4R8PK

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 23
structure length 105
sequence length 105
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r8pK00
2L43A 4AUQB 2C2VS 3LQJA 3PURA 3RPGB 5EYAF 4B7YC 3LRQA 1JM7B 2EA6A 2FUIA 1WEEA 2VJFA 5C13A 5KH9A 2ECGA 2YSMA 3N9LA 1T1HA 2LGKA 4GNFA 1BORA 4PTBA 2MUMA 2C2LA 3PHDA 1F62A 5B75A 5TDRA 1E4UA 5J3XA 5B78A 4V3KC 1WEUA 2MIQA 1U6GB 1WESA 2XB1A 2HYED 3FL2A 3SHBA 2L80A 2YU4A 2E6SA 2LV9A 3ZTGA 5LKXA 1XWHA 2YW8A 4QF2A 2IDAA 3DPLR 2F42A 2VJFB 3V43A 4TKPB 5G0FA 4GB0A 2EGPA 4Q6FA 2G6QA 3MHSA 2LRIC 4LLBA 3N9MA 5FB0A 4FO9A 4IC3A 3KQIA 2H0DB 5D1MB 2RI7A 3U5NA 5B77A 2JRJA 2KWNA 1FBVA 3VK6A 1MM2A 2DX8A 1Z6UA 4R2YA 2LN0A 3L1XA 3M62A 2VPGA 5AIUA 3U5PA 2LGVA 2Y1NA 2MT5A 2ECNA 5KH7A 5TABA 2K1JA 3C5KA 4O64A 2F6JA 1WEMA 2KU3A 3O35A 4ZQLA 2LXHC 3HCUA 2L0BA 2XEUA 2YYRA 3M99A 4N4FA 5LKTA 2K17A 1WFKA 4R8PK 2L5UA 4I7CA 3ASLA 1MM3A 1VD4A 4L58A 4GNGA 2K4DA 5G05B 3N9QA 4B86C 3QZVA 2YUCA 2LDRA 5TDWA 2YQMA 4AYCB 5G04B 1JOCA 5D1KB 1CHCA 1WE9A 2L75A 3GV4A 3M63A 3L11A 3N9NA 2LGGA 2LGLA 3ZPV1 1X4UA 5H9MA 5DINA 2Y43A 4YBTA 1WGMA 1DVPA 1Z2QA 2HDPA 4YAXA 3ZVZB 2FUUA 4FJCA 2VNFA 4WA6A 3ZNIA 4YADA 2Y1MA 4QF3A 1WILA 2D8SA 3IHPA 1WEWA 2KYUA 4UP0A 4XI1A 3T7LA 4S3OC 4A49A 4MVTA 2NAAA 3DQVR 5B79A 5TBNA 2G45A 4A4CA 5LKZA 2CSZA 5JG6A 3C6WA 2QIZA 2G43A 2MA6A 2UZGA 3T6RA 3O33A 4ZDTA 3MHHA 1N87A 3O37A 4I7BA 4LKAA 2CKLB 5DKAA 2M1RA 1LDKC 5FEYA 4YATA 2M3HA 2ZETC 2KE1A 2KR4A 2ECIA 5H1TA 5I3LA 2JMIA 4WZ3B 4UI9B 2YURA 1FP0A 4YABA 4A0CD 1WIMA 3KNVA 5TRBA 1VYXA 2CKLA 2KWKA 2MD7B 2YREA 3RPGC 4C9ZA 5H1UA 4GNEA 3KV5A 4BBQA 3ZPVE 2OXQC 4I7DA 4LK9A 4L7XA 5D1LB 3HCSA 3SOUA 4A4BA 2ECWA 3ZYQA 5LKUA 2KWJA 5FERA 2YT5A 2PNXA 2MNYA 4GNDA 1RMDA 1HYIA 4V3LC 4UP5A 2RSDA 2PUYA 1JM7A 3U5OA 5B8DA 4P5OB 5H1VA 4W4UA 2CSYA 5LCWB 5B76A 3RTRB 2FSAA 4ZUXU 2MD8C 2KFTA 3EB5A 4CA1A 1LDJB 1VFYA 2MA5A 3SOXA 3O34A 2VPEA 3KV6A 5C11A 2KGGA 2VPDA 3EB6A 2M85A 4BHWA 3U5MA 4PPEA 2JMJA 1WEOA 3N9PA 3O36A 3PUQA 4AP4A 3SOWA 3HCTA 1HYJA 2YSJA 4S3OB 1WEVA 4N3WA 1WEQA 2I50A 1WENA 2LXPC 3GL6A 3I2DA 1ZBDB 2EODA 2QJ0A 2YQLA 2AN6A 2LQ6A 2MNZA 1WEPA 4CCGX 4LJNA 5KH3A 2JMDA 1X4JA 1IYMA 2M6MA 5FB1A 2QICA 1X4IA 3LQIA 1K2FA 2ECTA 4YBSA 1G25A 2E6RA 4LADB 3LQHA 1V87A 4FK5A 4IC2A 3NG2A 4MSXA 4AVXA 2KWOA 4FIPA 3N9OA 2ECVA 2VJEB 2CT2A 2VP7A 4YC9A 3L1ZB 4F52B 2ECJA 2KREA 4AYCA 3O70A 3O7AA 2F6NA 1Z60A 4NN2A 4WZ2A 3ZVYA 2VPBA 2K16A 2BAYA 2YHNA 2KGIA 4YBMA 3HTKC 2VJEA 4X3GA 2KIZA 2H0DA 4WZ0A 5AITA 4R7EA 2YHOA
chains in the Genus database with same CATH superfamily
2L43A 4AUQB 2C2VS 3LQJA 3PURA 3M7KA 2DJAA 3RPGB 3T9KA 5EYAF 3LDYA 4B7YC 3LRQA 2RR4A 1JM7B 2EA6A 2FUIA 1WEEA 2VJFA 5C13A 5KH9A 2ECGA 2YSMA 3N9LA 1T1HA 3H7HA 2LGKA 4GNFA 1BORA 4PTBA 2MUMA 2C2LA 3Q1DA 3PHDA 1F62A 5B75A 5TDRA 1E4UA 5J3XA 5B78A 4V3KC 3SUBA 1WEUA 2MIQA 1U6GB 1WESA 2XB1A 3FL2A 2HYED 2XOZA 2L80A 3SHBA 2YU4A 2E6SA 2LV9A 3ZTGA 5LKXA 1XWHA 2YW8A 4QF2A 2IDAA 3DPLR 2F42A 2VJFB 3V43A 4TKPB 3LJUX 5G0FA 4GB0A 5SVYA 2EGPA 4Q6FA 2IQJA 2G6QA 3MHSA 2LRIC 4LLBA 3N9MA 5FB0A 4FO9A 4IC3A 3KQIA 2H0DB 5D1MB 2RI7A 3FEHA 3U5NA 5B77A 2JRJA 2KWNA 2EGMA 1FBVA 3VK6A 2CONA 1MM2A 2DX8A 1Z6UA 4R2YA 2LN0A 3L1XA 3M62A 2VPGA 5AIUA 3U5PA 2LGVA 2Y1NA 3O47A 2MT5A 2M13A 2ECNA 2XOYA 3FAOA 5KH7A 2JM3A 5TABA 2K1JA 3C5KA 3DDTA 4O64A 2F6JA 1WEMA 2KU3A 3O35A 4ZQLA 2LXHC 3HCUA 2L0BA 2EXUA 2XEUA 2YYRA 3M99A 2OWAA 4N4FA 5LKTA 2K17A 1WFKA 4R8PK 2L5UA 4I7CA 3ASLA 1MM3A 1VD4A 4L58A 4GNGA 2K4DA 5G05B 3N9QA 4B86C 3QZVA 2YUCA 2LDRA 5TDWA 2YQMA 4AYCB 5G04B 1JOCA 5D1KB 1CHCA 1WE9A 3FJUB 3MDBC 3E2DA 2L75A 3GV4A 3M63A 3L11A 3N9NA 2LGGA 2LGLA 3ZPV1 1X4UA 5H9MA 5DINA 2Y43A 4YBTA 1DCQA 4QQ4A 1WGMA 1DVPA 2XP0A 1Z2QA 2HDPA 4YAXA 3ZVZB 2FUUA 4F1PA 4FJCA 2VNFA 4WA6A 3ZNIA 2JUNA 4YADA 2Y1MA 4QF3A 1WILA 2D8SA 3IHPA 4Z0OA 1WEWA 2KYUA 4UP0A 4XI1A 3T7LA 4S3OC 4A49A 4MVTA 2NAAA 3DQVR 5B79A 5TBNA 2G45A 4H9DA 4A4CA 5LKZA 1MBMA 2CSZA 5K3QA 5JG6A 3C6WA 2E61A 2QIZA 2G43A 2MA6A 2UZGA 3T6RA 3O33A 4ZDTA 3MHHA 5SVIA 1N87A 3O37A 4I7BA 4OGEA 3FANA 4LKAA 2CKLB 5DKAA 2M1RA 1LDKC 2CRWA 2L7PA 5FEYA 4YATA 2M3HA 2ZETC 2KE1A 2KR4A 2ECIA 5H1TA 5I3LA 2JMIA 4WZ3B 4UI9B 2YURA 1FP0A 4YABA 4A0CD 1WIMA 3KNVA 5TRBA 1VYXA 2CSVA 2CKLA 2KWKA 2MD7B 2YREA 3RPGC 4C9ZA 2LAUA 5H1UA 4GNEA 3KV5A 4BBQA 3ZPVE 2OXQC 3DWDA 4I7DA 4LK9A 2FD4A 4L7XA 3PLWA 5D1LB 2CRRA 3HCSA 3SOUA 4A4BA 2ECWA 3ZYQA 5LKUA 2KWJA 5FERA 2YT5A 2PNXA 2P57A 2DSMA 5SVIB 2FFWA 2MNYA 4GNDA 1RMDA 1HYIA 4V3LC 4UP5A 2RSDA 2PUYA 1JM7A 3U5OA 5B8DA 4P5OB 5H1VA 3JUEA 4W4UA 2CSYA 5LCWB 3LVQE 5B76A 3RTRB 2FSAA 4ZUXU 2MD8C 2KFTA 3EB5A 4CA1A 1LDJB 1VFYA 2MA5A 3SOXA 3O34A 2VPEA 3KV6A 5C11A 2KGGA 2VPDA 3EB6A 2M85A 4BHWA 3U5MA 4PPEA 2JMJA 1WEOA 3N9PA 2MKEA 2KKXA 2YVRA 3O36A 3PUQA 4AP4A 3SOWA 3HCTA 1HYJA 2YSJA 4S3OB 2D8UA 1WEVA 4O62A 4N3WA 1WEQA 2I50A 3KDEC 1WENA 2LXPC 3GL6A 3I2DA 1ZBDB 2B0OE 2EODA 2QJ0A 2YQLA 4OGCA 2AN6A 2LQ6A 2MNZA 1WEPA 4CCGX 4LJNA 5KH3A 2JMDA 1X4JA 1IYMA 2M6MA 5FB1A 2QICA 1X4IA 3LQIA 1K2FA 2ECTA 4YBSA 1G25A 2E6RA 4LADB 3LQHA 1V87A 2KKYA 4FK5A 4IC2A 3NG2A 4MSXA 4AVXA 2KWOA 3FM8C 4FIPA 2XOCA 3N9OA 2ECVA 2VJEB 2CT2A 2VP7A 4YC9A 3L1ZB 4F52B 2ECJA 2KREA 5SVXA 4AYCA 3O70A 3O7AA 2F6NA 1Z60A 4NN2A 4WZ2A 3ZVYA 2VPBA 2K16A 2BAYA 2YHNA 4Z0RA 2KGIA 4YBMA 3LVRE 3HTKC 2VJEA 4X3GA 2KIZA 2H0DA 4WZ0A 5AITA 4R7EA 2YHOA
chains in the Genus database with same CATH topology
2L43A 4AUQB 2C2VS 3LQJA 3PURA 3RPGB 5EYAF 4B7YC 3LRQA 1JM7B 2EA6A 2FUIA 1WEEA 2VJFA 5C13A 5KH9A 2ECGA 2YSMA 3N9LA 1T1HA 2LGKA 4GNFA 1BORA 4PTBA 2MUMA 2C2LA 3PHDA 1F62A 5B75A 5TDRA 1E4UA 5J3XA 5B78A 4V3KC 1WEUA 2MIQA 1U6GB 1WESA 2XB1A 2HYED 3FL2A 3SHBA 2L80A 2YU4A 2E6SA 2LV9A 3ZTGA 5LKXA 1XWHA 2YW8A 4QF2A 2IDAA 3DPLR 2F42A 2VJFB 3V43A 4TKPB 5G0FA 4GB0A 2EGPA 4Q6FA 2G6QA 3MHSA 2LRIC 4LLBA 3N9MA 5FB0A 4FO9A 4IC3A 3KQIA 2H0DB 5D1MB 2RI7A 3U5NA 5B77A 2JRJA 2KWNA 1FBVA 3VK6A 1MM2A 2DX8A 1Z6UA 4R2YA 2LN0A 3L1XA 3M62A 2VPGA 5AIUA 3U5PA 2LGVA 2Y1NA 2MT5A 2ECNA 5KH7A 5TABA 2K1JA 3C5KA 4O64A 2F6JA 1WEMA 2KU3A 3O35A 4ZQLA 2LXHC 3HCUA 2L0BA 2XEUA 2YYRA 3M99A 4N4FA 5LKTA 2K17A 1WFKA 4R8PK 2L5UA 4I7CA 3ASLA 1MM3A 1VD4A 4L58A 4GNGA 2K4DA 5G05B 3N9QA 4B86C 3QZVA 2YUCA 2LDRA 5TDWA 2YQMA 4AYCB 5G04B 1JOCA 5D1KB 1CHCA 1WE9A 2L75A 3GV4A 3M63A 3L11A 3N9NA 2LGGA 2LGLA 3ZPV1 1X4UA 5H9MA 5DINA 2Y43A 4YBTA 1WGMA 1DVPA 1Z2QA 2HDPA 4YAXA 3ZVZB 2FUUA 4FJCA 2VNFA 4WA6A 3ZNIA 4YADA 2Y1MA 4QF3A 1WILA 2D8SA 3IHPA 1WEWA 2KYUA 4UP0A 4XI1A 3T7LA 4S3OC 4A49A 4MVTA 2NAAA 3DQVR 5B79A 5TBNA 2G45A 4A4CA 5LKZA 2CSZA 5JG6A 3C6WA 2QIZA 2G43A 2MA6A 2UZGA 3T6RA 3O33A 4ZDTA 3MHHA 1N87A 3O37A 4I7BA 4LKAA 2CKLB 5DKAA 2M1RA 1LDKC 5FEYA 4YATA 2M3HA 2ZETC 2KE1A 2KR4A 2ECIA 5H1TA 5I3LA 2JMIA 4WZ3B 4UI9B 2YURA 1FP0A 4YABA 4A0CD 1WIMA 3KNVA 5TRBA 1VYXA 2CKLA 2KWKA 2MD7B 2YREA 3RPGC 4C9ZA 5H1UA 4GNEA 3KV5A 4BBQA 3ZPVE 2OXQC 4I7DA 4LK9A 4L7XA 5D1LB 3HCSA 3SOUA 4A4BA 2ECWA 3ZYQA 5LKUA 2KWJA 5FERA 2YT5A 2PNXA 2MNYA 4GNDA 1RMDA 1HYIA 4V3LC 4UP5A 2RSDA 2PUYA 1JM7A 3U5OA 5B8DA 4P5OB 5H1VA 4W4UA 2CSYA 5LCWB 5B76A 3RTRB 2FSAA 4ZUXU 2MD8C 2KFTA 3EB5A 4CA1A 1LDJB 1VFYA 2MA5A 3SOXA 3O34A 2VPEA 3KV6A 5C11A 2KGGA 2VPDA 3EB6A 2M85A 4BHWA 3U5MA 4PPEA 2JMJA 1WEOA 3N9PA 3O36A 3PUQA 4AP4A 3SOWA 3HCTA 1HYJA 2YSJA 4S3OB 1WEVA 4N3WA 1WEQA 2I50A 1WENA 2LXPC 3GL6A 3I2DA 1ZBDB 2EODA 2QJ0A 2YQLA 2AN6A 2LQ6A 2MNZA 1WEPA 4CCGX 4LJNA 5KH3A 2JMDA 1X4JA 1IYMA 2M6MA 5FB1A 2QICA 1X4IA 3LQIA 1K2FA 2ECTA 4YBSA 1G25A 2E6RA 4LADB 3LQHA 1V87A 4FK5A 4IC2A 3NG2A 4MSXA 4AVXA 2KWOA 4FIPA 3N9OA 2ECVA 2VJEB 2CT2A 2VP7A 4YC9A 3L1ZB 4F52B 2ECJA 2KREA 4AYCA 3O70A 3O7AA 2F6NA 1Z60A 4NN2A 4WZ2A 3ZVYA 2VPBA 2K16A 2BAYA 2YHNA 2KGIA 4YBMA 3HTKC 2VJEA 4X3GA 2KIZA 2H0DA 4WZ0A 5AITA 4R7EA 2YHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L43 A;  4AUQ B;  2C2V S;  3LQJ A;  3PUR A;  3RPG B;  5EYA F;  4B7Y C;  3LRQ A;  1JM7 B;  2EA6 A;  2FUI A;  1WEE A;  2VJF A;  5C13 A;  5KH9 A;  2ECG A;  2YSM A;  3N9L A;  1T1H A;  2LGK A;  4GNF A;  1BOR A;  4PTB A;  2MUM A;  2C2L A;  3PHD A;  1F62 A;  5B75 A;  5TDR A;  1E4U A;  5J3X A;  5B78 A;  4V3K C;  1WEU A;  2MIQ A;  1U6G B;  1WES A;  2XB1 A;  2HYE D;  3FL2 A;  3SHB A;  2L80 A;  2YU4 A;  2E6S A;  2LV9 A;  3ZTG A;  5LKX A;  1XWH A;  2YW8 A;  4QF2 A;  2IDA A;  3DPL R;  2F42 A;  2VJF B;  3V43 A;  4TKP B;  5G0F A;  4GB0 A;  2EGP A;  4Q6F A;  2G6Q A;  3MHS A;  2LRI C;  4LLB A;  3N9M A;  5FB0 A;  4FO9 A;  4IC3 A;  3KQI A;  2H0D B;  5D1M B;  2RI7 A;  3U5N A;  5B77 A;  2JRJ A;  2KWN A;  1FBV A;  3VK6 A;  1MM2 A;  2DX8 A;  1Z6U A;  4R2Y A;  2LN0 A;  3L1X A;  3M62 A;  2VPG A;  5AIU A;  3U5P A;  2LGV A;  2Y1N A;  2MT5 A;  2ECN A;  5KH7 A;  5TAB A;  2K1J A;  3C5K A;  4O64 A;  2F6J A;  1WEM A;  2KU3 A;  3O35 A;  4ZQL A;  2LXH C;  3HCU A;  2L0B A;  2XEU A;  2YYR A;  3M99 A;  4N4F A;  5LKT A;  2K17 A;  1WFK A;  4R8P K;  2L5U A;  4I7C A;  3ASL A;  1MM3 A;  1VD4 A;  4L58 A;  4GNG A;  2K4D A;  5G05 B;  3N9Q A;  4B86 C;  3QZV A;  2YUC A;  2LDR A;  5TDW A;  2YQM A;  4AYC B;  5G04 B;  1JOC A;  5D1K B;  1CHC A;  1WE9 A;  2L75 A;  3GV4 A;  3M63 A;  3L11 A;  3N9N A;  2LGG A;  2LGL A;  3ZPV 1;  1X4U A;  5H9M A;  5DIN A;  2Y43 A;  4YBT A;  1WGM A;  1DVP A;  1Z2Q A;  2HDP A;  4YAX A;  3ZVZ B;  2FUU A;  4FJC A;  2VNF A;  4WA6 A;  3ZNI A;  4YAD A;  2Y1M A;  4QF3 A;  1WIL A;  2D8S A;  3IHP A;  1WEW A;  2KYU A;  4UP0 A;  4XI1 A;  3T7L A;  4S3O C;  4A49 A;  4MVT A;  2NAA A;  3DQV R;  5B79 A;  5TBN A;  2G45 A;  4A4C A;  5LKZ A;  2CSZ A;  5JG6 A;  3C6W A;  2QIZ A;  2G43 A;  2MA6 A;  2UZG A;  3T6R A;  3O33 A;  4ZDT A;  3MHH A;  1N87 A;  3O37 A;  4I7B A;  4LKA A;  2CKL B;  5DKA A;  2M1R A;  1LDK C;  5FEY A;  4YAT A;  2M3H A;  2ZET C;  2KE1 A;  2KR4 A;  2ECI A;  5H1T A;  5I3L A;  2JMI A;  4WZ3 B;  4UI9 B;  2YUR A;  1FP0 A;  4YAB A;  4A0C D;  1WIM A;  3KNV A;  5TRB A;  1VYX A;  2CKL A;  2KWK A;  2MD7 B;  2YRE A;  3RPG C;  4C9Z A;  5H1U A;  4GNE A;  3KV5 A;  4BBQ A;  3ZPV E;  2OXQ C;  4I7D A;  4LK9 A;  4L7X A;  5D1L B;  3HCS A;  3SOU A;  4A4B A;  2ECW A;  3ZYQ A;  5LKU A;  2KWJ A;  5FER A;  2YT5 A;  2PNX A;  2MNY A;  4GND A;  1RMD A;  1HYI A;  4V3L C;  4UP5 A;  2RSD A;  2PUY A;  1JM7 A;  3U5O A;  5B8D A;  4P5O B;  5H1V A;  4W4U A;  2CSY A;  5LCW B;  5B76 A;  3RTR B;  2FSA A;  4ZUX U;  2MD8 C;  2KFT A;  3EB5 A;  4CA1 A;  1LDJ B;  1VFY A;  2MA5 A;  3SOX A;  3O34 A;  2VPE A;  3KV6 A;  5C11 A;  2KGG A;  2VPD A;  3EB6 A;  2M85 A;  4BHW A;  3U5M A;  4PPE A;  2JMJ A;  1WEO A;  3N9P A;  3O36 A;  3PUQ A;  4AP4 A;  3SOW A;  3HCT A;  1HYJ A;  2YSJ A;  4S3O B;  1WEV A;  4N3W A;  1WEQ A;  2I50 A;  1WEN A;  2LXP C;  3GL6 A;  3I2D A;  1ZBD B;  2EOD A;  2QJ0 A;  2YQL A;  2AN6 A;  2LQ6 A;  2MNZ A;  1WEP A;  4CCG X;  4LJN A;  5KH3 A;  2JMD A;  1X4J A;  1IYM A;  2M6M A;  5FB1 A;  2QIC A;  1X4I A;  3LQI A;  1K2F A;  2ECT A;  4YBS A;  1G25 A;  2E6R A;  4LAD B;  3LQH A;  1V87 A;  4FK5 A;  4IC2 A;  3NG2 A;  4MSX A;  4AVX A;  2KWO A;  4FIP A;  3N9O A;  2ECV A;  2VJE B;  2CT2 A;  2VP7 A;  4YC9 A;  3L1Z B;  4F52 B;  2ECJ A;  2KRE A;  4AYC A;  3O70 A;  3O7A A;  2F6N A;  1Z60 A;  4NN2 A;  4WZ2 A;  3ZVY A;  2VPB A;  2K16 A;  2BAY A;  2YHN A;  2KGI A;  4YBM A;  3HTK C;  2VJE A;  4X3G A;  2KIZ A;  2H0D A;  4WZ0 A;  5AIT A;  4R7E A;  2YHO A; 
#chains in the Genus database with same CATH topology
 2L43 A;  4AUQ B;  2C2V S;  3LQJ A;  3PUR A;  3M7K A;  2DJA A;  3RPG B;  3T9K A;  5EYA F;  3LDY A;  4B7Y C;  3LRQ A;  2RR4 A;  1JM7 B;  2EA6 A;  2FUI A;  1WEE A;  2VJF A;  5C13 A;  5KH9 A;  2ECG A;  2YSM A;  3N9L A;  1T1H A;  3H7H A;  2LGK A;  4GNF A;  1BOR A;  4PTB A;  2MUM A;  2C2L A;  3Q1D A;  3PHD A;  1F62 A;  5B75 A;  5TDR A;  1E4U A;  5J3X A;  5B78 A;  4V3K C;  3SUB A;  1WEU A;  2MIQ A;  1U6G B;  1WES A;  2XB1 A;  3FL2 A;  2HYE D;  2XOZ A;  2L80 A;  3SHB A;  2YU4 A;  2E6S A;  2LV9 A;  3ZTG A;  5LKX A;  1XWH A;  2YW8 A;  4QF2 A;  2IDA A;  3DPL R;  2F42 A;  2VJF B;  3V43 A;  4TKP B;  3LJU X;  5G0F A;  4GB0 A;  5SVY A;  2EGP A;  4Q6F A;  2IQJ A;  2G6Q A;  3MHS A;  2LRI C;  4LLB A;  3N9M A;  5FB0 A;  4FO9 A;  4IC3 A;  3KQI A;  2H0D B;  5D1M B;  2RI7 A;  3FEH A;  3U5N A;  5B77 A;  2JRJ A;  2KWN A;  2EGM A;  1FBV A;  3VK6 A;  2CON A;  1MM2 A;  2DX8 A;  1Z6U A;  4R2Y A;  2LN0 A;  3L1X A;  3M62 A;  2VPG A;  5AIU A;  3U5P A;  2LGV A;  2Y1N A;  3O47 A;  2MT5 A;  2M13 A;  2ECN A;  2XOY A;  3FAO A;  5KH7 A;  2JM3 A;  5TAB A;  2K1J A;  3C5K A;  3DDT A;  4O64 A;  2F6J A;  1WEM A;  2KU3 A;  3O35 A;  4ZQL A;  2LXH C;  3HCU A;  2L0B A;  2EXU A;  2XEU A;  2YYR A;  3M99 A;  2OWA A;  4N4F A;  5LKT A;  2K17 A;  1WFK A;  4R8P K;  2L5U A;  4I7C A;  3ASL A;  1MM3 A;  1VD4 A;  4L58 A;  4GNG A;  2K4D A;  5G05 B;  3N9Q A;  4B86 C;  3QZV A;  2YUC A;  2LDR A;  5TDW A;  2YQM A;  4AYC B;  5G04 B;  1JOC A;  5D1K B;  1CHC A;  1WE9 A;  3FJU B;  3MDB C;  3E2D A;  2L75 A;  3GV4 A;  3M63 A;  3L11 A;  3N9N A;  2LGG A;  2LGL A;  3ZPV 1;  1X4U A;  5H9M A;  5DIN A;  2Y43 A;  4YBT A;  1DCQ A;  4QQ4 A;  1WGM A;  1DVP A;  2XP0 A;  1Z2Q A;  2HDP A;  4YAX A;  3ZVZ B;  2FUU A;  4F1P A;  4FJC A;  2VNF A;  4WA6 A;  3ZNI A;  2JUN A;  4YAD A;  2Y1M A;  4QF3 A;  1WIL A;  2D8S A;  3IHP A;  4Z0O A;  1WEW A;  2KYU A;  4UP0 A;  4XI1 A;  3T7L A;  4S3O C;  4A49 A;  4MVT A;  2NAA A;  3DQV R;  5B79 A;  5TBN A;  2G45 A;  4H9D A;  4A4C A;  5LKZ A;  1MBM A;  2CSZ A;  5K3Q A;  5JG6 A;  3C6W A;  2E61 A;  2QIZ A;  2G43 A;  2MA6 A;  2UZG A;  3T6R A;  3O33 A;  4ZDT A;  3MHH A;  5SVI A;  1N87 A;  3O37 A;  4I7B A;  4OGE A;  3FAN A;  4LKA A;  2CKL B;  5DKA A;  2M1R A;  1LDK C;  2CRW A;  2L7P A;  5FEY A;  4YAT A;  2M3H A;  2ZET C;  2KE1 A;  2KR4 A;  2ECI A;  5H1T A;  5I3L A;  2JMI A;  4WZ3 B;  4UI9 B;  2YUR A;  1FP0 A;  4YAB A;  4A0C D;  1WIM A;  3KNV A;  5TRB A;  1VYX A;  2CSV A;  2CKL A;  2KWK A;  2MD7 B;  2YRE A;  3RPG C;  4C9Z A;  2LAU A;  5H1U A;  4GNE A;  3KV5 A;  4BBQ A;  3ZPV E;  2OXQ C;  3DWD A;  4I7D A;  4LK9 A;  2FD4 A;  4L7X A;  3PLW A;  5D1L B;  2CRR A;  3HCS A;  3SOU A;  4A4B A;  2ECW A;  3ZYQ A;  5LKU A;  2KWJ A;  5FER A;  2YT5 A;  2PNX A;  2P57 A;  2DSM A;  5SVI B;  2FFW A;  2MNY A;  4GND A;  1RMD A;  1HYI A;  4V3L C;  4UP5 A;  2RSD A;  2PUY A;  1JM7 A;  3U5O A;  5B8D A;  4P5O B;  5H1V A;  3JUE A;  4W4U A;  2CSY A;  5LCW B;  3LVQ E;  5B76 A;  3RTR B;  2FSA A;  4ZUX U;  2MD8 C;  2KFT A;  3EB5 A;  4CA1 A;  1LDJ B;  1VFY A;  2MA5 A;  3SOX A;  3O34 A;  2VPE A;  3KV6 A;  5C11 A;  2KGG A;  2VPD A;  3EB6 A;  2M85 A;  4BHW A;  3U5M A;  4PPE A;  2JMJ A;  1WEO A;  3N9P A;  2MKE A;  2KKX A;  2YVR A;  3O36 A;  3PUQ A;  4AP4 A;  3SOW A;  3HCT A;  1HYJ A;  2YSJ A;  4S3O B;  2D8U A;  1WEV A;  4O62 A;  4N3W A;  1WEQ A;  2I50 A;  3KDE C;  1WEN A;  2LXP C;  3GL6 A;  3I2D A;  1ZBD B;  2B0O E;  2EOD A;  2QJ0 A;  2YQL A;  4OGC A;  2AN6 A;  2LQ6 A;  2MNZ A;  1WEP A;  4CCG X;  4LJN A;  5KH3 A;  2JMD A;  1X4J A;  1IYM A;  2M6M A;  5FB1 A;  2QIC A;  1X4I A;  3LQI A;  1K2F A;  2ECT A;  4YBS A;  1G25 A;  2E6R A;  4LAD B;  3LQH A;  1V87 A;  2KKY A;  4FK5 A;  4IC2 A;  3NG2 A;  4MSX A;  4AVX A;  2KWO A;  3FM8 C;  4FIP A;  2XOC A;  3N9O A;  2ECV A;  2VJE B;  2CT2 A;  2VP7 A;  4YC9 A;  3L1Z B;  4F52 B;  2ECJ A;  2KRE A;  5SVX A;  4AYC A;  3O70 A;  3O7A A;  2F6N A;  1Z60 A;  4NN2 A;  4WZ2 A;  3ZVY A;  2VPB A;  2K16 A;  2BAY A;  2YHN A;  4Z0R A;  2KGI A;  4YBM A;  3LVR E;  3HTK C;  2VJE A;  4X3G A;  2KIZ A;  2H0D A;  4WZ0 A;  5AIT A;  4R7E A;  2YHO A; 
#chains in the Genus database with same CATH homology
 2L43 A;  4AUQ B;  2C2V S;  3LQJ A;  3PUR A;  3RPG B;  5EYA F;  4B7Y C;  3LRQ A;  1JM7 B;  2EA6 A;  2FUI A;  1WEE A;  2VJF A;  5C13 A;  5KH9 A;  2ECG A;  2YSM A;  3N9L A;  1T1H A;  2LGK A;  4GNF A;  1BOR A;  4PTB A;  2MUM A;  2C2L A;  3PHD A;  1F62 A;  5B75 A;  5TDR A;  1E4U A;  5J3X A;  5B78 A;  4V3K C;  1WEU A;  2MIQ A;  1U6G B;  1WES A;  2XB1 A;  2HYE D;  3FL2 A;  3SHB A;  2L80 A;  2YU4 A;  2E6S A;  2LV9 A;  3ZTG A;  5LKX A;  1XWH A;  2YW8 A;  4QF2 A;  2IDA A;  3DPL R;  2F42 A;  2VJF B;  3V43 A;  4TKP B;  5G0F A;  4GB0 A;  2EGP A;  4Q6F A;  2G6Q A;  3MHS A;  2LRI C;  4LLB A;  3N9M A;  5FB0 A;  4FO9 A;  4IC3 A;  3KQI A;  2H0D B;  5D1M B;  2RI7 A;  3U5N A;  5B77 A;  2JRJ A;  2KWN A;  1FBV A;  3VK6 A;  1MM2 A;  2DX8 A;  1Z6U A;  4R2Y A;  2LN0 A;  3L1X A;  3M62 A;  2VPG A;  5AIU A;  3U5P A;  2LGV A;  2Y1N A;  2MT5 A;  2ECN A;  5KH7 A;  5TAB A;  2K1J A;  3C5K A;  4O64 A;  2F6J A;  1WEM A;  2KU3 A;  3O35 A;  4ZQL A;  2LXH C;  3HCU A;  2L0B A;  2XEU A;  2YYR A;  3M99 A;  4N4F A;  5LKT A;  2K17 A;  1WFK A;  4R8P K;  2L5U A;  4I7C A;  3ASL A;  1MM3 A;  1VD4 A;  4L58 A;  4GNG A;  2K4D A;  5G05 B;  3N9Q A;  4B86 C;  3QZV A;  2YUC A;  2LDR A;  5TDW A;  2YQM A;  4AYC B;  5G04 B;  1JOC A;  5D1K B;  1CHC A;  1WE9 A;  2L75 A;  3GV4 A;  3M63 A;  3L11 A;  3N9N A;  2LGG A;  2LGL A;  3ZPV 1;  1X4U A;  5H9M A;  5DIN A;  2Y43 A;  4YBT A;  1WGM A;  1DVP A;  1Z2Q A;  2HDP A;  4YAX A;  3ZVZ B;  2FUU A;  4FJC A;  2VNF A;  4WA6 A;  3ZNI A;  4YAD A;  2Y1M A;  4QF3 A;  1WIL A;  2D8S A;  3IHP A;  1WEW A;  2KYU A;  4UP0 A;  4XI1 A;  3T7L A;  4S3O C;  4A49 A;  4MVT A;  2NAA A;  3DQV R;  5B79 A;  5TBN A;  2G45 A;  4A4C A;  5LKZ A;  2CSZ A;  5JG6 A;  3C6W A;  2QIZ A;  2G43 A;  2MA6 A;  2UZG A;  3T6R A;  3O33 A;  4ZDT A;  3MHH A;  1N87 A;  3O37 A;  4I7B A;  4LKA A;  2CKL B;  5DKA A;  2M1R A;  1LDK C;  5FEY A;  4YAT A;  2M3H A;  2ZET C;  2KE1 A;  2KR4 A;  2ECI A;  5H1T A;  5I3L A;  2JMI A;  4WZ3 B;  4UI9 B;  2YUR A;  1FP0 A;  4YAB A;  4A0C D;  1WIM A;  3KNV A;  5TRB A;  1VYX A;  2CKL A;  2KWK A;  2MD7 B;  2YRE A;  3RPG C;  4C9Z A;  5H1U A;  4GNE A;  3KV5 A;  4BBQ A;  3ZPV E;  2OXQ C;  4I7D A;  4LK9 A;  4L7X A;  5D1L B;  3HCS A;  3SOU A;  4A4B A;  2ECW A;  3ZYQ A;  5LKU A;  2KWJ A;  5FER A;  2YT5 A;  2PNX A;  2MNY A;  4GND A;  1RMD A;  1HYI A;  4V3L C;  4UP5 A;  2RSD A;  2PUY A;  1JM7 A;  3U5O A;  5B8D A;  4P5O B;  5H1V A;  4W4U A;  2CSY A;  5LCW B;  5B76 A;  3RTR B;  2FSA A;  4ZUX U;  2MD8 C;  2KFT A;  3EB5 A;  4CA1 A;  1LDJ B;  1VFY A;  2MA5 A;  3SOX A;  3O34 A;  2VPE A;  3KV6 A;  5C11 A;  2KGG A;  2VPD A;  3EB6 A;  2M85 A;  4BHW A;  3U5M A;  4PPE A;  2JMJ A;  1WEO A;  3N9P A;  3O36 A;  3PUQ A;  4AP4 A;  3SOW A;  3HCT A;  1HYJ A;  2YSJ A;  4S3O B;  1WEV A;  4N3W A;  1WEQ A;  2I50 A;  1WEN A;  2LXP C;  3GL6 A;  3I2D A;  1ZBD B;  2EOD A;  2QJ0 A;  2YQL A;  2AN6 A;  2LQ6 A;  2MNZ A;  1WEP A;  4CCG X;  4LJN A;  5KH3 A;  2JMD A;  1X4J A;  1IYM A;  2M6M A;  5FB1 A;  2QIC A;  1X4I A;  3LQI A;  1K2F A;  2ECT A;  4YBS A;  1G25 A;  2E6R A;  4LAD B;  3LQH A;  1V87 A;  4FK5 A;  4IC2 A;  3NG2 A;  4MSX A;  4AVX A;  2KWO A;  4FIP A;  3N9O A;  2ECV A;  2VJE B;  2CT2 A;  2VP7 A;  4YC9 A;  3L1Z B;  4F52 B;  2ECJ A;  2KRE A;  4AYC A;  3O70 A;  3O7A A;  2F6N A;  1Z60 A;  4NN2 A;  4WZ2 A;  3ZVY A;  2VPB A;  2K16 A;  2BAY A;  2YHN A;  2KGI A;  4YBM A;  3HTK C;  2VJE A;  4X3G A;  2KIZ A;  2H0D A;  4WZ0 A;  5AIT A;  4R7E A;  2YHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...