5I3LA

Dpf3b in complex with h3k14ac peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
VIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of DPF3b in complex with an acetylated histone peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Zinc finger protein DPF3
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5i3lA00
4BHWA 5KH3A 3MHSA 4AP4A 2E6SA 2VJEA 2MA6A 2LQ6A 4A49A 4I7DA 4ZUXU 1WEMA 3FL2A 3O35A 1WENA 4LADB 2ECGA 4N3WA 2LXPC 2YREA 3DQVR 2K16A 2ECNA 2JMDA 3LQJA 4FJCA 2L80A 4L58A 2YHNA 3RPGC 5TABA 4UI9B 4PPEA 2LDRA 2K17A 4YAXA 4YADA 2K1JA 2I50A 2KFTA 3GV4A 4GB0A 5C13A 4FO9A 4UP5A 2K4DA 2RSDA 5JG6A 2LGKA 4S3OB 5KH7A 2M1RA 1WEVA 3V43A 2LGVA 5TDRA 1WEOA 3U5MA 2G45A 2KWKA 4X3GA 3N9MA 2XB1A 3VK6A 4WA6A 3DPLR 4P5OB 1WILA 4XI1A 2LGGA 4UP0A 2LN0A 1WIMA 2YT5A 5I3LA 2KE1A 5H1UA 4L7XA 3M63A 3ASLA 4GNGA 4BBQA 2IDAA 3EB6A 2UZGA 2ECIA 5FERA 1U6GB 3MHHA 3N9PA 5TDWA 3I2DA 5LKZA 4MVTA 2EGPA 3N9NA 2Y1MA 5TRBA 3EB5A 2MD8C 4WZ0A 4V3KC 2YU4A 2L5UA 2CSYA 2BAYA 4B86C 2VNFA 3KNVA 4LKAA 3M62A 2JRJA 4PTBA 3O33A 4O64A 1F62A 1WEPA 2F6NA 3GL6A 1HYJA 2PUYA 2HYED 4F52B 2KIZA 3QZVA 4AVXA 1WFKA 2HDPA 4ZDTA 5DKAA 4Q6FA 2D8SA 2C2VS 2VJEB 2CSZA 1G25A 2H0DB 3LQHA 2L0BA 2OXQC 2Y43A 4YBMA 1JM7B 1MM3A 2MIQA 3L1XA 3C5KA 4IC3A 3C6WA 2AN6A 3SOXA 2JMJA 2VPBA 2QJ0A 2H0DA 4TKPB 1FBVA 2VPDA 3ZPV1 2VJFB 2CT2A 3HCSA 3N9OA 4YBSA 5LKXA 3KV5A 4C9ZA 4QF2A 1MM2A 4W4UA 1WEWA 1T1HA 2M85A 1WESA 2YQLA 2Y1NA 4FIPA 4AUQB 3ZTGA 3SOUA 2QICA 3ZVYA 2ECJA 4FK5A 3ZVZB 5C11A 3N9QA 2QIZA 1X4IA 2NAAA 2KGIA 5B78A 2YHOA 3RTRB 2G6QA 5B79A 2XEUA 3KQIA 2E6RA 5KH9A 4YBTA 1E4UA 4I7BA 3O70A 1Z60A 2MT5A 2PNXA 5H9MA 3ZPVE 2YYRA 2MUMA 2CKLB 1ZBDB 3ZYQA 4MSXA 1JOCA 1WEEA 1Z2QA 4AYCB 3PHDA 2VPGA 4WZ2A 5FEYA 5FB0A 1BORA 3N9LA 2RI7A 2VP7A 5LKUA 2LRIC 3L1ZB 1X4JA 2M6MA 1V87A 4R7EA 4NN2A 4ZQLA 1VD4A 5D1KB 2ECWA 2KU3A 1LDJB 5FB1A 5H1TA 1WGMA 4A4CA 3IHPA 2CKLA 1N87A 2EA6A 5J3XA 2YURA 3HCUA 4A4BA 2JMIA 2G43A 1WEQA 4GNDA 2KWOA 3U5NA 4V3LC 5EYAF 5B8DA 4LK9A 5AITA 1K2FA 3PURA 2FSAA 2F6JA 2DX8A 4N4FA 3O7AA 3RPGB 1IYMA 2EODA 5B77A 3HCTA 5G0FA 3O37A 4YATA 2FUUA 2VPEA 3HTKC 2LXHC 3PUQA 2MNYA 3O36A 1FP0A 2ECTA 1DVPA 4CCGX 1WEUA 3SOWA 3LRQA 4GNFA 1HYIA 1VYXA 4I7CA 3T6RA 1VFYA 2LV9A 1JM7A 4YC9A 2VJFA 2KWJA 1LDKC 4QF3A 2YQMA 3T7LA 2YW8A 2F42A 4S3OC 5LKTA 2YSMA 3NG2A 3U5OA 3KV6A 3O34A 4LLBA 1X4UA 2KYUA 2YSJA 2KR4A 2KWNA 2KGGA 2MA5A 1CHCA 4WZ3B 2KREA 3M99A 2M3HA 5DINA 1WE9A 3LQIA 2YUCA 4LJNA 4A0CD 1RMDA 5B75A 4CA1A 1XWHA 2MD7B 5B76A 5TBNA 3L11A 4R2YA 2L75A 2L43A 3U5PA 5D1LB 1Z6UA 2ZETC 2ECVA 5LCWB 4AYCA 5G04B 5G05B 2LGLA 4IC2A 4R8PK 3ZNIA 4GNEA 5AIUA 2MNZA 4YABA 5H1VA 2C2LA 4B7YC 3SHBA 5D1MB 2FUIA
chains in the Genus database with same CATH superfamily
4BHWA 5KH3A 3MHSA 4AP4A 2E6SA 2VJEA 2MA6A 2LQ6A 4A49A 4I7DA 3FJUB 2L7PA 4ZUXU 1WEMA 3FL2A 3O35A 1WENA 4LADB 2JUNA 2ECGA 4N3WA 2LXPC 2YREA 3DQVR 2K16A 2ECNA 3O47A 2JMDA 3LQJA 4FJCA 2L80A 4L58A 2YHNA 3RPGC 5TABA 4UI9B 4PPEA 2LDRA 2K17A 4YAXA 4YADA 2K1JA 2I50A 2KFTA 3GV4A 4GB0A 5C13A 4FO9A 4UP5A 2K4DA 2RSDA 5K3QA 5JG6A 2LGKA 4S3OB 2CRWA 5KH7A 2M1RA 2FFWA 2M13A 1WEVA 3V43A 2LGVA 5TDRA 1WEOA 3U5MA 4F1PA 2B0OE 2G45A 2KWKA 3MDBC 4X3GA 3N9MA 2XB1A 3VK6A 4WA6A 3DPLR 4P5OB 1WILA 4XI1A 2LGGA 3LDYA 4UP0A 2LN0A 1WIMA 3Q1DA 2YT5A 5I3LA 2KE1A 5H1UA 4L7XA 3M63A 3ASLA 4GNGA 4BBQA 2EXUA 2IDAA 3EB6A 2UZGA 2ECIA 5FERA 1U6GB 3MHHA 3N9PA 5TDWA 5SVIA 3I2DA 5LKZA 4MVTA 2EGPA 3N9NA 2Y1MA 5TRBA 3EB5A 3KDEC 4Z0OA 2MD8C 4WZ0A 3FEHA 4V3KC 2YU4A 2FD4A 2DJAA 2L5UA 2CSYA 2BAYA 4B86C 2VNFA 3KNVA 4LKAA 3M62A 2JRJA 3FANA 4PTBA 3O33A 4O64A 1F62A 1WEPA 2F6NA 2P57A 3GL6A 1HYJA 2PUYA 2HYED 3M7KA 4F52B 2KIZA 3SUBA 3QZVA 4AVXA 4Z0RA 1WFKA 2HDPA 4ZDTA 5DKAA 2XOCA 4Q6FA 2D8SA 4H9DA 2C2VS 2VJEB 1MBMA 2CSZA 2IQJA 1G25A 2H0DB 3LQHA 2L0BA 2OXQC 2CRRA 2Y43A 4YBMA 1JM7B 1MM3A 2MIQA 3L1XA 3C5KA 4IC3A 3LVQE 3C6WA 2AN6A 3SOXA 2JMJA 2VPBA 2QJ0A 4OGCA 2H0DA 4TKPB 1FBVA 2VPDA 3LVRE 3ZPV1 2VJFB 2CT2A 2E61A 3HCSA 3N9OA 4YBSA 5LKXA 3KV5A 2CSVA 4C9ZA 4QF2A 1MM2A 3DDTA 4W4UA 1WEWA 1T1HA 2M85A 1WESA 2YQLA 2Y1NA 4FIPA 4AUQB 3ZTGA 3SOUA 2QICA 3ZVYA 2ECJA 4FK5A 3ZVZB 5C11A 5SVYA 3N9QA 2QIZA 4QQ4A 1X4IA 2NAAA 2KGIA 5B78A 2YHOA 3RTRB 2G6QA 5B79A 2XEUA 3KQIA 2E6RA 5KH9A 4YBTA 2CONA 1E4UA 4I7BA 2XOZA 3O70A 1Z60A 2MT5A 2PNXA 5H9MA 3ZPVE 2YYRA 2MUMA 5SVXA 3E2DA 2CKLB 1ZBDB 3ZYQA 4MSXA 2LAUA 2KKXA 1JOCA 1WEEA 1Z2QA 4AYCB 3PHDA 2VPGA 4WZ2A 5FEYA 5FB0A 1BORA 3N9LA 2RI7A 2VP7A 5LKUA 2LRIC 2D8UA 3L1ZB 1X4JA 2M6MA 1V87A 4R7EA 4NN2A 4ZQLA 1VD4A 5D1KB 2ECWA 2DSMA 2KU3A 1LDJB 5FB1A 5H1TA 1WGMA 4A4CA 3IHPA 2CKLA 2RR4A 1N87A 2EA6A 5J3XA 2YURA 3HCUA 4A4BA 1DCQA 2JMIA 2G43A 1WEQA 4GNDA 3DWDA 2KWOA 3U5NA 4V3LC 2KKYA 5EYAF 5B8DA 4LK9A 5AITA 1K2FA 3PURA 2FSAA 2F6JA 2DX8A 4N4FA 3O7AA 3LJUX 3RPGB 1IYMA 2JM3A 2XOYA 2EODA 4O62A 5B77A 3HCTA 5G0FA 3T9KA 3O37A 4YATA 2FUUA 2VPEA 3HTKC 2LXHC 3PUQA 2MNYA 2EGMA 3O36A 1FP0A 2ECTA 1DVPA 4CCGX 1WEUA 3SOWA 3LRQA 3PLWA 4GNFA 1HYIA 1VYXA 4I7CA 3T6RA 1VFYA 3FAOA 2LV9A 4OGEA 1JM7A 4YC9A 2VJFA 2KWJA 1LDKC 2YVRA 2YQMA 4QF3A 3T7LA 2YW8A 2F42A 4S3OC 5LKTA 2XP0A 2YSMA 3NG2A 3U5OA 3KV6A 3O34A 4LLBA 1X4UA 2KYUA 2YSJA 2KR4A 2KWNA 2KGGA 2MA5A 1CHCA 4WZ3B 2KREA 3M99A 2M3HA 5DINA 1WE9A 3LQIA 2YUCA 4LJNA 4A0CD 1RMDA 5B75A 4CA1A 1XWHA 2MD7B 5B76A 5TBNA 3L11A 4R2YA 3FM8C 2OWAA 2L75A 5SVIB 2L43A 3U5PA 5D1LB 1Z6UA 2ZETC 2ECVA 3JUEA 5LCWB 4AYCA 5G04B 5G05B 2LGLA 3H7HA 4IC2A 4R8PK 3ZNIA 4GNEA 5AIUA 2MNZA 4YABA 2MKEA 5H1VA 2C2LA 4B7YC 3SHBA 5D1MB 2FUIA
chains in the Genus database with same CATH topology
4BHWA 5KH3A 3MHSA 4AP4A 2E6SA 2VJEA 2MA6A 2LQ6A 4A49A 4I7DA 4ZUXU 1WEMA 3FL2A 3O35A 1WENA 4LADB 2ECGA 4N3WA 2LXPC 2YREA 3DQVR 2K16A 2ECNA 2JMDA 3LQJA 4FJCA 2L80A 4L58A 2YHNA 3RPGC 5TABA 4UI9B 4PPEA 2LDRA 2K17A 4YAXA 4YADA 2K1JA 2I50A 2KFTA 3GV4A 4GB0A 5C13A 4FO9A 4UP5A 2K4DA 2RSDA 5JG6A 2LGKA 4S3OB 5KH7A 2M1RA 1WEVA 3V43A 2LGVA 5TDRA 1WEOA 3U5MA 2G45A 2KWKA 4X3GA 3N9MA 2XB1A 3VK6A 4WA6A 3DPLR 4P5OB 1WILA 4XI1A 2LGGA 4UP0A 2LN0A 1WIMA 2YT5A 5I3LA 2KE1A 5H1UA 4L7XA 3M63A 3ASLA 4GNGA 4BBQA 2IDAA 3EB6A 2UZGA 2ECIA 5FERA 1U6GB 3MHHA 3N9PA 5TDWA 3I2DA 5LKZA 4MVTA 2EGPA 3N9NA 2Y1MA 5TRBA 3EB5A 2MD8C 4WZ0A 4V3KC 2YU4A 2L5UA 2CSYA 2BAYA 4B86C 2VNFA 3KNVA 4LKAA 3M62A 2JRJA 4PTBA 3O33A 4O64A 1F62A 1WEPA 2F6NA 3GL6A 1HYJA 2PUYA 2HYED 4F52B 2KIZA 3QZVA 4AVXA 1WFKA 2HDPA 4ZDTA 5DKAA 4Q6FA 2D8SA 2C2VS 2VJEB 2CSZA 1G25A 2H0DB 3LQHA 2L0BA 2OXQC 2Y43A 4YBMA 1JM7B 1MM3A 2MIQA 3L1XA 3C5KA 4IC3A 3C6WA 2AN6A 3SOXA 2JMJA 2VPBA 2QJ0A 2H0DA 4TKPB 1FBVA 2VPDA 3ZPV1 2VJFB 2CT2A 3HCSA 3N9OA 4YBSA 5LKXA 3KV5A 4C9ZA 4QF2A 1MM2A 4W4UA 1WEWA 1T1HA 2M85A 1WESA 2YQLA 2Y1NA 4FIPA 4AUQB 3ZTGA 3SOUA 2QICA 3ZVYA 2ECJA 4FK5A 3ZVZB 5C11A 3N9QA 2QIZA 1X4IA 2NAAA 2KGIA 5B78A 2YHOA 3RTRB 2G6QA 5B79A 2XEUA 3KQIA 2E6RA 5KH9A 4YBTA 1E4UA 4I7BA 3O70A 1Z60A 2MT5A 2PNXA 5H9MA 3ZPVE 2YYRA 2MUMA 2CKLB 1ZBDB 3ZYQA 4MSXA 1JOCA 1WEEA 1Z2QA 4AYCB 3PHDA 2VPGA 4WZ2A 5FEYA 5FB0A 1BORA 3N9LA 2RI7A 2VP7A 5LKUA 2LRIC 3L1ZB 1X4JA 2M6MA 1V87A 4R7EA 4NN2A 4ZQLA 1VD4A 5D1KB 2ECWA 2KU3A 1LDJB 5FB1A 5H1TA 1WGMA 4A4CA 3IHPA 2CKLA 1N87A 2EA6A 5J3XA 2YURA 3HCUA 4A4BA 2JMIA 2G43A 1WEQA 4GNDA 2KWOA 3U5NA 4V3LC 5EYAF 5B8DA 4LK9A 5AITA 1K2FA 3PURA 2FSAA 2F6JA 2DX8A 4N4FA 3O7AA 3RPGB 1IYMA 2EODA 5B77A 3HCTA 5G0FA 3O37A 4YATA 2FUUA 2VPEA 3HTKC 2LXHC 3PUQA 2MNYA 3O36A 1FP0A 2ECTA 1DVPA 4CCGX 1WEUA 3SOWA 3LRQA 4GNFA 1HYIA 1VYXA 4I7CA 3T6RA 1VFYA 2LV9A 1JM7A 4YC9A 2VJFA 2KWJA 1LDKC 4QF3A 2YQMA 3T7LA 2YW8A 2F42A 4S3OC 5LKTA 2YSMA 3NG2A 3U5OA 3KV6A 3O34A 4LLBA 1X4UA 2KYUA 2YSJA 2KR4A 2KWNA 2KGGA 2MA5A 1CHCA 4WZ3B 2KREA 3M99A 2M3HA 5DINA 1WE9A 3LQIA 2YUCA 4LJNA 4A0CD 1RMDA 5B75A 4CA1A 1XWHA 2MD7B 5B76A 5TBNA 3L11A 4R2YA 2L75A 2L43A 3U5PA 5D1LB 1Z6UA 2ZETC 2ECVA 5LCWB 4AYCA 5G04B 5G05B 2LGLA 4IC2A 4R8PK 3ZNIA 4GNEA 5AIUA 2MNZA 4YABA 5H1VA 2C2LA 4B7YC 3SHBA 5D1MB 2FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHW A;  5KH3 A;  3MHS A;  4AP4 A;  2E6S A;  2VJE A;  2MA6 A;  2LQ6 A;  4A49 A;  4I7D A;  4ZUX U;  1WEM A;  3FL2 A;  3O35 A;  1WEN A;  4LAD B;  2ECG A;  4N3W A;  2LXP C;  2YRE A;  3DQV R;  2K16 A;  2ECN A;  2JMD A;  3LQJ A;  4FJC A;  2L80 A;  4L58 A;  2YHN A;  3RPG C;  5TAB A;  4UI9 B;  4PPE A;  2LDR A;  2K17 A;  4YAX A;  4YAD A;  2K1J A;  2I50 A;  2KFT A;  3GV4 A;  4GB0 A;  5C13 A;  4FO9 A;  4UP5 A;  2K4D A;  2RSD A;  5JG6 A;  2LGK A;  4S3O B;  5KH7 A;  2M1R A;  1WEV A;  3V43 A;  2LGV A;  5TDR A;  1WEO A;  3U5M A;  2G45 A;  2KWK A;  4X3G A;  3N9M A;  2XB1 A;  3VK6 A;  4WA6 A;  3DPL R;  4P5O B;  1WIL A;  4XI1 A;  2LGG A;  4UP0 A;  2LN0 A;  1WIM A;  2YT5 A;  5I3L A;  2KE1 A;  5H1U A;  4L7X A;  3M63 A;  3ASL A;  4GNG A;  4BBQ A;  2IDA A;  3EB6 A;  2UZG A;  2ECI A;  5FER A;  1U6G B;  3MHH A;  3N9P A;  5TDW A;  3I2D A;  5LKZ A;  4MVT A;  2EGP A;  3N9N A;  2Y1M A;  5TRB A;  3EB5 A;  2MD8 C;  4WZ0 A;  4V3K C;  2YU4 A;  2L5U A;  2CSY A;  2BAY A;  4B86 C;  2VNF A;  3KNV A;  4LKA A;  3M62 A;  2JRJ A;  4PTB A;  3O33 A;  4O64 A;  1F62 A;  1WEP A;  2F6N A;  3GL6 A;  1HYJ A;  2PUY A;  2HYE D;  4F52 B;  2KIZ A;  3QZV A;  4AVX A;  1WFK A;  2HDP A;  4ZDT A;  5DKA A;  4Q6F A;  2D8S A;  2C2V S;  2VJE B;  2CSZ A;  1G25 A;  2H0D B;  3LQH A;  2L0B A;  2OXQ C;  2Y43 A;  4YBM A;  1JM7 B;  1MM3 A;  2MIQ A;  3L1X A;  3C5K A;  4IC3 A;  3C6W A;  2AN6 A;  3SOX A;  2JMJ A;  2VPB A;  2QJ0 A;  2H0D A;  4TKP B;  1FBV A;  2VPD A;  3ZPV 1;  2VJF B;  2CT2 A;  3HCS A;  3N9O A;  4YBS A;  5LKX A;  3KV5 A;  4C9Z A;  4QF2 A;  1MM2 A;  4W4U A;  1WEW A;  1T1H A;  2M85 A;  1WES A;  2YQL A;  2Y1N A;  4FIP A;  4AUQ B;  3ZTG A;  3SOU A;  2QIC A;  3ZVY A;  2ECJ A;  4FK5 A;  3ZVZ B;  5C11 A;  3N9Q A;  2QIZ A;  1X4I A;  2NAA A;  2KGI A;  5B78 A;  2YHO A;  3RTR B;  2G6Q A;  5B79 A;  2XEU A;  3KQI A;  2E6R A;  5KH9 A;  4YBT A;  1E4U A;  4I7B A;  3O70 A;  1Z60 A;  2MT5 A;  2PNX A;  5H9M A;  3ZPV E;  2YYR A;  2MUM A;  2CKL B;  1ZBD B;  3ZYQ A;  4MSX A;  1JOC A;  1WEE A;  1Z2Q A;  4AYC B;  3PHD A;  2VPG A;  4WZ2 A;  5FEY A;  5FB0 A;  1BOR A;  3N9L A;  2RI7 A;  2VP7 A;  5LKU A;  2LRI C;  3L1Z B;  1X4J A;  2M6M A;  1V87 A;  4R7E A;  4NN2 A;  4ZQL A;  1VD4 A;  5D1K B;  2ECW A;  2KU3 A;  1LDJ B;  5FB1 A;  5H1T A;  1WGM A;  4A4C A;  3IHP A;  2CKL A;  1N87 A;  2EA6 A;  5J3X A;  2YUR A;  3HCU A;  4A4B A;  2JMI A;  2G43 A;  1WEQ A;  4GND A;  2KWO A;  3U5N A;  4V3L C;  5EYA F;  5B8D A;  4LK9 A;  5AIT A;  1K2F A;  3PUR A;  2FSA A;  2F6J A;  2DX8 A;  4N4F A;  3O7A A;  3RPG B;  1IYM A;  2EOD A;  5B77 A;  3HCT A;  5G0F A;  3O37 A;  4YAT A;  2FUU A;  2VPE A;  3HTK C;  2LXH C;  3PUQ A;  2MNY A;  3O36 A;  1FP0 A;  2ECT A;  1DVP A;  4CCG X;  1WEU A;  3SOW A;  3LRQ A;  4GNF A;  1HYI A;  1VYX A;  4I7C A;  3T6R A;  1VFY A;  2LV9 A;  1JM7 A;  4YC9 A;  2VJF A;  2KWJ A;  1LDK C;  4QF3 A;  2YQM A;  3T7L A;  2YW8 A;  2F42 A;  4S3O C;  5LKT A;  2YSM A;  3NG2 A;  3U5O A;  3KV6 A;  3O34 A;  4LLB A;  1X4U A;  2KYU A;  2YSJ A;  2KR4 A;  2KWN A;  2KGG A;  2MA5 A;  1CHC A;  4WZ3 B;  2KRE A;  3M99 A;  2M3H A;  5DIN A;  1WE9 A;  3LQI A;  2YUC A;  4LJN A;  4A0C D;  1RMD A;  5B75 A;  4CA1 A;  1XWH A;  2MD7 B;  5B76 A;  5TBN A;  3L11 A;  4R2Y A;  2L75 A;  2L43 A;  3U5P A;  5D1L B;  1Z6U A;  2ZET C;  2ECV A;  5LCW B;  4AYC A;  5G04 B;  5G05 B;  2LGL A;  4IC2 A;  4R8P K;  3ZNI A;  4GNE A;  5AIU A;  2MNZ A;  4YAB A;  5H1V A;  2C2L A;  4B7Y C;  3SHB A;  5D1M B;  2FUI A; 
#chains in the Genus database with same CATH topology
 4BHW A;  5KH3 A;  3MHS A;  4AP4 A;  2E6S A;  2VJE A;  2MA6 A;  2LQ6 A;  4A49 A;  4I7D A;  3FJU B;  2L7P A;  4ZUX U;  1WEM A;  3FL2 A;  3O35 A;  1WEN A;  4LAD B;  2JUN A;  2ECG A;  4N3W A;  2LXP C;  2YRE A;  3DQV R;  2K16 A;  2ECN A;  3O47 A;  2JMD A;  3LQJ A;  4FJC A;  2L80 A;  4L58 A;  2YHN A;  3RPG C;  5TAB A;  4UI9 B;  4PPE A;  2LDR A;  2K17 A;  4YAX A;  4YAD A;  2K1J A;  2I50 A;  2KFT A;  3GV4 A;  4GB0 A;  5C13 A;  4FO9 A;  4UP5 A;  2K4D A;  2RSD A;  5K3Q A;  5JG6 A;  2LGK A;  4S3O B;  2CRW A;  5KH7 A;  2M1R A;  2FFW A;  2M13 A;  1WEV A;  3V43 A;  2LGV A;  5TDR A;  1WEO A;  3U5M A;  4F1P A;  2B0O E;  2G45 A;  2KWK A;  3MDB C;  4X3G A;  3N9M A;  2XB1 A;  3VK6 A;  4WA6 A;  3DPL R;  4P5O B;  1WIL A;  4XI1 A;  2LGG A;  3LDY A;  4UP0 A;  2LN0 A;  1WIM A;  3Q1D A;  2YT5 A;  5I3L A;  2KE1 A;  5H1U A;  4L7X A;  3M63 A;  3ASL A;  4GNG A;  4BBQ A;  2EXU A;  2IDA A;  3EB6 A;  2UZG A;  2ECI A;  5FER A;  1U6G B;  3MHH A;  3N9P A;  5TDW A;  5SVI A;  3I2D A;  5LKZ A;  4MVT A;  2EGP A;  3N9N A;  2Y1M A;  5TRB A;  3EB5 A;  3KDE C;  4Z0O A;  2MD8 C;  4WZ0 A;  3FEH A;  4V3K C;  2YU4 A;  2FD4 A;  2DJA A;  2L5U A;  2CSY A;  2BAY A;  4B86 C;  2VNF A;  3KNV A;  4LKA A;  3M62 A;  2JRJ A;  3FAN A;  4PTB A;  3O33 A;  4O64 A;  1F62 A;  1WEP A;  2F6N A;  2P57 A;  3GL6 A;  1HYJ A;  2PUY A;  2HYE D;  3M7K A;  4F52 B;  2KIZ A;  3SUB A;  3QZV A;  4AVX A;  4Z0R A;  1WFK A;  2HDP A;  4ZDT A;  5DKA A;  2XOC A;  4Q6F A;  2D8S A;  4H9D A;  2C2V S;  2VJE B;  1MBM A;  2CSZ A;  2IQJ A;  1G25 A;  2H0D B;  3LQH A;  2L0B A;  2OXQ C;  2CRR A;  2Y43 A;  4YBM A;  1JM7 B;  1MM3 A;  2MIQ A;  3L1X A;  3C5K A;  4IC3 A;  3LVQ E;  3C6W A;  2AN6 A;  3SOX A;  2JMJ A;  2VPB A;  2QJ0 A;  4OGC A;  2H0D A;  4TKP B;  1FBV A;  2VPD A;  3LVR E;  3ZPV 1;  2VJF B;  2CT2 A;  2E61 A;  3HCS A;  3N9O A;  4YBS A;  5LKX A;  3KV5 A;  2CSV A;  4C9Z A;  4QF2 A;  1MM2 A;  3DDT A;  4W4U A;  1WEW A;  1T1H A;  2M85 A;  1WES A;  2YQL A;  2Y1N A;  4FIP A;  4AUQ B;  3ZTG A;  3SOU A;  2QIC A;  3ZVY A;  2ECJ A;  4FK5 A;  3ZVZ B;  5C11 A;  5SVY A;  3N9Q A;  2QIZ A;  4QQ4 A;  1X4I A;  2NAA A;  2KGI A;  5B78 A;  2YHO A;  3RTR B;  2G6Q A;  5B79 A;  2XEU A;  3KQI A;  2E6R A;  5KH9 A;  4YBT A;  2CON A;  1E4U A;  4I7B A;  2XOZ A;  3O70 A;  1Z60 A;  2MT5 A;  2PNX A;  5H9M A;  3ZPV E;  2YYR A;  2MUM A;  5SVX A;  3E2D A;  2CKL B;  1ZBD B;  3ZYQ A;  4MSX A;  2LAU A;  2KKX A;  1JOC A;  1WEE A;  1Z2Q A;  4AYC B;  3PHD A;  2VPG A;  4WZ2 A;  5FEY A;  5FB0 A;  1BOR A;  3N9L A;  2RI7 A;  2VP7 A;  5LKU A;  2LRI C;  2D8U A;  3L1Z B;  1X4J A;  2M6M A;  1V87 A;  4R7E A;  4NN2 A;  4ZQL A;  1VD4 A;  5D1K B;  2ECW A;  2DSM A;  2KU3 A;  1LDJ B;  5FB1 A;  5H1T A;  1WGM A;  4A4C A;  3IHP A;  2CKL A;  2RR4 A;  1N87 A;  2EA6 A;  5J3X A;  2YUR A;  3HCU A;  4A4B A;  1DCQ A;  2JMI A;  2G43 A;  1WEQ A;  4GND A;  3DWD A;  2KWO A;  3U5N A;  4V3L C;  2KKY A;  5EYA F;  5B8D A;  4LK9 A;  5AIT A;  1K2F A;  3PUR A;  2FSA A;  2F6J A;  2DX8 A;  4N4F A;  3O7A A;  3LJU X;  3RPG B;  1IYM A;  2JM3 A;  2XOY A;  2EOD A;  4O62 A;  5B77 A;  3HCT A;  5G0F A;  3T9K A;  3O37 A;  4YAT A;  2FUU A;  2VPE A;  3HTK C;  2LXH C;  3PUQ A;  2MNY A;  2EGM A;  3O36 A;  1FP0 A;  2ECT A;  1DVP A;  4CCG X;  1WEU A;  3SOW A;  3LRQ A;  3PLW A;  4GNF A;  1HYI A;  1VYX A;  4I7C A;  3T6R A;  1VFY A;  3FAO A;  2LV9 A;  4OGE A;  1JM7 A;  4YC9 A;  2VJF A;  2KWJ A;  1LDK C;  2YVR A;  2YQM A;  4QF3 A;  3T7L A;  2YW8 A;  2F42 A;  4S3O C;  5LKT A;  2XP0 A;  2YSM A;  3NG2 A;  3U5O A;  3KV6 A;  3O34 A;  4LLB A;  1X4U A;  2KYU A;  2YSJ A;  2KR4 A;  2KWN A;  2KGG A;  2MA5 A;  1CHC A;  4WZ3 B;  2KRE A;  3M99 A;  2M3H A;  5DIN A;  1WE9 A;  3LQI A;  2YUC A;  4LJN A;  4A0C D;  1RMD A;  5B75 A;  4CA1 A;  1XWH A;  2MD7 B;  5B76 A;  5TBN A;  3L11 A;  4R2Y A;  3FM8 C;  2OWA A;  2L75 A;  5SVI B;  2L43 A;  3U5P A;  5D1L B;  1Z6U A;  2ZET C;  2ECV A;  3JUE A;  5LCW B;  4AYC A;  5G04 B;  5G05 B;  2LGL A;  3H7H A;  4IC2 A;  4R8P K;  3ZNI A;  4GNE A;  5AIU A;  2MNZ A;  4YAB A;  2MKE A;  5H1V A;  2C2L A;  4B7Y C;  3SHB A;  5D1M B;  2FUI A; 
#chains in the Genus database with same CATH homology
 4BHW A;  5KH3 A;  3MHS A;  4AP4 A;  2E6S A;  2VJE A;  2MA6 A;  2LQ6 A;  4A49 A;  4I7D A;  4ZUX U;  1WEM A;  3FL2 A;  3O35 A;  1WEN A;  4LAD B;  2ECG A;  4N3W A;  2LXP C;  2YRE A;  3DQV R;  2K16 A;  2ECN A;  2JMD A;  3LQJ A;  4FJC A;  2L80 A;  4L58 A;  2YHN A;  3RPG C;  5TAB A;  4UI9 B;  4PPE A;  2LDR A;  2K17 A;  4YAX A;  4YAD A;  2K1J A;  2I50 A;  2KFT A;  3GV4 A;  4GB0 A;  5C13 A;  4FO9 A;  4UP5 A;  2K4D A;  2RSD A;  5JG6 A;  2LGK A;  4S3O B;  5KH7 A;  2M1R A;  1WEV A;  3V43 A;  2LGV A;  5TDR A;  1WEO A;  3U5M A;  2G45 A;  2KWK A;  4X3G A;  3N9M A;  2XB1 A;  3VK6 A;  4WA6 A;  3DPL R;  4P5O B;  1WIL A;  4XI1 A;  2LGG A;  4UP0 A;  2LN0 A;  1WIM A;  2YT5 A;  5I3L A;  2KE1 A;  5H1U A;  4L7X A;  3M63 A;  3ASL A;  4GNG A;  4BBQ A;  2IDA A;  3EB6 A;  2UZG A;  2ECI A;  5FER A;  1U6G B;  3MHH A;  3N9P A;  5TDW A;  3I2D A;  5LKZ A;  4MVT A;  2EGP A;  3N9N A;  2Y1M A;  5TRB A;  3EB5 A;  2MD8 C;  4WZ0 A;  4V3K C;  2YU4 A;  2L5U A;  2CSY A;  2BAY A;  4B86 C;  2VNF A;  3KNV A;  4LKA A;  3M62 A;  2JRJ A;  4PTB A;  3O33 A;  4O64 A;  1F62 A;  1WEP A;  2F6N A;  3GL6 A;  1HYJ A;  2PUY A;  2HYE D;  4F52 B;  2KIZ A;  3QZV A;  4AVX A;  1WFK A;  2HDP A;  4ZDT A;  5DKA A;  4Q6F A;  2D8S A;  2C2V S;  2VJE B;  2CSZ A;  1G25 A;  2H0D B;  3LQH A;  2L0B A;  2OXQ C;  2Y43 A;  4YBM A;  1JM7 B;  1MM3 A;  2MIQ A;  3L1X A;  3C5K A;  4IC3 A;  3C6W A;  2AN6 A;  3SOX A;  2JMJ A;  2VPB A;  2QJ0 A;  2H0D A;  4TKP B;  1FBV A;  2VPD A;  3ZPV 1;  2VJF B;  2CT2 A;  3HCS A;  3N9O A;  4YBS A;  5LKX A;  3KV5 A;  4C9Z A;  4QF2 A;  1MM2 A;  4W4U A;  1WEW A;  1T1H A;  2M85 A;  1WES A;  2YQL A;  2Y1N A;  4FIP A;  4AUQ B;  3ZTG A;  3SOU A;  2QIC A;  3ZVY A;  2ECJ A;  4FK5 A;  3ZVZ B;  5C11 A;  3N9Q A;  2QIZ A;  1X4I A;  2NAA A;  2KGI A;  5B78 A;  2YHO A;  3RTR B;  2G6Q A;  5B79 A;  2XEU A;  3KQI A;  2E6R A;  5KH9 A;  4YBT A;  1E4U A;  4I7B A;  3O70 A;  1Z60 A;  2MT5 A;  2PNX A;  5H9M A;  3ZPV E;  2YYR A;  2MUM A;  2CKL B;  1ZBD B;  3ZYQ A;  4MSX A;  1JOC A;  1WEE A;  1Z2Q A;  4AYC B;  3PHD A;  2VPG A;  4WZ2 A;  5FEY A;  5FB0 A;  1BOR A;  3N9L A;  2RI7 A;  2VP7 A;  5LKU A;  2LRI C;  3L1Z B;  1X4J A;  2M6M A;  1V87 A;  4R7E A;  4NN2 A;  4ZQL A;  1VD4 A;  5D1K B;  2ECW A;  2KU3 A;  1LDJ B;  5FB1 A;  5H1T A;  1WGM A;  4A4C A;  3IHP A;  2CKL A;  1N87 A;  2EA6 A;  5J3X A;  2YUR A;  3HCU A;  4A4B A;  2JMI A;  2G43 A;  1WEQ A;  4GND A;  2KWO A;  3U5N A;  4V3L C;  5EYA F;  5B8D A;  4LK9 A;  5AIT A;  1K2F A;  3PUR A;  2FSA A;  2F6J A;  2DX8 A;  4N4F A;  3O7A A;  3RPG B;  1IYM A;  2EOD A;  5B77 A;  3HCT A;  5G0F A;  3O37 A;  4YAT A;  2FUU A;  2VPE A;  3HTK C;  2LXH C;  3PUQ A;  2MNY A;  3O36 A;  1FP0 A;  2ECT A;  1DVP A;  4CCG X;  1WEU A;  3SOW A;  3LRQ A;  4GNF A;  1HYI A;  1VYX A;  4I7C A;  3T6R A;  1VFY A;  2LV9 A;  1JM7 A;  4YC9 A;  2VJF A;  2KWJ A;  1LDK C;  4QF3 A;  2YQM A;  3T7L A;  2YW8 A;  2F42 A;  4S3O C;  5LKT A;  2YSM A;  3NG2 A;  3U5O A;  3KV6 A;  3O34 A;  4LLB A;  1X4U A;  2KYU A;  2YSJ A;  2KR4 A;  2KWN A;  2KGG A;  2MA5 A;  1CHC A;  4WZ3 B;  2KRE A;  3M99 A;  2M3H A;  5DIN A;  1WE9 A;  3LQI A;  2YUC A;  4LJN A;  4A0C D;  1RMD A;  5B75 A;  4CA1 A;  1XWH A;  2MD7 B;  5B76 A;  5TBN A;  3L11 A;  4R2Y A;  2L75 A;  2L43 A;  3U5P A;  5D1L B;  1Z6U A;  2ZET C;  2ECV A;  5LCW B;  4AYC A;  5G04 B;  5G05 B;  2LGL A;  4IC2 A;  4R8P K;  3ZNI A;  4GNE A;  5AIU A;  2MNZ A;  4YAB A;  5H1V A;  2C2L A;  4B7Y C;  3SHB A;  5D1M B;  2FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...