5I3LA

Dpf3b in complex with h3k14ac peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
VIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein DPF3
publication title Crystal structure of DPF3b in complex with an acetylated histone peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5i3lA00
3KV5A 1F62A 3ZVYA 1X4IA 1FP0A 2VJFA 3N9NA 5C11A 3SOXA 2KR4A 1JM7B 2F42A 2EGPA 3U5MA 3KNVA 4GNEA 5J3XA 5FERA 4ZQLA 2C2VS 5B78A 4AP4A 1WEVA 3MHHA 2M3HA 4V3KC 2K1JA 5B76A 2KREA 2EA6A 2KWNA 2CSYA 5TDRA 1IYMA 3ZTGA 2L0BA 3M99A 1HYIA 4YBMA 1WEPA 4WZ2A 1E4UA 4A0CD 2PNXA 4Q6FA 5TDWA 1LDJB 2KFTA 4QF3A 1WEQA 4I7BA 1Z60A 3N9LA 4ZUXU 5LKXA 3U5PA 4XI1A 2QIZA 2XB1A 4AYCA 2QJ0A 2YUCA 2BAYA 3LQJA 3O7AA 1Z6UA 2VPEA 3MHSA 2CKLB 2PUYA 5AITA 4N3WA 2YT5A 2YYRA 5G04B 1DVPA 4PPEA 2KU3A 4C9ZA 2YSJA 2LV9A 2RSDA 1VYXA 4L58A 3SOUA 5TBNA 3M62A 4BBQA 4B86C 4YADA 2H0DB 5B75A 2MD8C 1LDKC 2YQMA 4P5OB 3I2DA 4WA6A 2KGIA 1XWHA 2MIQA 4S3OB 4AVXA 1WEMA 2VP7A 4FIPA 4GNFA 2F6NA 2E6RA 3ZNIA 4I7DA 4MVTA 3O37A 4LKAA 4B7YC 4X3GA 1N87A 5D1MB 3ZPVE 2FSAA 2KYUA 4UP5A 2KGGA 4GNDA 5FEYA 2VPBA 3EB5A 4YABA 2L5UA 3LQHA 2IDAA 3ASLA 4YBSA 2KWJA 4ZDTA 2FUUA 3T7LA 2ECIA 4WZ3B 4BHWA 2OXQC 2MNYA 3O35A 2LDRA 2LGKA 2RI7A 2MD7B 4R2YA 4V3LC 2EODA 1Z2QA 2LGGA 4F52B 1WFKA 2CKLA 4GB0A 2M1RA 5FB1A 1CHCA 2ECWA 5JG6A 2VPGA 1JOCA 3EB6A 2YU4A 2VJEB 5H1UA 3KV6A 2E6SA 2Y1MA 3DQVR 2VPDA 4W4UA 2YURA 3O34A 2LGVA 3M63A 2KWKA 3T6RA 4FJCA 1WILA 2LXPC 2H0DA 3O70A 3HTKC 1VFYA 2CSZA 4QF2A 3U5NA 5LKUA 3LQIA 1WENA 2K17A 1WEEA 5AIUA 1WE9A 4LJNA 5B77A 2ECTA 3DPLR 5C13A 3FL2A 2UZGA 4MSXA 1FBVA 4WZ0A 2LN0A 4A4CA 3O36A 2M85A 5H1TA 1V87A 5LCWB 5D1LB 2HYED 4NN2A 3L1XA 3L1ZB 4N4FA 3NG2A 1JM7A 2YW8A 3U5OA 2JRJA 3HCSA 2L75A 2G6QA 2L43A 4YC9A 3C6WA 1WEUA 2CT2A 4R8PK 2LRIC 4YBTA 2YHOA 4GNGA 2NAAA 5TABA 3ZPV1 4CCGX 4AYCB 2YHNA 2Y43A 3SHBA 4UP0A 3PHDA 4LADB 2KWOA 3PURA 4S3OC 5G05B 3N9OA 2MT5A 1U6GB 1WIMA 2C2LA 3SOWA 4A4BA 1HYJA 5KH7A 3RTRB 1VD4A 2Y1NA 3HCUA 2XEUA 1WESA 5B79A 5KH3A 4IC3A 3HCTA 3QZVA 3ZYQA 5LKTA 2JMJA 1RMDA 5D1KB 5G0FA 2K16A 2JMIA 4L7XA 2D8SA 2MA5A 3IHPA 4AUQB 4UI9B 3GL6A 1WEOA 2AN6A 2MUMA 3C5KA 2YSMA 3N9QA 4LK9A 2ECNA 3ZVZB 2MA6A 3RPGB 3GV4A 4PTBA 2G43A 3N9PA 5EYAF 2M6MA 2VJFB 2QICA 1MM3A 2LQ6A 2KE1A 3VK6A 1WGMA 2FUIA 4LLBA 2ECJA 5H1VA 3KQIA 3RPGC 4YATA 5DINA 5TRBA 2F6JA 3LRQA 4FK5A 4TKPB 2L80A 2LGLA 2G45A 5I3LA 2HDPA 3N9MA 4IC2A 5LKZA 3L11A 4YAXA 2LXHC 1BORA 4FO9A 1X4UA 1WEWA 2DX8A 5B8DA 4CA1A 2ECVA 4I7CA 2VNFA 3V43A 2ECGA 2ZETC 5DKAA 2MNZA 2KIZA 5FB0A 1MM2A 5KH9A 1T1HA 1ZBDB 2YREA 1K2FA 4R7EA 2I50A 1X4JA 4O64A 5H9MA 2VJEA 2YQLA 1G25A 4A49A 2JMDA 3PUQA 2K4DA 3O33A
chains in the Genus database with same CATH superfamily
3KV5A 1F62A 3ZVYA 1X4IA 2CONA 1FP0A 2VJFA 3N9NA 5C11A 3SOXA 2KR4A 1JM7B 2F42A 2EGPA 3U5MA 3KNVA 2KKXA 4GNEA 2P57A 5J3XA 5FERA 4ZQLA 2C2VS 5B78A 4AP4A 1WEVA 3MHHA 2M3HA 4V3KC 2K1JA 2M13A 5B76A 2KREA 2EA6A 2KWNA 2CSYA 5TDRA 4F1PA 2YVRA 1IYMA 3ZTGA 2L0BA 3M99A 1HYIA 4YBMA 1WEPA 4WZ2A 1E4UA 4A0CD 2PNXA 4Q6FA 4OGCA 5TDWA 1LDJB 2KFTA 4QF3A 2CRWA 1WEQA 4I7BA 1Z60A 3N9LA 4ZUXU 5LKXA 3U5PA 4XI1A 2QIZA 2XB1A 4AYCA 2D8UA 2QJ0A 2YUCA 2BAYA 3LQJA 3O7AA 1Z6UA 3LJUX 2VPEA 3MHSA 2CKLB 2PUYA 5AITA 4N3WA 2YT5A 2YYRA 5G04B 1DVPA 4PPEA 2KU3A 4C9ZA 2YSJA 2LV9A 2RSDA 1VYXA 4L58A 3SOUA 5TBNA 2JUNA 3DWDA 3M62A 4BBQA 2L7PA 4B86C 4YADA 2H0DB 5B75A 3E2DA 2MD8C 1LDKC 2YQMA 4P5OB 3I2DA 3MDBC 4WA6A 3O47A 2KGIA 1XWHA 2MIQA 4S3OB 4AVXA 1WEMA 2VP7A 4FIPA 4GNFA 4O62A 4Z0OA 2F6NA 2E6RA 3ZNIA 4I7DA 4MVTA 3O37A 2EXUA 4LKAA 4B7YC 4X3GA 1N87A 5D1MB 3ZPVE 2EGMA 2FSAA 2XOZA 2KYUA 4UP5A 2KGGA 4GNDA 5FEYA 2VPBA 3EB5A 4YABA 2L5UA 3LQHA 2IDAA 3ASLA 4YBSA 2KWJA 4ZDTA 2FUUA 3T7LA 2ECIA 4WZ3B 3KDEC 4BHWA 2CRRA 2OXQC 2MNYA 3FAOA 3O35A 2LDRA 2LGKA 2RI7A 2MD7B 4R2YA 4V3LC 2EODA 1Z2QA 2LGGA 2XOYA 4F52B 1WFKA 2CKLA 4GB0A 2M1RA 5FB1A 1CHCA 2ECWA 3LDYA 5JG6A 2VPGA 1JOCA 3EB6A 2YU4A 2KKYA 2VJEB 5H1UA 3KV6A 2E6SA 2Y1MA 3DQVR 3FANA 2VPDA 4W4UA 2YURA 3O34A 2LGVA 3M63A 2KWKA 3T6RA 4FJCA 1WILA 2LXPC 2H0DA 3O70A 3HTKC 1VFYA 2CSZA 4QF2A 3U5NA 5LKUA 3LQIA 1WENA 2K17A 1WEEA 5AIUA 1WE9A 4LJNA 5B77A 4Z0RA 2ECTA 3DPLR 5C13A 3FL2A 2UZGA 4MSXA 2FFWA 1FBVA 4WZ0A 5SVIB 2LN0A 4A4CA 3O36A 2M85A 5H1TA 1V87A 2DJAA 5LCWB 5D1LB 2HYED 4NN2A 3PLWA 3SUBA 2JM3A 3L1XA 3L1ZB 4N4FA 3NG2A 1JM7A 3JUEA 2YW8A 3U5OA 2JRJA 3HCSA 2L75A 2G6QA 2L43A 4YC9A 3C6WA 1WEUA 2CT2A 4R8PK 2LRIC 1MBMA 4YBTA 2YHOA 4GNGA 2NAAA 5TABA 3ZPV1 4CCGX 4AYCB 2YHNA 3M7KA 2E61A 2Y43A 3SHBA 3DDTA 4UP0A 3PHDA 4LADB 2KWOA 3PURA 4S3OC 5G05B 3N9OA 2MT5A 1U6GB 1WIMA 2C2LA 3SOWA 4A4BA 1HYJA 5KH7A 3RTRB 3LVRE 1VD4A 2Y1NA 3HCUA 2XEUA 1WESA 5B79A 5KH3A 4IC3A 3HCTA 3QZVA 3ZYQA 5LKTA 2JMJA 4OGEA 1RMDA 5D1KB 5G0FA 2K16A 2JMIA 4L7XA 2D8SA 2RR4A 2MA5A 5SVXA 3IHPA 4AUQB 4UI9B 3GL6A 1WEOA 2AN6A 2MUMA 3C5KA 2IQJA 2YSMA 3N9QA 4LK9A 3H7HA 2ECNA 5SVIA 3T9KA 3ZVZB 2MKEA 2XOCA 2MA6A 3RPGB 3Q1DA 3GV4A 2CSVA 3FM8C 4PTBA 2G43A 3N9PA 5EYAF 2M6MA 2VJFB 4H9DA 2QICA 1MM3A 2LQ6A 2KE1A 3VK6A 1WGMA 1DCQA 2FUIA 4LLBA 2ECJA 5H1VA 3KQIA 3RPGC 4YATA 5DINA 5TRBA 2F6JA 3LRQA 4FK5A 4TKPB 2DSMA 5K3QA 2L80A 2LGLA 2G45A 5I3LA 2HDPA 3N9MA 4IC2A 5LKZA 3L11A 2LAUA 4YAXA 2LXHC 1BORA 4FO9A 1X4UA 1WEWA 2DX8A 5B8DA 4CA1A 2ECVA 2OWAA 4I7CA 2VNFA 3V43A 2FD4A 2ECGA 2ZETC 5DKAA 2MNZA 3LVQE 2KIZA 5FB0A 1MM2A 5KH9A 1T1HA 1ZBDB 2B0OE 4QQ4A 2YREA 3FEHA 1K2FA 4R7EA 2I50A 1X4JA 4O64A 5H9MA 2VJEA 3FJUB 2YQLA 2XP0A 1G25A 4A49A 2JMDA 3PUQA 2K4DA 3O33A 5SVYA
chains in the Genus database with same CATH topology
3KV5A 1F62A 3ZVYA 1X4IA 1FP0A 2VJFA 3N9NA 5C11A 3SOXA 2KR4A 1JM7B 2F42A 2EGPA 3U5MA 3KNVA 4GNEA 5J3XA 5FERA 4ZQLA 2C2VS 5B78A 4AP4A 1WEVA 3MHHA 2M3HA 4V3KC 2K1JA 5B76A 2KREA 2EA6A 2KWNA 2CSYA 5TDRA 1IYMA 3ZTGA 2L0BA 3M99A 1HYIA 4YBMA 1WEPA 4WZ2A 1E4UA 4A0CD 2PNXA 4Q6FA 5TDWA 1LDJB 2KFTA 4QF3A 1WEQA 4I7BA 1Z60A 3N9LA 4ZUXU 5LKXA 3U5PA 4XI1A 2QIZA 2XB1A 4AYCA 2QJ0A 2YUCA 2BAYA 3LQJA 3O7AA 1Z6UA 2VPEA 3MHSA 2CKLB 2PUYA 5AITA 4N3WA 2YT5A 2YYRA 5G04B 1DVPA 4PPEA 2KU3A 4C9ZA 2YSJA 2LV9A 2RSDA 1VYXA 4L58A 3SOUA 5TBNA 3M62A 4BBQA 4B86C 4YADA 2H0DB 5B75A 2MD8C 1LDKC 2YQMA 4P5OB 3I2DA 4WA6A 2KGIA 1XWHA 2MIQA 4S3OB 4AVXA 1WEMA 2VP7A 4FIPA 4GNFA 2F6NA 2E6RA 3ZNIA 4I7DA 4MVTA 3O37A 4LKAA 4B7YC 4X3GA 1N87A 5D1MB 3ZPVE 2FSAA 2KYUA 4UP5A 2KGGA 4GNDA 5FEYA 2VPBA 3EB5A 4YABA 2L5UA 3LQHA 2IDAA 3ASLA 4YBSA 2KWJA 4ZDTA 2FUUA 3T7LA 2ECIA 4WZ3B 4BHWA 2OXQC 2MNYA 3O35A 2LDRA 2LGKA 2RI7A 2MD7B 4R2YA 4V3LC 2EODA 1Z2QA 2LGGA 4F52B 1WFKA 2CKLA 4GB0A 2M1RA 5FB1A 1CHCA 2ECWA 5JG6A 2VPGA 1JOCA 3EB6A 2YU4A 2VJEB 5H1UA 3KV6A 2E6SA 2Y1MA 3DQVR 2VPDA 4W4UA 2YURA 3O34A 2LGVA 3M63A 2KWKA 3T6RA 4FJCA 1WILA 2LXPC 2H0DA 3O70A 3HTKC 1VFYA 2CSZA 4QF2A 3U5NA 5LKUA 3LQIA 1WENA 2K17A 1WEEA 5AIUA 1WE9A 4LJNA 5B77A 2ECTA 3DPLR 5C13A 3FL2A 2UZGA 4MSXA 1FBVA 4WZ0A 2LN0A 4A4CA 3O36A 2M85A 5H1TA 1V87A 5LCWB 5D1LB 2HYED 4NN2A 3L1XA 3L1ZB 4N4FA 3NG2A 1JM7A 2YW8A 3U5OA 2JRJA 3HCSA 2L75A 2G6QA 2L43A 4YC9A 3C6WA 1WEUA 2CT2A 4R8PK 2LRIC 4YBTA 2YHOA 4GNGA 2NAAA 5TABA 3ZPV1 4CCGX 4AYCB 2YHNA 2Y43A 3SHBA 4UP0A 3PHDA 4LADB 2KWOA 3PURA 4S3OC 5G05B 3N9OA 2MT5A 1U6GB 1WIMA 2C2LA 3SOWA 4A4BA 1HYJA 5KH7A 3RTRB 1VD4A 2Y1NA 3HCUA 2XEUA 1WESA 5B79A 5KH3A 4IC3A 3HCTA 3QZVA 3ZYQA 5LKTA 2JMJA 1RMDA 5D1KB 5G0FA 2K16A 2JMIA 4L7XA 2D8SA 2MA5A 3IHPA 4AUQB 4UI9B 3GL6A 1WEOA 2AN6A 2MUMA 3C5KA 2YSMA 3N9QA 4LK9A 2ECNA 3ZVZB 2MA6A 3RPGB 3GV4A 4PTBA 2G43A 3N9PA 5EYAF 2M6MA 2VJFB 2QICA 1MM3A 2LQ6A 2KE1A 3VK6A 1WGMA 2FUIA 4LLBA 2ECJA 5H1VA 3KQIA 3RPGC 4YATA 5DINA 5TRBA 2F6JA 3LRQA 4FK5A 4TKPB 2L80A 2LGLA 2G45A 5I3LA 2HDPA 3N9MA 4IC2A 5LKZA 3L11A 4YAXA 2LXHC 1BORA 4FO9A 1X4UA 1WEWA 2DX8A 5B8DA 4CA1A 2ECVA 4I7CA 2VNFA 3V43A 2ECGA 2ZETC 5DKAA 2MNZA 2KIZA 5FB0A 1MM2A 5KH9A 1T1HA 1ZBDB 2YREA 1K2FA 4R7EA 2I50A 1X4JA 4O64A 5H9MA 2VJEA 2YQLA 1G25A 4A49A 2JMDA 3PUQA 2K4DA 3O33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV5 A;  1F62 A;  3ZVY A;  1X4I A;  1FP0 A;  2VJF A;  3N9N A;  5C11 A;  3SOX A;  2KR4 A;  1JM7 B;  2F42 A;  2EGP A;  3U5M A;  3KNV A;  4GNE A;  5J3X A;  5FER A;  4ZQL A;  2C2V S;  5B78 A;  4AP4 A;  1WEV A;  3MHH A;  2M3H A;  4V3K C;  2K1J A;  5B76 A;  2KRE A;  2EA6 A;  2KWN A;  2CSY A;  5TDR A;  1IYM A;  3ZTG A;  2L0B A;  3M99 A;  1HYI A;  4YBM A;  1WEP A;  4WZ2 A;  1E4U A;  4A0C D;  2PNX A;  4Q6F A;  5TDW A;  1LDJ B;  2KFT A;  4QF3 A;  1WEQ A;  4I7B A;  1Z60 A;  3N9L A;  4ZUX U;  5LKX A;  3U5P A;  4XI1 A;  2QIZ A;  2XB1 A;  4AYC A;  2QJ0 A;  2YUC A;  2BAY A;  3LQJ A;  3O7A A;  1Z6U A;  2VPE A;  3MHS A;  2CKL B;  2PUY A;  5AIT A;  4N3W A;  2YT5 A;  2YYR A;  5G04 B;  1DVP A;  4PPE A;  2KU3 A;  4C9Z A;  2YSJ A;  2LV9 A;  2RSD A;  1VYX A;  4L58 A;  3SOU A;  5TBN A;  3M62 A;  4BBQ A;  4B86 C;  4YAD A;  2H0D B;  5B75 A;  2MD8 C;  1LDK C;  2YQM A;  4P5O B;  3I2D A;  4WA6 A;  2KGI A;  1XWH A;  2MIQ A;  4S3O B;  4AVX A;  1WEM A;  2VP7 A;  4FIP A;  4GNF A;  2F6N A;  2E6R A;  3ZNI A;  4I7D A;  4MVT A;  3O37 A;  4LKA A;  4B7Y C;  4X3G A;  1N87 A;  5D1M B;  3ZPV E;  2FSA A;  2KYU A;  4UP5 A;  2KGG A;  4GND A;  5FEY A;  2VPB A;  3EB5 A;  4YAB A;  2L5U A;  3LQH A;  2IDA A;  3ASL A;  4YBS A;  2KWJ A;  4ZDT A;  2FUU A;  3T7L A;  2ECI A;  4WZ3 B;  4BHW A;  2OXQ C;  2MNY A;  3O35 A;  2LDR A;  2LGK A;  2RI7 A;  2MD7 B;  4R2Y A;  4V3L C;  2EOD A;  1Z2Q A;  2LGG A;  4F52 B;  1WFK A;  2CKL A;  4GB0 A;  2M1R A;  5FB1 A;  1CHC A;  2ECW A;  5JG6 A;  2VPG A;  1JOC A;  3EB6 A;  2YU4 A;  2VJE B;  5H1U A;  3KV6 A;  2E6S A;  2Y1M A;  3DQV R;  2VPD A;  4W4U A;  2YUR A;  3O34 A;  2LGV A;  3M63 A;  2KWK A;  3T6R A;  4FJC A;  1WIL A;  2LXP C;  2H0D A;  3O70 A;  3HTK C;  1VFY A;  2CSZ A;  4QF2 A;  3U5N A;  5LKU A;  3LQI A;  1WEN A;  2K17 A;  1WEE A;  5AIU A;  1WE9 A;  4LJN A;  5B77 A;  2ECT A;  3DPL R;  5C13 A;  3FL2 A;  2UZG A;  4MSX A;  1FBV A;  4WZ0 A;  2LN0 A;  4A4C A;  3O36 A;  2M85 A;  5H1T A;  1V87 A;  5LCW B;  5D1L B;  2HYE D;  4NN2 A;  3L1X A;  3L1Z B;  4N4F A;  3NG2 A;  1JM7 A;  2YW8 A;  3U5O A;  2JRJ A;  3HCS A;  2L75 A;  2G6Q A;  2L43 A;  4YC9 A;  3C6W A;  1WEU A;  2CT2 A;  4R8P K;  2LRI C;  4YBT A;  2YHO A;  4GNG A;  2NAA A;  5TAB A;  3ZPV 1;  4CCG X;  4AYC B;  2YHN A;  2Y43 A;  3SHB A;  4UP0 A;  3PHD A;  4LAD B;  2KWO A;  3PUR A;  4S3O C;  5G05 B;  3N9O A;  2MT5 A;  1U6G B;  1WIM A;  2C2L A;  3SOW A;  4A4B A;  1HYJ A;  5KH7 A;  3RTR B;  1VD4 A;  2Y1N A;  3HCU A;  2XEU A;  1WES A;  5B79 A;  5KH3 A;  4IC3 A;  3HCT A;  3QZV A;  3ZYQ A;  5LKT A;  2JMJ A;  1RMD A;  5D1K B;  5G0F A;  2K16 A;  2JMI A;  4L7X A;  2D8S A;  2MA5 A;  3IHP A;  4AUQ B;  4UI9 B;  3GL6 A;  1WEO A;  2AN6 A;  2MUM A;  3C5K A;  2YSM A;  3N9Q A;  4LK9 A;  2ECN A;  3ZVZ B;  2MA6 A;  3RPG B;  3GV4 A;  4PTB A;  2G43 A;  3N9P A;  5EYA F;  2M6M A;  2VJF B;  2QIC A;  1MM3 A;  2LQ6 A;  2KE1 A;  3VK6 A;  1WGM A;  2FUI A;  4LLB A;  2ECJ A;  5H1V A;  3KQI A;  3RPG C;  4YAT A;  5DIN A;  5TRB A;  2F6J A;  3LRQ A;  4FK5 A;  4TKP B;  2L80 A;  2LGL A;  2G45 A;  5I3L A;  2HDP A;  3N9M A;  4IC2 A;  5LKZ A;  3L11 A;  4YAX A;  2LXH C;  1BOR A;  4FO9 A;  1X4U A;  1WEW A;  2DX8 A;  5B8D A;  4CA1 A;  2ECV A;  4I7C A;  2VNF A;  3V43 A;  2ECG A;  2ZET C;  5DKA A;  2MNZ A;  2KIZ A;  5FB0 A;  1MM2 A;  5KH9 A;  1T1H A;  1ZBD B;  2YRE A;  1K2F A;  4R7E A;  2I50 A;  1X4J A;  4O64 A;  5H9M A;  2VJE A;  2YQL A;  1G25 A;  4A49 A;  2JMD A;  3PUQ A;  2K4D A;  3O33 A; 
#chains in the Genus database with same CATH topology
 3KV5 A;  1F62 A;  3ZVY A;  1X4I A;  2CON A;  1FP0 A;  2VJF A;  3N9N A;  5C11 A;  3SOX A;  2KR4 A;  1JM7 B;  2F42 A;  2EGP A;  3U5M A;  3KNV A;  2KKX A;  4GNE A;  2P57 A;  5J3X A;  5FER A;  4ZQL A;  2C2V S;  5B78 A;  4AP4 A;  1WEV A;  3MHH A;  2M3H A;  4V3K C;  2K1J A;  2M13 A;  5B76 A;  2KRE A;  2EA6 A;  2KWN A;  2CSY A;  5TDR A;  4F1P A;  2YVR A;  1IYM A;  3ZTG A;  2L0B A;  3M99 A;  1HYI A;  4YBM A;  1WEP A;  4WZ2 A;  1E4U A;  4A0C D;  2PNX A;  4Q6F A;  4OGC A;  5TDW A;  1LDJ B;  2KFT A;  4QF3 A;  2CRW A;  1WEQ A;  4I7B A;  1Z60 A;  3N9L A;  4ZUX U;  5LKX A;  3U5P A;  4XI1 A;  2QIZ A;  2XB1 A;  4AYC A;  2D8U A;  2QJ0 A;  2YUC A;  2BAY A;  3LQJ A;  3O7A A;  1Z6U A;  3LJU X;  2VPE A;  3MHS A;  2CKL B;  2PUY A;  5AIT A;  4N3W A;  2YT5 A;  2YYR A;  5G04 B;  1DVP A;  4PPE A;  2KU3 A;  4C9Z A;  2YSJ A;  2LV9 A;  2RSD A;  1VYX A;  4L58 A;  3SOU A;  5TBN A;  2JUN A;  3DWD A;  3M62 A;  4BBQ A;  2L7P A;  4B86 C;  4YAD A;  2H0D B;  5B75 A;  3E2D A;  2MD8 C;  1LDK C;  2YQM A;  4P5O B;  3I2D A;  3MDB C;  4WA6 A;  3O47 A;  2KGI A;  1XWH A;  2MIQ A;  4S3O B;  4AVX A;  1WEM A;  2VP7 A;  4FIP A;  4GNF A;  4O62 A;  4Z0O A;  2F6N A;  2E6R A;  3ZNI A;  4I7D A;  4MVT A;  3O37 A;  2EXU A;  4LKA A;  4B7Y C;  4X3G A;  1N87 A;  5D1M B;  3ZPV E;  2EGM A;  2FSA A;  2XOZ A;  2KYU A;  4UP5 A;  2KGG A;  4GND A;  5FEY A;  2VPB A;  3EB5 A;  4YAB A;  2L5U A;  3LQH A;  2IDA A;  3ASL A;  4YBS A;  2KWJ A;  4ZDT A;  2FUU A;  3T7L A;  2ECI A;  4WZ3 B;  3KDE C;  4BHW A;  2CRR A;  2OXQ C;  2MNY A;  3FAO A;  3O35 A;  2LDR A;  2LGK A;  2RI7 A;  2MD7 B;  4R2Y A;  4V3L C;  2EOD A;  1Z2Q A;  2LGG A;  2XOY A;  4F52 B;  1WFK A;  2CKL A;  4GB0 A;  2M1R A;  5FB1 A;  1CHC A;  2ECW A;  3LDY A;  5JG6 A;  2VPG A;  1JOC A;  3EB6 A;  2YU4 A;  2KKY A;  2VJE B;  5H1U A;  3KV6 A;  2E6S A;  2Y1M A;  3DQV R;  3FAN A;  2VPD A;  4W4U A;  2YUR A;  3O34 A;  2LGV A;  3M63 A;  2KWK A;  3T6R A;  4FJC A;  1WIL A;  2LXP C;  2H0D A;  3O70 A;  3HTK C;  1VFY A;  2CSZ A;  4QF2 A;  3U5N A;  5LKU A;  3LQI A;  1WEN A;  2K17 A;  1WEE A;  5AIU A;  1WE9 A;  4LJN A;  5B77 A;  4Z0R A;  2ECT A;  3DPL R;  5C13 A;  3FL2 A;  2UZG A;  4MSX A;  2FFW A;  1FBV A;  4WZ0 A;  5SVI B;  2LN0 A;  4A4C A;  3O36 A;  2M85 A;  5H1T A;  1V87 A;  2DJA A;  5LCW B;  5D1L B;  2HYE D;  4NN2 A;  3PLW A;  3SUB A;  2JM3 A;  3L1X A;  3L1Z B;  4N4F A;  3NG2 A;  1JM7 A;  3JUE A;  2YW8 A;  3U5O A;  2JRJ A;  3HCS A;  2L75 A;  2G6Q A;  2L43 A;  4YC9 A;  3C6W A;  1WEU A;  2CT2 A;  4R8P K;  2LRI C;  1MBM A;  4YBT A;  2YHO A;  4GNG A;  2NAA A;  5TAB A;  3ZPV 1;  4CCG X;  4AYC B;  2YHN A;  3M7K A;  2E61 A;  2Y43 A;  3SHB A;  3DDT A;  4UP0 A;  3PHD A;  4LAD B;  2KWO A;  3PUR A;  4S3O C;  5G05 B;  3N9O A;  2MT5 A;  1U6G B;  1WIM A;  2C2L A;  3SOW A;  4A4B A;  1HYJ A;  5KH7 A;  3RTR B;  3LVR E;  1VD4 A;  2Y1N A;  3HCU A;  2XEU A;  1WES A;  5B79 A;  5KH3 A;  4IC3 A;  3HCT A;  3QZV A;  3ZYQ A;  5LKT A;  2JMJ A;  4OGE A;  1RMD A;  5D1K B;  5G0F A;  2K16 A;  2JMI A;  4L7X A;  2D8S A;  2RR4 A;  2MA5 A;  5SVX A;  3IHP A;  4AUQ B;  4UI9 B;  3GL6 A;  1WEO A;  2AN6 A;  2MUM A;  3C5K A;  2IQJ A;  2YSM A;  3N9Q A;  4LK9 A;  3H7H A;  2ECN A;  5SVI A;  3T9K A;  3ZVZ B;  2MKE A;  2XOC A;  2MA6 A;  3RPG B;  3Q1D A;  3GV4 A;  2CSV A;  3FM8 C;  4PTB A;  2G43 A;  3N9P A;  5EYA F;  2M6M A;  2VJF B;  4H9D A;  2QIC A;  1MM3 A;  2LQ6 A;  2KE1 A;  3VK6 A;  1WGM A;  1DCQ A;  2FUI A;  4LLB A;  2ECJ A;  5H1V A;  3KQI A;  3RPG C;  4YAT A;  5DIN A;  5TRB A;  2F6J A;  3LRQ A;  4FK5 A;  4TKP B;  2DSM A;  5K3Q A;  2L80 A;  2LGL A;  2G45 A;  5I3L A;  2HDP A;  3N9M A;  4IC2 A;  5LKZ A;  3L11 A;  2LAU A;  4YAX A;  2LXH C;  1BOR A;  4FO9 A;  1X4U A;  1WEW A;  2DX8 A;  5B8D A;  4CA1 A;  2ECV A;  2OWA A;  4I7C A;  2VNF A;  3V43 A;  2FD4 A;  2ECG A;  2ZET C;  5DKA A;  2MNZ A;  3LVQ E;  2KIZ A;  5FB0 A;  1MM2 A;  5KH9 A;  1T1H A;  1ZBD B;  2B0O E;  4QQ4 A;  2YRE A;  3FEH A;  1K2F A;  4R7E A;  2I50 A;  1X4J A;  4O64 A;  5H9M A;  2VJE A;  3FJU B;  2YQL A;  2XP0 A;  1G25 A;  4A49 A;  2JMD A;  3PUQ A;  2K4D A;  3O33 A;  5SVY A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  1F62 A;  3ZVY A;  1X4I A;  1FP0 A;  2VJF A;  3N9N A;  5C11 A;  3SOX A;  2KR4 A;  1JM7 B;  2F42 A;  2EGP A;  3U5M A;  3KNV A;  4GNE A;  5J3X A;  5FER A;  4ZQL A;  2C2V S;  5B78 A;  4AP4 A;  1WEV A;  3MHH A;  2M3H A;  4V3K C;  2K1J A;  5B76 A;  2KRE A;  2EA6 A;  2KWN A;  2CSY A;  5TDR A;  1IYM A;  3ZTG A;  2L0B A;  3M99 A;  1HYI A;  4YBM A;  1WEP A;  4WZ2 A;  1E4U A;  4A0C D;  2PNX A;  4Q6F A;  5TDW A;  1LDJ B;  2KFT A;  4QF3 A;  1WEQ A;  4I7B A;  1Z60 A;  3N9L A;  4ZUX U;  5LKX A;  3U5P A;  4XI1 A;  2QIZ A;  2XB1 A;  4AYC A;  2QJ0 A;  2YUC A;  2BAY A;  3LQJ A;  3O7A A;  1Z6U A;  2VPE A;  3MHS A;  2CKL B;  2PUY A;  5AIT A;  4N3W A;  2YT5 A;  2YYR A;  5G04 B;  1DVP A;  4PPE A;  2KU3 A;  4C9Z A;  2YSJ A;  2LV9 A;  2RSD A;  1VYX A;  4L58 A;  3SOU A;  5TBN A;  3M62 A;  4BBQ A;  4B86 C;  4YAD A;  2H0D B;  5B75 A;  2MD8 C;  1LDK C;  2YQM A;  4P5O B;  3I2D A;  4WA6 A;  2KGI A;  1XWH A;  2MIQ A;  4S3O B;  4AVX A;  1WEM A;  2VP7 A;  4FIP A;  4GNF A;  2F6N A;  2E6R A;  3ZNI A;  4I7D A;  4MVT A;  3O37 A;  4LKA A;  4B7Y C;  4X3G A;  1N87 A;  5D1M B;  3ZPV E;  2FSA A;  2KYU A;  4UP5 A;  2KGG A;  4GND A;  5FEY A;  2VPB A;  3EB5 A;  4YAB A;  2L5U A;  3LQH A;  2IDA A;  3ASL A;  4YBS A;  2KWJ A;  4ZDT A;  2FUU A;  3T7L A;  2ECI A;  4WZ3 B;  4BHW A;  2OXQ C;  2MNY A;  3O35 A;  2LDR A;  2LGK A;  2RI7 A;  2MD7 B;  4R2Y A;  4V3L C;  2EOD A;  1Z2Q A;  2LGG A;  4F52 B;  1WFK A;  2CKL A;  4GB0 A;  2M1R A;  5FB1 A;  1CHC A;  2ECW A;  5JG6 A;  2VPG A;  1JOC A;  3EB6 A;  2YU4 A;  2VJE B;  5H1U A;  3KV6 A;  2E6S A;  2Y1M A;  3DQV R;  2VPD A;  4W4U A;  2YUR A;  3O34 A;  2LGV A;  3M63 A;  2KWK A;  3T6R A;  4FJC A;  1WIL A;  2LXP C;  2H0D A;  3O70 A;  3HTK C;  1VFY A;  2CSZ A;  4QF2 A;  3U5N A;  5LKU A;  3LQI A;  1WEN A;  2K17 A;  1WEE A;  5AIU A;  1WE9 A;  4LJN A;  5B77 A;  2ECT A;  3DPL R;  5C13 A;  3FL2 A;  2UZG A;  4MSX A;  1FBV A;  4WZ0 A;  2LN0 A;  4A4C A;  3O36 A;  2M85 A;  5H1T A;  1V87 A;  5LCW B;  5D1L B;  2HYE D;  4NN2 A;  3L1X A;  3L1Z B;  4N4F A;  3NG2 A;  1JM7 A;  2YW8 A;  3U5O A;  2JRJ A;  3HCS A;  2L75 A;  2G6Q A;  2L43 A;  4YC9 A;  3C6W A;  1WEU A;  2CT2 A;  4R8P K;  2LRI C;  4YBT A;  2YHO A;  4GNG A;  2NAA A;  5TAB A;  3ZPV 1;  4CCG X;  4AYC B;  2YHN A;  2Y43 A;  3SHB A;  4UP0 A;  3PHD A;  4LAD B;  2KWO A;  3PUR A;  4S3O C;  5G05 B;  3N9O A;  2MT5 A;  1U6G B;  1WIM A;  2C2L A;  3SOW A;  4A4B A;  1HYJ A;  5KH7 A;  3RTR B;  1VD4 A;  2Y1N A;  3HCU A;  2XEU A;  1WES A;  5B79 A;  5KH3 A;  4IC3 A;  3HCT A;  3QZV A;  3ZYQ A;  5LKT A;  2JMJ A;  1RMD A;  5D1K B;  5G0F A;  2K16 A;  2JMI A;  4L7X A;  2D8S A;  2MA5 A;  3IHP A;  4AUQ B;  4UI9 B;  3GL6 A;  1WEO A;  2AN6 A;  2MUM A;  3C5K A;  2YSM A;  3N9Q A;  4LK9 A;  2ECN A;  3ZVZ B;  2MA6 A;  3RPG B;  3GV4 A;  4PTB A;  2G43 A;  3N9P A;  5EYA F;  2M6M A;  2VJF B;  2QIC A;  1MM3 A;  2LQ6 A;  2KE1 A;  3VK6 A;  1WGM A;  2FUI A;  4LLB A;  2ECJ A;  5H1V A;  3KQI A;  3RPG C;  4YAT A;  5DIN A;  5TRB A;  2F6J A;  3LRQ A;  4FK5 A;  4TKP B;  2L80 A;  2LGL A;  2G45 A;  5I3L A;  2HDP A;  3N9M A;  4IC2 A;  5LKZ A;  3L11 A;  4YAX A;  2LXH C;  1BOR A;  4FO9 A;  1X4U A;  1WEW A;  2DX8 A;  5B8D A;  4CA1 A;  2ECV A;  4I7C A;  2VNF A;  3V43 A;  2ECG A;  2ZET C;  5DKA A;  2MNZ A;  2KIZ A;  5FB0 A;  1MM2 A;  5KH9 A;  1T1H A;  1ZBD B;  2YRE A;  1K2F A;  4R7E A;  2I50 A;  1X4J A;  4O64 A;  5H9M A;  2VJE A;  2YQL A;  1G25 A;  4A49 A;  2JMD A;  3PUQ A;  2K4D A;  3O33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...