9Z A;  5DKA A;  5LKX A;  3O35 A;  4N4F A;  4QF3 A;  2F6N A;  4B86 C;  4I7B A;  1K2F A;  2B0O E;  3O37 A;  2NAA A;  3ZVY A;  2Y1M A;  3KV5 A;  5FB0 A;  2OXQ C;  2LXP C;  2DX8 A;  2G6Q A;  3LVQ E;  3O33 A;  4AYC A;  4YAB A;  2KYU A;  2M85 A;  1MBM A;  2VJE B;  4YBT A;  2L75 A;  2LV9 A;  4R7E A;  3EB5 A;  2ECJ A;  3C6W A;  3N9P A;  4A4C A;  1FBV A;  4FJC A;  5LCW B;  2F6J A;  3QZV A;  3U5P A;  1CHC A;  2VPD A;  3N9N A;  4OGE A;  2XP0 A;  1XWH A;  4GNF A;  3HTK C;  3SHB A;  5KH7 A;  1JM7 B;  3SOX A;  2XEU A;  2LN0 A;  3LDY A;  2C2L A;  2ECG A;  1Z2Q A;  4NN2 A;  3PLW A;  2EOD A;  5B76 A;  4PPE A;  3ZTG A;  3U5O A;  1Z60 A;  3I2D A;  1E4U A;  4ZDT A;  2K4D A;  4YBM A;  2YT5 A;  2MUM A;  2RI7 A;  1VYX A;  2EGM A;  4XI1 A;  5B75 A;  4A0C D;  2EA6 A;  5B79 A;  4LJN A;  5TAB A;  4ZUX U;  4GNG A;  2YQM A;  3ZVZ B;  5AIU A;  1ZBD B;  2F42 A;  1WE9 A;  2KKY A;  5LKZ A;  2YUC A;  1WIL A;  5H1T A;  3M62 A;  2KGI A;  2JUN A;  3SUB A;  4IC3 A;  4IC2 A;  3LQJ A;  3L1Z B;  4H9D A;  5LKT A;  4TKP B;  3DQV R;  2YW8 A;  3N9Q A;  2M3H A;  2LGG A;  5EYA F;  1WFK A;  2D8S A;  2M6M A;  5H1U A;  4QQ4 A;  1WEW A;  2AN6 A;  2PNX A;  1IYM A;  2QIZ A;  3KDE C;  2D8U A;  2KRE A;  4B7Y C;  2MD7 B;  1X4J A;  2ECN A;  1V87 A;  4GND A;  2MKE A;  2CKL B;  3HCS A;  3ZYQ A;  4Z0R A;  5D1K B;  4GB0 A;  3MHS A;  3KNV A;  2LRI C;  3L1X A;  2VJF B;  3KV6 A;  2LXH C;  1WEN A;  2H0D B;  4LKA A;  3U5N A;  5H1V A;  2L80 A;  3ASL A;  3RTR B;  4LLB A;  5TBN A;  5TDR A;  2VP7 A;  3DDT A;  2E61 A;  4AP4 A;  2CSY A;  2RSD A;  5SVX A;  1DCQ A;  2KIZ A;  4F52 B;  3PHD A;  1HYJ A;  4S3O C;  5KH9 A;  2KWO A;  1RMD A;  5KH3 A;  5FER A;  2VPG A;  5SVI A;  5B8D A;  2YHO A;  4AYC B;  2XB1 A;  4UP0 A;  3ZNI A;  1JM7 A;  2YUR A;  2HDP A;  3M99 A;  4R2Y A;  2MNZ A;  5TDW A;  3MDB C;  4FK5 A;  3RPG B;  1WEO A;  4FIP A;  4YC9 A;  5B77 A;  3FM8 C;  1VFY A;  4L7X A;  4UI9 B;  2M13 A;  4X3G A;  5FEY A;  2KU3 A;  1WGM A;  4FO9 A;  4PTB A;  3Q1D A;  2M1R A;  3LQI A;  2ECI A;  2MA6 A;  2E6R A;  2OWA A;  2JMD A;  3LRQ A;  4I7C A;  2VNF A;  2E6S A;  4W4U A;  4V3L C;  2EGP A;  4Q6F A;  5H9M A;  2MD8 C;  1WEM A;  2G45 A;  5D1M B;  3C5K A;  3T6R A;  2YYR A;  5C11 A;  4I7D A;  4A49 A;  1WEU A;  3DWD A;  4WZ3 B;  1HYI A;  2YHN A;  3SOU A;  2HYE D;  5C13 A; 
#chains in the Genus database with same CATH homology
 1X4U A;  5G04 B;  1WES A;  2YRE A;  5D1L B;  3O70 A;  2L5U A;  3RPG C;  3PUQ A;  2ECT A;  5J3X A;  2BAY A;  1DVP A;  3EB6 A;  2FSA A;  4WZ0 A;  5I3L A;  4V3K C;  2VJF A;  2IDA A;  2Y1N A;  1T1H A;  2KWN A;  1VD4 A;  2JMI A;  3FL2 A;  3O7A A;  2H0D A;  5DIN A;  5G05 B;  1WEV A;  2LGV A;  2LDR A;  4N3W A;  4L58 A;  4R8P K;  2KR4 A;  2K1J A;  4WA6 A;  2VJE A;  3GV4 A;  3N9L A;  2Y43 A;  2UZG A;  1WEE A;  5B78 A;  2YQL A;  4YAX A;  4GNE A;  1N87 A;  3HCT A;  3O36 A;  2G43 A;  4MSX A;  2KE1 A;  2KFT A;  4YAD A;  3T7L A;  4A4B A;  3DPL R;  3NG2 A;  4MVT A;  3IHP A;  2VPB A;  1LDK C;  1F62 A;  1MM2 A;  3LQH A;  1FP0 A;  2ECW A;  3VK6 A;  3KQI A;  2MA5 A;  2LGK A;  1MM3 A;  3L11 A;  3V43 A;  1U6G B;  2JRJ A;  2MNY A;  2CT2 A;  2CSZ A;  3MHH A;  2VPE A;  2C2V S;  2MT5 A;  3N9M A;  2QJ0 A;  4AUQ B;  1X4I A;  3U5M A;  3O34 A;  2ECV A;  2LGL A;  2L0B A;  5JG6 A;  4BBQ A;  5AIT A;  1LDJ B;  3M63 A;  2K16 A;  1BOR A;  2FUI A;  2FUU A;  5LKU A;  4CA1 A;  3N9O A;  1G25 A;  4ZQL A;  3SOW A;  4O64 A;  2JMJ A;  1WEQ A;  2KWJ A;  4YBS A;  2I50 A;  2YU4 A;  3GL6 A;  5TRB A;  3HCU A;  2CKL A;  4UP5 A;  4S3O B;  3ZPV E;  4CCG X;  2KGG A;  1WEP A;  2L43 A;  4BHW A;  2KWK A;  2QIC A;  3PUR A;  2PUY A;  5G0F A;  3ZPV 1;  4AVX A;  2K17 A;  1WIM A;  4WZ2 A;  4YAT A;  4QF2 A;  1JOC A;  2YSM A;  2ZET C;  1Z6U A;  4LAD B;  2YSJ A;  2LQ6 A;  5FB1 A;  4P5O B;  2MIQ A;  4LK9 A;  4C9Z A;  5DKA A;  5LKX A;  3O35 A;  4N4F A;  4QF3 A;  2F6N A;  4B86 C;  4I7B A;  1K2F A;  3O37 A;  2NAA A;  3ZVY A;  2Y1M A;  3KV5 A;  5FB0 A;  2OXQ C;  2LXP C;  2DX8 A;  2G6Q A;  3O33 A;  4AYC A;  4YAB A;  2KYU A;  2M85 A;  2VJE B;  4YBT A;  2L75 A;  2LV9 A;  4R7E A;  3EB5 A;  2ECJ A;  3C6W A;  3N9P A;  4A4C A;  1FBV A;  4FJC A;  5LCW B;  2F6J A;  3QZV A;  3U5P A;  1CHC A;  2VPD A;  3N9N A;  1XWH A;  4GNF A;  3HTK C;  3SHB A;  5KH7 A;  1JM7 B;  3SOX A;  2XEU A;  2LN0 A;  2C2L A;  2ECG A;  1Z2Q A;  4NN2 A;  2EOD A;  5B76 A;  4PPE A;  3ZTG A;  3U5O A;  1Z60 A;  3I2D A;  1E4U A;  4ZDT A;  2K4D A;  4YBM A;  2YT5 A;  2MUM A;  2RI7 A;  1VYX A;  4XI1 A;  5B75 A;  4A0C D;  2EA6 A;  5B79 A;  4LJN A;  5TAB A;  4ZUX U;  4GNG A;  2YQM A;  3ZVZ B;  5AIU A;  1ZBD B;  2F42 A;  1WE9 A;  5LKZ A;  2YUC A;  1WIL A;  5H1T A;  3M62 A;  2KGI A;  4IC3 A;  4IC2 A;  3LQJ A;  3L1Z B;  5LKT A;  4TKP B;  3DQV R;  2YW8 A;  3N9Q A;  2M3H A;  2LGG A;  5EYA F;  1WFK A;  2D8S A;  2M6M A;  5H1U A;  1WEW A;  2AN6 A;  2PNX A;  1IYM A;  2QIZ A;  2KRE A;  4B7Y C;  2MD7 B;  1X4J A;  2ECN A;  1V87 A;  4GND A;  2CKL B;  3HCS A;  3ZYQ A;  5D1K B;  4GB0 A;  3MHS A;  3KNV A;  2LRI C;  3L1X A;  2VJF B;  3KV6 A;  2LXH C;  1WEN A;  2H0D B;  4LKA A;  3U5N A;  5H1V A;  2L80 A;  3ASL A;  3RTR B;  4LLB A;  5TBN A;  5TDR A;  2VP7 A;  4AP4 A;  2CSY A;  2RSD A;  2KIZ A;  4F52 B;  3PHD A;  1HYJ A;  4S3O C;  5KH9 A;  2KWO A;  1RMD A;  5KH3 A;  5FER A;  2VPG A;  5B8D A;  2YHO A;  4AYC B;  2XB1 A;  4UP0 A;  3ZNI A;  1JM7 A;  2YUR A;  2HDP A;  3M99 A;  4R2Y A;  2MNZ A;  5TDW A;  4FK5 A;  3RPG B;  1WEO A;  4FIP A;  4YC9 A;  5B77 A;  1VFY A;  4L7X A;  4UI9 B;  4X3G A;  5FEY A;  2KU3 A;  1WGM A;  4FO9 A;  4PTB A;  2M1R A;  3LQI A;  2ECI A;  2MA6 A;  2E6R A;  2JMD A;  3LRQ A;  4I7C A;  2VNF A;  2E6S A;  4W4U A;  4V3L C;  2EGP A;  4Q6F A;  5H9M A;  2MD8 C;  1WEM A;  2G45 A;  5D1M B;  3C5K A;  3T6R A;  2YYR A;  5C11 A;  4I7D A;  4A49 A;  1WEU A;  4WZ3 B;  1HYI A;  2YHN A;  3SOU A;  2HYE D;  5C13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...