4R8PK

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 23
structure length 105
sequence length 105
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r8pK00
1JM7A 4NN2A 5LKTA 1WEEA 3ZVYA 4A0CD 5AITA 2YT5A 4WA6A 5B77A 4A4CA 3RPGB 2F42A 4LK9A 2K16A 1BORA 2YHOA 4AUQB 2VJFA 4R2YA 2HDPA 1Z60A 3NG2A 2MIQA 3V43A 4ZUXU 5D1KB 2HYED 2LQ6A 4V3KC 2ECTA 2KE1A 3PUQA 1WEOA 4R8PK 2C2VS 2VJEB 4I7BA 2Y1NA 1F62A 1E4UA 2K4DA 3LQJA 5TABA 4UI9B 2CT2A 4GNFA 2G43A 2MA5A 2YURA 3SOUA 5EYAF 5KH9A 4WZ0A 2EA6A 1Z2QA 3GL6A 5TDWA 2KU3A 2L43A 3QZVA 2RI7A 3KQIA 2FUIA 2ECJA 5TRBA 2YYRA 3ZPVE 2G45A 3EB5A 2KREA 3L1ZB 4GB0A 2L80A 4GNDA 2VPGA 4F52B 4YADA 4YBTA 4LKAA 5LKZA 2ECVA 2H0DA 2VNFA 2CSZA 4WZ3B 2D8SA 1WE9A 2YQMA 3O33A 1WESA 3O70A 2M3HA 1X4IA 1HYJA 2C2LA 4WZ2A 3C5KA 3T7LA 4UP5A 4MSXA 3U5PA 3SHBA 3ZYQA 2H0DB 5FEYA 4P5OB 4B86C 3C6WA 4I7CA 4N3WA 1VD4A 2Y43A 4GNEA 1V87A 5G04B 2KWOA 4MVTA 3ZNIA 1VFYA 2NAAA 2YREA 2KIZA 5J3XA 1WEWA 1X4JA 4O64A 3SOWA 3IHPA 2QIZA 4YBSA 2YHNA 2LGGA 3KV5A 1WENA 3LRQA 3ZTGA 3DQVR 4CA1A 5B76A 5G0FA 4QF2A 4IC2A 5KH3A 5DKAA 3O7AA 2KWNA 1CHCA 3DPLR 4FK5A 3RPGC 2KWJA 2FUUA 1WEQA 5TDRA 1G25A 2VJEA 4I7DA 3ASLA 2CKLA 2MA6A 2ECIA 2LRIC 3M63A 3ZVZB 2LGVA 4UP0A 2VPDA 2PNXA 2LV9A 4GNGA 4PPEA 2MNYA 2CKLB 2VPBA 2KR4A 2VJFB 2ZETC 4AYCB 2KGIA 2YQLA 1U6GB 4LADB 2DX8A 2YSJA 4X3GA 2E6RA 3PHDA 5D1LB 3O35A 2QICA 3HCSA 5H9MA 2F6NA 1WEMA 2M85A 2E6SA 5AIUA 1RMDA 1ZBDB 1VYXA 3O37A 3N9OA 2LXHC 4A49A 4ZQLA 5I3LA 3FL2A 1MM2A 2F6JA 2K1JA 1JM7B 4W4UA 3MHHA 2LGKA 4ZDTA 4N4FA 2RSDA 1WEUA 2AN6A 2LGLA 4S3OC 3U5OA 3RTRB 4Q6FA 3ZPV1 2Y1MA 4AYCA 1HYIA 2ECGA 5LKXA 5JG6A 4LJNA 2I50A 5H1TA 1FP0A 2YSMA 2MD7B 2LXPC 4TKPB 2MT5A 2YUCA 4FO9A 2YU4A 3N9MA 2MUMA 2M1RA 5FERA 2G6QA 5KH7A 1FBVA 4BHWA 1K2FA 5FB1A 2XEUA 3HCTA 1WILA 1IYMA 5TBNA 5H1VA 2EODA 4R7EA 2L0BA 4YABA 3O36A 5G05B 3KNVA 3HCUA 3O34A 2L75A 4FJCA 5FB0A 1WIMA 5B79A 3U5NA 2ECNA 2KYUA 2M6MA 4CCGX 3L1XA 4B7YC 4FIPA 3N9LA 3EB6A 5B78A 4YBMA 4YAXA 3MHSA 4C9ZA 3L11A 5B8DA 2YW8A 4A4BA 4AP4A 3M62A 4XI1A 1T1HA 1WFKA 1LDKC 3PURA 3SOXA 1DVPA 4QF3A 2MNZA 3LQIA 3N9QA 1Z6UA 3T6RA 4IC3A 2JRJA 2QJ0A 2JMIA 1LDJB 3HTKC 4YATA 1XWHA 3I2DA 2BAYA 2PUYA 1WEVA 2MD8C 3VK6A 4LLBA 1WEPA 2CSYA 2JMJA 5B75A 2OXQC 2EGPA 2UZGA 4PTBA 2LDRA 3M99A 3LQHA 4BBQA 1WGMA 2KFTA 1MM3A 2KWKA 2XB1A 5LCWB 1JOCA 2L5UA 4AVXA 3N9NA 2ECWA 4V3LC 1X4UA 5C13A 3GV4A 2FSAA 4L7XA 2K17A 4L58A 5D1MB 2VPEA 2LN0A 2VP7A 2JMDA 3KV6A 4S3OB 5LKUA 4YC9A 2KGGA 3U5MA 3N9PA 1N87A 2IDAA 5H1UA 5C11A 5DINA
chains in the Genus database with same CATH superfamily
1JM7A 4NN2A 2D8UA 5LKTA 1WEEA 3ZVYA 4A0CD 3FAOA 5AITA 2CONA 2YT5A 4WA6A 5B77A 2XOYA 4A4CA 3RPGB 2F42A 4LK9A 2K16A 1BORA 2YHOA 4AUQB 3H7HA 2VJFA 3JUEA 4R2YA 2HDPA 1Z60A 3NG2A 2MIQA 3V43A 5K3QA 4ZUXU 5D1KB 2HYED 2LQ6A 4V3KC 2ECTA 2KE1A 3PUQA 1WEOA 4R8PK 2C2VS 2VJEB 2JUNA 4I7BA 2Y1NA 1F62A 1E4UA 2K4DA 5SVXA 3LVRE 4F1PA 3LQJA 5TABA 4H9DA 4UI9B 2CT2A 4GNFA 3SUBA 2G43A 2EXUA 2MA5A 2YURA 3SOUA 2KKYA 4OGCA 5EYAF 5KH9A 4WZ0A 2EA6A 1Z2QA 3GL6A 5TDWA 2KU3A 2L43A 3QZVA 2RI7A 3KQIA 2FUIA 2FD4A 2ECJA 5TRBA 2YYRA 3ZPVE 2DJAA 2G45A 3EB5A 2KREA 2P57A 3L1ZB 4GB0A 2L80A 4GNDA 2OWAA 5SVIA 2VPGA 4F52B 4YADA 2JM3A 4YBTA 4LKAA 5LKZA 2ECVA 4O62A 3DWDA 2H0DA 2VNFA 2CSZA 4WZ3B 2D8SA 1WE9A 2YQMA 3O33A 1WESA 3O70A 2M3HA 1X4IA 1HYJA 3T9KA 2C2LA 4WZ2A 3C5KA 3T7LA 4UP5A 4MSXA 3U5PA 3SHBA 3ZYQA 2H0DB 5FEYA 4P5OB 2IQJA 2FFWA 4B86C 3C6WA 4I7CA 4N3WA 1VD4A 2LAUA 2Y43A 4GNEA 1V87A 5G04B 2KWOA 4MVTA 3ZNIA 1VFYA 2NAAA 2YREA 2KIZA 5J3XA 1WEWA 2XP0A 1X4JA 4O64A 3SOWA 3IHPA 2QIZA 4YBSA 2CRWA 2YHNA 2LGGA 3KV5A 1WENA 3LRQA 3ZTGA 3DQVR 4Z0OA 4CA1A 5B76A 5G0FA 4QF2A 4IC2A 3LDYA 2KKXA 1DCQA 5DKAA 5KH3A 3O7AA 2KWNA 1CHCA 3DPLR 4FK5A 3RPGC 2KWJA 2FUUA 1WEQA 5TDRA 2MKEA 1G25A 2VJEA 4I7DA 3ASLA 2CKLA 2MA6A 2ECIA 2LRIC 3M63A 3ZVZB 2LGVA 4UP0A 3FEHA 2VPDA 2PNXA 2LV9A 4GNGA 4PPEA 3M7KA 2YVRA 2MNYA 2CKLB 2VPBA 2KR4A 2VJFB 2ZETC 4AYCB 2KGIA 2YQLA 1MBMA 1U6GB 3LJUX 4LADB 3KDEC 2DX8A 2YSJA 4X3GA 2E6RA 3PHDA 4Z0RA 5D1LB 3O35A 2QICA 3HCSA 5H9MA 2F6NA 1WEMA 2M85A 2E6SA 5AIUA 1RMDA 1ZBDB 1VYXA 3LVQE 3O37A 3N9OA 2LXHC 4A49A 4ZQLA 5I3LA 3FL2A 1MM2A 2F6JA 2K1JA 1JM7B 4W4UA 3MHHA 2LGKA 4ZDTA 4N4FA 2RSDA 1WEUA 2AN6A 2LGLA 3FJUB 3Q1DA 4S3OC 3U5OA 3RTRB 4Q6FA 2M13A 3ZPV1 2Y1MA 2EGMA 4AYCA 1HYIA 2ECGA 3O47A 5LKXA 2CRRA 3MDBC 5JG6A 4LJNA 2I50A 5H1TA 1FP0A 2YSMA 2MD7B 2LXPC 4TKPB 2MT5A 2YUCA 4FO9A 2E61A 2XOCA 2YU4A 2MUMA 2CSVA 3N9MA 5SVIB 2M1RA 5FERA 2G6QA 5KH7A 1FBVA 3PLWA 4BHWA 1K2FA 5FB1A 2XEUA 3HCTA 1WILA 1IYMA 5TBNA 3FM8C 5H1VA 2EODA 4R7EA 2L0BA 3O36A 4YABA 5G05B 3KNVA 3HCUA 3O34A 2L75A 4FJCA 5FB0A 1WIMA 5B79A 3U5NA 2ECNA 2KYUA 2M6MA 3E2DA 4CCGX 3L1XA 4B7YC 4FIPA 3N9LA 3EB6A 5B78A 4YBMA 4YAXA 3MHSA 4C9ZA 3L11A 4A4BA 2YW8A 3DDTA 4AP4A 5B8DA 3M62A 4XI1A 1T1HA 1WFKA 1LDKC 3PURA 3SOXA 4QQ4A 1DVPA 4QF3A 2MNZA 3LQIA 3N9QA 1Z6UA 3T6RA 4IC3A 2JRJA 2QJ0A 2JMIA 4OGEA 1LDJB 3HTKC 4YATA 1XWHA 3I2DA 2BAYA 2PUYA 1WEVA 2MD8C 3VK6A 4LLBA 1WEPA 2CSYA 2JMJA 5B75A 2L7PA 2OXQC 2EGPA 2RR4A 2UZGA 4PTBA 2LDRA 3M99A 3LQHA 4BBQA 1WGMA 2KFTA 1MM3A 2KWKA 2XB1A 5LCWB 1JOCA 2L5UA 4AVXA 3N9NA 2ECWA 4V3LC 1X4UA 5C13A 3GV4A 5SVYA 2FSAA 4L7XA 2K17A 4L58A 5D1MB 2VPEA 2LN0A 2XOZA 2VP7A 2JMDA 3KV6A 4S3OB 5LKUA 4YC9A 2KGGA 2DSMA 3U5MA 3N9PA 1N87A 2B0OE 2IDAA 5H1UA 5C11A 3FANA 5DINA
chains in the Genus database with same CATH topology
1JM7A 4NN2A 5LKTA 1WEEA 3ZVYA 4A0CD 5AITA 2YT5A 4WA6A 5B77A 4A4CA 3RPGB 2F42A 4LK9A 2K16A 1BORA 2YHOA 4AUQB 2VJFA 4R2YA 2HDPA 1Z60A 3NG2A 2MIQA 3V43A 4ZUXU 5D1KB 2HYED 2LQ6A 4V3KC 2ECTA 2KE1A 3PUQA 1WEOA 4R8PK 2C2VS 2VJEB 4I7BA 2Y1NA 1F62A 1E4UA 2K4DA 3LQJA 5TABA 4UI9B 2CT2A 4GNFA 2G43A 2MA5A 2YURA 3SOUA 5EYAF 5KH9A 4WZ0A 2EA6A 1Z2QA 3GL6A 5TDWA 2KU3A 2L43A 3QZVA 2RI7A 3KQIA 2FUIA 2ECJA 5TRBA 2YYRA 3ZPVE 2G45A 3EB5A 2KREA 3L1ZB 4GB0A 2L80A 4GNDA 2VPGA 4F52B 4YADA 4YBTA 4LKAA 5LKZA 2ECVA 2H0DA 2VNFA 2CSZA 4WZ3B 2D8SA 1WE9A 2YQMA 3O33A 1WESA 3O70A 2M3HA 1X4IA 1HYJA 2C2LA 4WZ2A 3C5KA 3T7LA 4UP5A 4MSXA 3U5PA 3SHBA 3ZYQA 2H0DB 5FEYA 4P5OB 4B86C 3C6WA 4I7CA 4N3WA 1VD4A 2Y43A 4GNEA 1V87A 5G04B 2KWOA 4MVTA 3ZNIA 1VFYA 2NAAA 2YREA 2KIZA 5J3XA 1WEWA 1X4JA 4O64A 3SOWA 3IHPA 2QIZA 4YBSA 2YHNA 2LGGA 3KV5A 1WENA 3LRQA 3ZTGA 3DQVR 4CA1A 5B76A 5G0FA 4QF2A 4IC2A 5KH3A 5DKAA 3O7AA 2KWNA 1CHCA 3DPLR 4FK5A 3RPGC 2KWJA 2FUUA 1WEQA 5TDRA 1G25A 2VJEA 4I7DA 3ASLA 2CKLA 2MA6A 2ECIA 2LRIC 3M63A 3ZVZB 2LGVA 4UP0A 2VPDA 2PNXA 2LV9A 4GNGA 4PPEA 2MNYA 2CKLB 2VPBA 2KR4A 2VJFB 2ZETC 4AYCB 2KGIA 2YQLA 1U6GB 4LADB 2DX8A 2YSJA 4X3GA 2E6RA 3PHDA 5D1LB 3O35A 2QICA 3HCSA 5H9MA 2F6NA 1WEMA 2M85A 2E6SA 5AIUA 1RMDA 1ZBDB 1VYXA 3O37A 3N9OA 2LXHC 4A49A 4ZQLA 5I3LA 3FL2A 1MM2A 2F6JA 2K1JA 1JM7B 4W4UA 3MHHA 2LGKA 4ZDTA 4N4FA 2RSDA 1WEUA 2AN6A 2LGLA 4S3OC 3U5OA 3RTRB 4Q6FA 3ZPV1 2Y1MA 4AYCA 1HYIA 2ECGA 5LKXA 5JG6A 4LJNA 2I50A 5H1TA 1FP0A 2YSMA 2MD7B 2LXPC 4TKPB 2MT5A 2YUCA 4FO9A 2YU4A 3N9MA 2MUMA 2M1RA 5FERA 2G6QA 5KH7A 1FBVA 4BHWA 1K2FA 5FB1A 2XEUA 3HCTA 1WILA 1IYMA 5TBNA 5H1VA 2EODA 4R7EA 2L0BA 4YABA 3O36A 5G05B 3KNVA 3HCUA 3O34A 2L75A 4FJCA 5FB0A 1WIMA 5B79A 3U5NA 2ECNA 2KYUA 2M6MA 4CCGX 3L1XA 4B7YC 4FIPA 3N9LA 3EB6A 5B78A 4YBMA 4YAXA 3MHSA 4C9ZA 3L11A 5B8DA 2YW8A 4A4BA 4AP4A 3M62A 4XI1A 1T1HA 1WFKA 1LDKC 3PURA 3SOXA 1DVPA 4QF3A 2MNZA 3LQIA 3N9QA 1Z6UA 3T6RA 4IC3A 2JRJA 2QJ0A 2JMIA 1LDJB 3HTKC 4YATA 1XWHA 3I2DA 2BAYA 2PUYA 1WEVA 2MD8C 3VK6A 4LLBA 1WEPA 2CSYA 2JMJA 5B75A 2OXQC 2EGPA 2UZGA 4PTBA 2LDRA 3M99A 3LQHA 4BBQA 1WGMA 2KFTA 1MM3A 2KWKA 2XB1A 5LCWB 1JOCA 2L5UA 4AVXA 3N9NA 2ECWA 4V3LC 1X4UA 5C13A 3GV4A 2FSAA 4L7XA 2K17A 4L58A 5D1MB 2VPEA 2LN0A 2VP7A 2JMDA 3KV6A 4S3OB 5LKUA 4YC9A 2KGGA 3U5MA 3N9PA 1N87A 2IDAA 5H1UA 5C11A 5DINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM7 A;  4NN2 A;  5LKT A;  1WEE A;  3ZVY A;  4A0C D;  5AIT A;  2YT5 A;  4WA6 A;  5B77 A;  4A4C A;  3RPG B;  2F42 A;  4LK9 A;  2K16 A;  1BOR A;  2YHO A;  4AUQ B;  2VJF A;  4R2Y A;  2HDP A;  1Z60 A;  3NG2 A;  2MIQ A;  3V43 A;  4ZUX U;  5D1K B;  2HYE D;  2LQ6 A;  4V3K C;  2ECT A;  2KE1 A;  3PUQ A;  1WEO A;  4R8P K;  2C2V S;  2VJE B;  4I7B A;  2Y1N A;  1F62 A;  1E4U A;  2K4D A;  3LQJ A;  5TAB A;  4UI9 B;  2CT2 A;  4GNF A;  2G43 A;  2MA5 A;  2YUR A;  3SOU A;  5EYA F;  5KH9 A;  4WZ0 A;  2EA6 A;  1Z2Q A;  3GL6 A;  5TDW A;  2KU3 A;  2L43 A;  3QZV A;  2RI7 A;  3KQI A;  2FUI A;  2ECJ A;  5TRB A;  2YYR A;  3ZPV E;  2G45 A;  3EB5 A;  2KRE A;  3L1Z B;  4GB0 A;  2L80 A;  4GND A;  2VPG A;  4F52 B;  4YAD A;  4YBT A;  4LKA A;  5LKZ A;  2ECV A;  2H0D A;  2VNF A;  2CSZ A;  4WZ3 B;  2D8S A;  1WE9 A;  2YQM A;  3O33 A;  1WES A;  3O70 A;  2M3H A;  1X4I A;  1HYJ A;  2C2L A;  4WZ2 A;  3C5K A;  3T7L A;  4UP5 A;  4MSX A;  3U5P A;  3SHB A;  3ZYQ A;  2H0D B;  5FEY A;  4P5O B;  4B86 C;  3C6W A;  4I7C A;  4N3W A;  1VD4 A;  2Y43 A;  4GNE A;  1V87 A;  5G04 B;  2KWO A;  4MVT A;  3ZNI A;  1VFY A;  2NAA A;  2YRE A;  2KIZ A;  5J3X A;  1WEW A;  1X4J A;  4O64 A;  3SOW A;  3IHP A;  2QIZ A;  4YBS A;  2YHN A;  2LGG A;  3KV5 A;  1WEN A;  3LRQ A;  3ZTG A;  3DQV R;  4CA1 A;  5B76 A;  5G0F A;  4QF2 A;  4IC2 A;  5KH3 A;  5DKA A;  3O7A A;  2KWN A;  1CHC A;  3DPL R;  4FK5 A;  3RPG C;  2KWJ A;  2FUU A;  1WEQ A;  5TDR A;  1G25 A;  2VJE A;  4I7D A;  3ASL A;  2CKL A;  2MA6 A;  2ECI A;  2LRI C;  3M63 A;  3ZVZ B;  2LGV A;  4UP0 A;  2VPD A;  2PNX A;  2LV9 A;  4GNG A;  4PPE A;  2MNY A;  2CKL B;  2VPB A;  2KR4 A;  2VJF B;  2ZET C;  4AYC B;  2KGI A;  2YQL A;  1U6G B;  4LAD B;  2DX8 A;  2YSJ A;  4X3G A;  2E6R A;  3PHD A;  5D1L B;  3O35 A;  2QIC A;  3HCS A;  5H9M A;  2F6N A;  1WEM A;  2M85 A;  2E6S A;  5AIU A;  1RMD A;  1ZBD B;  1VYX A;  3O37 A;  3N9O A;  2LXH C;  4A49 A;  4ZQL A;  5I3L A;  3FL2 A;  1MM2 A;  2F6J A;  2K1J A;  1JM7 B;  4W4U A;  3MHH A;  2LGK A;  4ZDT A;  4N4F A;  2RSD A;  1WEU A;  2AN6 A;  2LGL A;  4S3O C;  3U5O A;  3RTR B;  4Q6F A;  3ZPV 1;  2Y1M A;  4AYC A;  1HYI A;  2ECG A;  5LKX A;  5JG6 A;  4LJN A;  2I50 A;  5H1T A;  1FP0 A;  2YSM A;  2MD7 B;  2LXP C;  4TKP B;  2MT5 A;  2YUC A;  4FO9 A;  2YU4 A;  3N9M A;  2MUM A;  2M1R A;  5FER A;  2G6Q A;  5KH7 A;  1FBV A;  4BHW A;  1K2F A;  5FB1 A;  2XEU A;  3HCT A;  1WIL A;  1IYM A;  5TBN A;  5H1V A;  2EOD A;  4R7E A;  2L0B A;  4YAB A;  3O36 A;  5G05 B;  3KNV A;  3HCU A;  3O34 A;  2L75 A;  4FJC A;  5FB0 A;  1WIM A;  5B79 A;  3U5N A;  2ECN A;  2KYU A;  2M6M A;  4CCG X;  3L1X A;  4B7Y C;  4FIP A;  3N9L A;  3EB6 A;  5B78 A;  4YBM A;  4YAX A;  3MHS A;  4C9Z A;  3L11 A;  5B8D A;  2YW8 A;  4A4B A;  4AP4 A;  3M62 A;  4XI1 A;  1T1H A;  1WFK A;  1LDK C;  3PUR A;  3SOX A;  1DVP A;  4QF3 A;  2MNZ A;  3LQI A;  3N9Q A;  1Z6U A;  3T6R A;  4IC3 A;  2JRJ A;  2QJ0 A;  2JMI A;  1LDJ B;  3HTK C;  4YAT A;  1XWH A;  3I2D A;  2BAY A;  2PUY A;  1WEV A;  2MD8 C;  3VK6 A;  4LLB A;  1WEP A;  2CSY A;  2JMJ A;  5B75 A;  2OXQ C;  2EGP A;  2UZG A;  4PTB A;  2LDR A;  3M99 A;  3LQH A;  4BBQ A;  1WGM A;  2KFT A;  1MM3 A;  2KWK A;  2XB1 A;  5LCW B;  1JOC A;  2L5U A;  4AVX A;  3N9N A;  2ECW A;  4V3L C;  1X4U A;  5C13 A;  3GV4 A;  2FSA A;  4L7X A;  2K17 A;  4L58 A;  5D1M B;  2VPE A;  2LN0 A;  2VP7 A;  2JMD A;  3KV6 A;  4S3O B;  5LKU A;  4YC9 A;  2KGG A;  3U5M A;  3N9P A;  1N87 A;  2IDA A;  5H1U A;  5C11 A;  5DIN A; 
#chains in the Genus database with same CATH topology
 1JM7 A;  4NN2 A;  2D8U A;  5LKT A;  1WEE A;  3ZVY A;  4A0C D;  3FAO A;  5AIT A;  2CON A;  2YT5 A;  4WA6 A;  5B77 A;  2XOY A;  4A4C A;  3RPG B;  2F42 A;  4LK9 A;  2K16 A;  1BOR A;  2YHO A;  4AUQ B;  3H7H A;  2VJF A;  3JUE A;  4R2Y A;  2HDP A;  1Z60 A;  3NG2 A;  2MIQ A;  3V43 A;  5K3Q A;  4ZUX U;  5D1K B;  2HYE D;  2LQ6 A;  4V3K C;  2ECT A;  2KE1 A;  3PUQ A;  1WEO A;  4R8P K;  2C2V S;  2VJE B;  2JUN A;  4I7B A;  2Y1N A;  1F62 A;  1E4U A;  2K4D A;  5SVX A;  3LVR E;  4F1P A;  3LQJ A;  5TAB A;  4H9D A;  4UI9 B;  2CT2 A;  4GNF A;  3SUB A;  2G43 A;  2EXU A;  2MA5 A;  2YUR A;  3SOU A;  2KKY A;  4OGC A;  5EYA F;  5KH9 A;  4WZ0 A;  2EA6 A;  1Z2Q A;  3GL6 A;  5TDW A;  2KU3 A;  2L43 A;  3QZV A;  2RI7 A;  3KQI A;  2FUI A;  2FD4 A;  2ECJ A;  5TRB A;  2YYR A;  3ZPV E;  2DJA A;  2G45 A;  3EB5 A;  2KRE A;  2P57 A;  3L1Z B;  4GB0 A;  2L80 A;  4GND A;  2OWA A;  5SVI A;  2VPG A;  4F52 B;  4YAD A;  2JM3 A;  4YBT A;  4LKA A;  5LKZ A;  2ECV A;  4O62 A;  3DWD A;  2H0D A;  2VNF A;  2CSZ A;  4WZ3 B;  2D8S A;  1WE9 A;  2YQM A;  3O33 A;  1WES A;  3O70 A;  2M3H A;  1X4I A;  1HYJ A;  3T9K A;  2C2L A;  4WZ2 A;  3C5K A;  3T7L A;  4UP5 A;  4MSX A;  3U5P A;  3SHB A;  3ZYQ A;  2H0D B;  5FEY A;  4P5O B;  2IQJ A;  2FFW A;  4B86 C;  3C6W A;  4I7C A;  4N3W A;  1VD4 A;  2LAU A;  2Y43 A;  4GNE A;  1V87 A;  5G04 B;  2KWO A;  4MVT A;  3ZNI A;  1VFY A;  2NAA A;  2YRE A;  2KIZ A;  5J3X A;  1WEW A;  2XP0 A;  1X4J A;  4O64 A;  3SOW A;  3IHP A;  2QIZ A;  4YBS A;  2CRW A;  2YHN A;  2LGG A;  3KV5 A;  1WEN A;  3LRQ A;  3ZTG A;  3DQV R;  4Z0O A;  4CA1 A;  5B76 A;  5G0F A;  4QF2 A;  4IC2 A;  3LDY A;  2KKX A;  1DCQ A;  5DKA A;  5KH3 A;  3O7A A;  2KWN A;  1CHC A;  3DPL R;  4FK5 A;  3RPG C;  2KWJ A;  2FUU A;  1WEQ A;  5TDR A;  2MKE A;  1G25 A;  2VJE A;  4I7D A;  3ASL A;  2CKL A;  2MA6 A;  2ECI A;  2LRI C;  3M63 A;  3ZVZ B;  2LGV A;  4UP0 A;  3FEH A;  2VPD A;  2PNX A;  2LV9 A;  4GNG A;  4PPE A;  3M7K A;  2YVR A;  2MNY A;  2CKL B;  2VPB A;  2KR4 A;  2VJF B;  2ZET C;  4AYC B;  2KGI A;  2YQL A;  1MBM A;  1U6G B;  3LJU X;  4LAD B;  3KDE C;  2DX8 A;  2YSJ A;  4X3G A;  2E6R A;  3PHD A;  4Z0R A;  5D1L B;  3O35 A;  2QIC A;  3HCS A;  5H9M A;  2F6N A;  1WEM A;  2M85 A;  2E6S A;  5AIU A;  1RMD A;  1ZBD B;  1VYX A;  3LVQ E;  3O37 A;  3N9O A;  2LXH C;  4A49 A;  4ZQL A;  5I3L A;  3FL2 A;  1MM2 A;  2F6J A;  2K1J A;  1JM7 B;  4W4U A;  3MHH A;  2LGK A;  4ZDT A;  4N4F A;  2RSD A;  1WEU A;  2AN6 A;  2LGL A;  3FJU B;  3Q1D A;  4S3O C;  3U5O A;  3RTR B;  4Q6F A;  2M13 A;  3ZPV 1;  2Y1M A;  2EGM A;  4AYC A;  1HYI A;  2ECG A;  3O47 A;  5LKX A;  2CRR A;  3MDB C;  5JG6 A;  4LJN A;  2I50 A;  5H1T A;  1FP0 A;  2YSM A;  2MD7 B;  2LXP C;  4TKP B;  2MT5 A;  2YUC A;  4FO9 A;  2E61 A;  2XOC A;  2YU4 A;  2MUM A;  2CSV A;  3N9M A;  5SVI B;  2M1R A;  5FER A;  2G6Q A;  5KH7 A;  1FBV A;  3PLW A;  4BHW A;  1K2F A;  5FB1 A;  2XEU A;  3HCT A;  1WIL A;  1IYM A;  5TBN A;  3FM8 C;  5H1V A;  2EOD A;  4R7E A;  2L0B A;  3O36 A;  4YAB A;  5G05 B;  3KNV A;  3HCU A;  3O34 A;  2L75 A;  4FJC A;  5FB0 A;  1WIM A;  5B79 A;  3U5N A;  2ECN A;  2KYU A;  2M6M A;  3E2D A;  4CCG X;  3L1X A;  4B7Y C;  4FIP A;  3N9L A;  3EB6 A;  5B78 A;  4YBM A;  4YAX A;  3MHS A;  4C9Z A;  3L11 A;  4A4B A;  2YW8 A;  3DDT A;  4AP4 A;  5B8D A;  3M62 A;  4XI1 A;  1T1H A;  1WFK A;  1LDK C;  3PUR A;  3SOX A;  4QQ4 A;  1DVP A;  4QF3 A;  2MNZ A;  3LQI A;  3N9Q A;  1Z6U A;  3T6R A;  4IC3 A;  2JRJ A;  2QJ0 A;  2JMI A;  4OGE A;  1LDJ B;  3HTK C;  4YAT A;  1XWH A;  3I2D A;  2BAY A;  2PUY A;  1WEV A;  2MD8 C;  3VK6 A;  4LLB A;  1WEP A;  2CSY A;  2JMJ A;  5B75 A;  2L7P A;  2OXQ C;  2EGP A;  2RR4 A;  2UZG A;  4PTB A;  2LDR A;  3M99 A;  3LQH A;  4BBQ A;  1WGM A;  2KFT A;  1MM3 A;  2KWK A;  2XB1 A;  5LCW B;  1JOC A;  2L5U A;  4AVX A;  3N9N A;  2ECW A;  4V3L C;  1X4U A;  5C13 A;  3GV4 A;  5SVY A;  2FSA A;  4L7X A;  2K17 A;  4L58 A;  5D1M B;  2VPE A;  2LN0 A;  2XOZ A;  2VP7 A;  2JMD A;  3KV6 A;  4S3O B;  5LKU A;  4YC9 A;  2KGG A;  2DSM A;  3U5M A;  3N9P A;  1N87 A;  2B0O E;  2IDA A;  5H1U A;  5C11 A;  3FAN A;  5DIN A; 
#chains in the Genus database with same CATH homology
 1JM7 A;  4NN2 A;  5LKT A;  1WEE A;  3ZVY A;  4A0C D;  5AIT A;  2YT5 A;  4WA6 A;  5B77 A;  4A4C A;  3RPG B;  2F42 A;  4LK9 A;  2K16 A;  1BOR A;  2YHO A;  4AUQ B;  2VJF A;  4R2Y A;  2HDP A;  1Z60 A;  3NG2 A;  2MIQ A;  3V43 A;  4ZUX U;  5D1K B;  2HYE D;  2LQ6 A;  4V3K C;  2ECT A;  2KE1 A;  3PUQ A;  1WEO A;  4R8P K;  2C2V S;  2VJE B;  4I7B A;  2Y1N A;  1F62 A;  1E4U A;  2K4D A;  3LQJ A;  5TAB A;  4UI9 B;  2CT2 A;  4GNF A;  2G43 A;  2MA5 A;  2YUR A;  3SOU A;  5EYA F;  5KH9 A;  4WZ0 A;  2EA6 A;  1Z2Q A;  3GL6 A;  5TDW A;  2KU3 A;  2L43 A;  3QZV A;  2RI7 A;  3KQI A;  2FUI A;  2ECJ A;  5TRB A;  2YYR A;  3ZPV E;  2G45 A;  3EB5 A;  2KRE A;  3L1Z B;  4GB0 A;  2L80 A;  4GND A;  2VPG A;  4F52 B;  4YAD A;  4YBT A;  4LKA A;  5LKZ A;  2ECV A;  2H0D A;  2VNF A;  2CSZ A;  4WZ3 B;  2D8S A;  1WE9 A;  2YQM A;  3O33 A;  1WES A;  3O70 A;  2M3H A;  1X4I A;  1HYJ A;  2C2L A;  4WZ2 A;  3C5K A;  3T7L A;  4UP5 A;  4MSX A;  3U5P A;  3SHB A;  3ZYQ A;  2H0D B;  5FEY A;  4P5O B;  4B86 C;  3C6W A;  4I7C A;  4N3W A;  1VD4 A;  2Y43 A;  4GNE A;  1V87 A;  5G04 B;  2KWO A;  4MVT A;  3ZNI A;  1VFY A;  2NAA A;  2YRE A;  2KIZ A;  5J3X A;  1WEW A;  1X4J A;  4O64 A;  3SOW A;  3IHP A;  2QIZ A;  4YBS A;  2YHN A;  2LGG A;  3KV5 A;  1WEN A;  3LRQ A;  3ZTG A;  3DQV R;  4CA1 A;  5B76 A;  5G0F A;  4QF2 A;  4IC2 A;  5KH3 A;  5DKA A;  3O7A A;  2KWN A;  1CHC A;  3DPL R;  4FK5 A;  3RPG C;  2KWJ A;  2FUU A;  1WEQ A;  5TDR A;  1G25 A;  2VJE A;  4I7D A;  3ASL A;  2CKL A;  2MA6 A;  2ECI A;  2LRI C;  3M63 A;  3ZVZ B;  2LGV A;  4UP0 A;  2VPD A;  2PNX A;  2LV9 A;  4GNG A;  4PPE A;  2MNY A;  2CKL B;  2VPB A;  2KR4 A;  2VJF B;  2ZET C;  4AYC B;  2KGI A;  2YQL A;  1U6G B;  4LAD B;  2DX8 A;  2YSJ A;  4X3G A;  2E6R A;  3PHD A;  5D1L B;  3O35 A;  2QIC A;  3HCS A;  5H9M A;  2F6N A;  1WEM A;  2M85 A;  2E6S A;  5AIU A;  1RMD A;  1ZBD B;  1VYX A;  3O37 A;  3N9O A;  2LXH C;  4A49 A;  4ZQL A;  5I3L A;  3FL2 A;  1MM2 A;  2F6J A;  2K1J A;  1JM7 B;  4W4U A;  3MHH A;  2LGK A;  4ZDT A;  4N4F A;  2RSD A;  1WEU A;  2AN6 A;  2LGL A;  4S3O C;  3U5O A;  3RTR B;  4Q6F A;  3ZPV 1;  2Y1M A;  4AYC A;  1HYI A;  2ECG A;  5LKX A;  5JG6 A;  4LJN A;  2I50 A;  5H1T A;  1FP0 A;  2YSM A;  2MD7 B;  2LXP C;  4TKP B;  2MT5 A;  2YUC A;  4FO9 A;  2YU4 A;  3N9M A;  2MUM A;  2M1R A;  5FER A;  2G6Q A;  5KH7 A;  1FBV A;  4BHW A;  1K2F A;  5FB1 A;  2XEU A;  3HCT A;  1WIL A;  1IYM A;  5TBN A;  5H1V A;  2EOD A;  4R7E A;  2L0B A;  4YAB A;  3O36 A;  5G05 B;  3KNV A;  3HCU A;  3O34 A;  2L75 A;  4FJC A;  5FB0 A;  1WIM A;  5B79 A;  3U5N A;  2ECN A;  2KYU A;  2M6M A;  4CCG X;  3L1X A;  4B7Y C;  4FIP A;  3N9L A;  3EB6 A;  5B78 A;  4YBM A;  4YAX A;  3MHS A;  4C9Z A;  3L11 A;  5B8D A;  2YW8 A;  4A4B A;  4AP4 A;  3M62 A;  4XI1 A;  1T1H A;  1WFK A;  1LDK C;  3PUR A;  3SOX A;  1DVP A;  4QF3 A;  2MNZ A;  3LQI A;  3N9Q A;  1Z6U A;  3T6R A;  4IC3 A;  2JRJ A;  2QJ0 A;  2JMI A;  1LDJ B;  3HTK C;  4YAT A;  1XWH A;  3I2D A;  2BAY A;  2PUY A;  1WEV A;  2MD8 C;  3VK6 A;  4LLB A;  1WEP A;  2CSY A;  2JMJ A;  5B75 A;  2OXQ C;  2EGP A;  2UZG A;  4PTB A;  2LDR A;  3M99 A;  3LQH A;  4BBQ A;  1WGM A;  2KFT A;  1MM3 A;  2KWK A;  2XB1 A;  5LCW B;  1JOC A;  2L5U A;  4AVX A;  3N9N A;  2ECW A;  4V3L C;  1X4U A;  5C13 A;  3GV4 A;  2FSA A;  4L7X A;  2K17 A;  4L58 A;  5D1M B;  2VPE A;  2LN0 A;  2VP7 A;  2JMD A;  3KV6 A;  4S3O B;  5LKU A;  4YC9 A;  2KGG A;  3U5M A;  3N9P A;  1N87 A;  2IDA A;  5H1U A;  5C11 A;  5DIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...