4R8PK

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
total genus 23
structure length 105
sequence length 105
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r8pK00
2VJEB 2YW8A 2HDPA 4YAXA 1FP0A 3KNVA 5TRBA 3L1XA 2KWNA 3N9PA 4PTBA 2KGIA 1FBVA 2M1RA 2KR4A 2E6SA 3RPGB 1VFYA 1ZBDB 4A0CD 1WEUA 2ECJA 5TABA 3ZTGA 2VPDA 5B75A 4UP5A 1Z6UA 2EA6A 2OXQC 2VNFA 5FERA 2LRIC 2D8SA 5KH7A 4V3LC 1WEEA 2LGKA 4FIPA 3PURA 4F52B 3HCUA 4Q6FA 4A4CA 2ECNA 2NAAA 5DINA 1DVPA 1WEMA 4GB0A 1X4UA 4LJNA 1WIMA 3O35A 4N3WA 2C2LA 3C5KA 2VP7A 4MVTA 2YU4A 3LQJA 4YABA 2VPEA 1LDKC 2KU3A 3V43A 5DKAA 4I7BA 2FSAA 2Y1MA 2MT5A 4A4BA 3HTKC 3KQIA 2YYRA 4LKAA 2EGPA 1HYJA 3LQHA 3GL6A 4V3KC 3ZVYA 3C6WA 5LKXA 3U5NA 4YADA 4AVXA 3SOUA 2LDRA 2L43A 4I7DA 2H0DB 5B78A 2JMDA 5FB0A 2MNZA 2L0BA 2CKLB 1U6GB 3ZPVE 1JOCA 5H1VA 4CA1A 1MM3A 4MSXA 5AIUA 1HYIA 2HYED 5AITA 2LQ6A 2YSMA 2G45A 2K17A 2L5UA 3IHPA 4ZDTA 3O33A 5LCWB 4N4FA 4R7EA 4FK5A 4LLBA 5LKTA 3N9OA 2KWOA 3N9QA 4GNGA 1IYMA 4GNEA 3T7LA 2CT2A 3PUQA 2H0DA 4R2YA 4QF2A 4L7XA 3GV4A 5TDRA 4UI9B 2CKLA 2E6RA 2G6QA 4QF3A 3N9NA 4IC2A 3KV5A 5B76A 5TBNA 5B79A 3MHHA 1Z2QA 1G25A 2DX8A 2C2VS 2LXPC 2XEUA 2L80A 5LKUA 2K16A 1VD4A 1WEQA 2KE1A 2L75A 2YURA 2CSYA 5C11A 1N87A 5KH3A 2MD7B 2KREA 1V87A 2LGVA 5H1TA 3I2DA 5B8DA 2K4DA 4GNFA 1WESA 3U5OA 2BAYA 2ECGA 3O36A 4W4UA 1X4IA 4WA6A 2F42A 3N9LA 2AN6A 1WEOA 2F6NA 4GNDA 3ZYQA 1WEVA 2KFTA 2MUMA 2JRJA 4FJCA 2KYUA 2VJFB 5TDWA 3HCTA 1BORA 4YBTA 4LADB 2Y43A 1CHCA 1E4UA 3RPGC 2QIZA 4L58A 2MD8C 2LGGA 2ECTA 4WZ2A 3QZVA 4AYCB 5J3XA 4LK9A 4YC9A 2KIZA 2KWJA 4YBMA 1Z60A 3EB5A 2LN0A 4C9ZA 5D1MB 2VPBA 2YHOA 1RMDA 4B86C 4FO9A 2YT5A 5I3LA 2VJFA 3M62A 1X4JA 3L1ZB 4ZQLA 4WZ3B 2EODA 5FEYA 3LRQA 3L11A 1VYXA 5C13A 2QJ0A 2LV9A 4R8PK 2VPGA 4AYCA 3FL2A 4ZUXU 4A49A 2YUCA 1LDJB 1T1HA 4WZ0A 3T6RA 1MM2A 2XB1A 2YREA 2MA5A 2M85A 2KGGA 4NN2A 1WENA 2G43A 1WEPA 3SHBA 2YHNA 3DPLR 4S3OC 1WGMA 4X3GA 3ASLA 2IDAA 2FUIA 3O70A 3O37A 2I50A 4BBQA 2VJEA 3KV6A 3SOWA 5FB1A 1F62A 3M63A 4XI1A 1XWHA 3U5PA 2QICA 4IC3A 3ZVZB 5H9MA 4YBSA 4B7YC 2FUUA 3VK6A 2JMJA 2JMIA 2CSZA 2YQMA 1JM7B 2MIQA 5G05B 3NG2A 4O64A 5H1UA 1WILA 2YQLA 3ZPV1 2F6JA 3HCSA 2ECVA 3PHDA 3EB6A 2MA6A 2RSDA 2ECIA 2PNXA 5D1KB 4I7CA 2LGLA 4BHWA 3SOXA 3RTRB 3MHSA 5B77A 5KH9A 5G04B 2KWKA 3ZNIA 1K2FA 3O7AA 2YSJA 2MNYA 3O34A 2ECWA 4P5OB 1JM7A 2K1JA 4YATA 5LKZA 4PPEA 4S3OB 1WEWA 3U5MA 3DQVR 2RI7A 4TKPB 3N9MA 1WE9A 5EYAF 2ZETC 4AUQB 2LXHC 4UP0A 5G0FA 4AP4A 2PUYA 2UZGA 5D1LB 4CCGX 2Y1NA 1WFKA 2M3HA 3LQIA 2M6MA 3M99A 5JG6A
chains in the Genus database with same CATH superfamily
2VJEB 2CRRA 2YW8A 2XOCA 2HDPA 4YAXA 1FP0A 3KNVA 2LAUA 5TRBA 3L1XA 2KWNA 3N9PA 4PTBA 2KGIA 1FBVA 2M1RA 2KR4A 2E6SA 3RPGB 1VFYA 1ZBDB 4A0CD 1WEUA 2ECJA 5TABA 3ZTGA 2VPDA 5B75A 4UP5A 2E61A 1Z6UA 3PLWA 2EA6A 2OXQC 2VNFA 5FERA 2LRIC 4OGCA 2D8SA 3E2DA 5KH7A 4V3LC 1WEEA 2DSMA 2LGKA 4FIPA 3PURA 4F52B 3HCUA 4Q6FA 4A4CA 2ECNA 2NAAA 5DINA 1DVPA 4H9DA 2XOZA 1WEMA 4GB0A 1X4UA 4LJNA 1WIMA 2FD4A 3O35A 4N3WA 3M7KA 2C2LA 3C5KA 2VP7A 4MVTA 2YU4A 3LQJA 3JUEA 4YABA 2VPEA 1LDKC 2KU3A 3T9KA 3V43A 5DKAA 4I7BA 2FSAA 2Y1MA 2MT5A 4A4BA 3HTKC 3KQIA 2YYRA 3FEHA 4LKAA 3LJUX 2KKXA 2EGPA 1HYJA 3LQHA 3GL6A 4V3KC 3ZVYA 3C6WA 5LKXA 3U5NA 4YADA 4AVXA 3SOUA 2LDRA 2L43A 4I7DA 2H0DB 5B78A 2JMDA 5FB0A 2MNZA 2L0BA 2CKLB 1U6GB 2OWAA 3ZPVE 1JOCA 5H1VA 4CA1A 1MM3A 4MSXA 5AIUA 1HYIA 2HYED 4OGEA 2LQ6A 5AITA 2YSMA 2G45A 2K17A 2L5UA 3IHPA 4ZDTA 5SVYA 3O33A 5LCWB 4N4FA 4R7EA 4FK5A 4LLBA 5LKTA 3N9OA 1DCQA 2KWOA 2YVRA 3N9QA 4GNGA 1IYMA 3SUBA 4GNEA 3T7LA 2CT2A 3PUQA 2H0DA 4R2YA 4QF2A 4L7XA 3GV4A 5TDRA 4UI9B 2CKLA 2E6RA 2CSVA 2G6QA 4QF3A 3N9NA 4IC2A 3KV5A 5B76A 2XOYA 5TBNA 5B79A 3MHHA 1Z2QA 1G25A 2DX8A 2C2VS 2LXPC 2XEUA 2L80A 5LKUA 2K16A 3LVRE 3MDBC 3FJUB 1VD4A 1WEQA 2KE1A 2L75A 2YURA 2CSYA 2FFWA 5C11A 1N87A 5KH3A 2MD7B 2KREA 1V87A 2JUNA 2LGVA 5H1TA 3I2DA 5B8DA 2K4DA 4GNFA 1WESA 2XP0A 3U5OA 2BAYA 3Q1DA 2ECGA 3O36A 4W4UA 1X4IA 4WA6A 2F42A 2M13A 3N9LA 2AN6A 1WEOA 2F6NA 4GNDA 3ZYQA 3FANA 1WEVA 2KFTA 2MUMA 2JRJA 4FJCA 2KYUA 2VJFB 5TDWA 3HCTA 2D8UA 5SVXA 3FM8C 1BORA 4YBTA 4LADB 2Y43A 1CHCA 1E4UA 3FAOA 3RPGC 2QIZA 4L58A 2MD8C 2LGGA 2ECTA 4WZ2A 3QZVA 5K3QA 4AYCB 5J3XA 4LK9A 4YC9A 2KIZA 2KWJA 4YBMA 1Z60A 3EB5A 2LN0A 4C9ZA 5D1MB 2VPBA 3DDTA 2L7PA 2JM3A 2YHOA 2B0OE 1RMDA 4B86C 4FO9A 2YT5A 5I3LA 2VJFA 4O62A 3M62A 1X4JA 3L1ZB 4ZQLA 4WZ3B 2EODA 2CRWA 5FEYA 1MBMA 2P57A 3L11A 3LRQA 1VYXA 5C13A 2QJ0A 2LV9A 4R8PK 2VPGA 4AYCA 3FL2A 4ZUXU 4A49A 2IQJA 2YUCA 4Z0RA 1LDJB 1T1HA 4WZ0A 3T6RA 1MM2A 2XB1A 2YREA 2MA5A 2M85A 2DJAA 2KGGA 4NN2A 1WENA 2G43A 2MKEA 5SVIB 4Z0OA 1WEPA 3SHBA 2YHNA 3DPLR 4S3OC 1WGMA 4X3GA 2EGMA 3ASLA 2IDAA 2FUIA 3O70A 3O37A 2I50A 4BBQA 2VJEA 3KV6A 3SOWA 5FB1A 1F62A 3M63A 4XI1A 1XWHA 3U5PA 2QICA 4IC3A 3ZVZB 5H9MA 4YBSA 4B7YC 2FUUA 3VK6A 2JMJA 2JMIA 2CSZA 2YQMA 1JM7B 2MIQA 2RR4A 5G05B 3NG2A 4O64A 5H1UA 1WILA 2YQLA 3ZPV1 2F6JA 5SVIA 3HCSA 2ECVA 3PHDA 3EB6A 3DWDA 2MA6A 2RSDA 2ECIA 2EXUA 2PNXA 5D1KB 3LVQE 4I7CA 2LGLA 4BHWA 2KKYA 3SOXA 3RTRB 3MHSA 5B77A 5KH9A 5G04B 2KWKA 3ZNIA 1K2FA 3O7AA 2YSJA 2CONA 2MNYA 3H7HA 3O34A 4QQ4A 2ECWA 4P5OB 1JM7A 2K1JA 4YATA 5LKZA 4PPEA 4S3OB 4F1PA 1WEWA 3U5MA 3DQVR 3LDYA 2RI7A 4TKPB 3N9MA 1WE9A 5EYAF 2ZETC 4AUQB 2LXHC 4UP0A 5G0FA 4AP4A 2PUYA 2UZGA 5D1LB 4CCGX 3KDEC 2Y1NA 1WFKA 2M3HA 3LQIA 2M6MA 3O47A 3M99A 5JG6A
chains in the Genus database with same CATH topology
2VJEB 2YW8A 2HDPA 4YAXA 1FP0A 3KNVA 5TRBA 3L1XA 2KWNA 3N9PA 4PTBA 2KGIA 1FBVA 2M1RA 2KR4A 2E6SA 3RPGB 1VFYA 1ZBDB 4A0CD 1WEUA 2ECJA 5TABA 3ZTGA 2VPDA 5B75A 4UP5A 1Z6UA 2EA6A 2OXQC 2VNFA 5FERA 2LRIC 2D8SA 5KH7A 4V3LC 1WEEA 2LGKA 4FIPA 3PURA 4F52B 3HCUA 4Q6FA 4A4CA 2ECNA 2NAAA 5DINA 1DVPA 1WEMA 4GB0A 1X4UA 4LJNA 1WIMA 3O35A 4N3WA 2C2LA 3C5KA 2VP7A 4MVTA 2YU4A 3LQJA 4YABA 2VPEA 1LDKC 2KU3A 3V43A 5DKAA 4I7BA 2FSAA 2Y1MA 2MT5A 4A4BA 3HTKC 3KQIA 2YYRA 4LKAA 2EGPA 1HYJA 3LQHA 3GL6A 4V3KC 3ZVYA 3C6WA 5LKXA 3U5NA 4YADA 4AVXA 3SOUA 2LDRA 2L43A 4I7DA 2H0DB 5B78A 2JMDA 5FB0A 2MNZA 2L0BA 2CKLB 1U6GB 3ZPVE 1JOCA 5H1VA 4CA1A 1MM3A 4MSXA 5AIUA 1HYIA 2HYED 5AITA 2LQ6A 2YSMA 2G45A 2K17A 2L5UA 3IHPA 4ZDTA 3O33A 5LCWB 4N4FA 4R7EA 4FK5A 4LLBA 5LKTA 3N9OA 2KWOA 3N9QA 4GNGA 1IYMA 4GNEA 3T7LA 2CT2A 3PUQA 2H0DA 4R2YA 4QF2A 4L7XA 3GV4A 5TDRA 4UI9B 2CKLA 2E6RA 2G6QA 4QF3A 3N9NA 4IC2A 3KV5A 5B76A 5TBNA 5B79A 3MHHA 1Z2QA 1G25A 2DX8A 2C2VS 2LXPC 2XEUA 2L80A 5LKUA 2K16A 1VD4A 1WEQA 2KE1A 2L75A 2YURA 2CSYA 5C11A 1N87A 5KH3A 2MD7B 2KREA 1V87A 2LGVA 5H1TA 3I2DA 5B8DA 2K4DA 4GNFA 1WESA 3U5OA 2BAYA 2ECGA 3O36A 4W4UA 1X4IA 4WA6A 2F42A 3N9LA 2AN6A 1WEOA 2F6NA 4GNDA 3ZYQA 1WEVA 2KFTA 2MUMA 2JRJA 4FJCA 2KYUA 2VJFB 5TDWA 3HCTA 1BORA 4YBTA 4LADB 2Y43A 1CHCA 1E4UA 3RPGC 2QIZA 4L58A 2MD8C 2LGGA 2ECTA 4WZ2A 3QZVA 4AYCB 5J3XA 4LK9A 4YC9A 2KIZA 2KWJA 4YBMA 1Z60A 3EB5A 2LN0A 4C9ZA 5D1MB 2VPBA 2YHOA 1RMDA 4B86C 4FO9A 2YT5A 5I3LA 2VJFA 3M62A 1X4JA 3L1ZB 4ZQLA 4WZ3B 2EODA 5FEYA 3LRQA 3L11A 1VYXA 5C13A 2QJ0A 2LV9A 4R8PK 2VPGA 4AYCA 3FL2A 4ZUXU 4A49A 2YUCA 1LDJB 1T1HA 4WZ0A 3T6RA 1MM2A 2XB1A 2YREA 2MA5A 2M85A 2KGGA 4NN2A 1WENA 2G43A 1WEPA 3SHBA 2YHNA 3DPLR 4S3OC 1WGMA 4X3GA 3ASLA 2IDAA 2FUIA 3O70A 3O37A 2I50A 4BBQA 2VJEA 3KV6A 3SOWA 5FB1A 1F62A 3M63A 4XI1A 1XWHA 3U5PA 2QICA 4IC3A 3ZVZB 5H9MA 4YBSA 4B7YC 2FUUA 3VK6A 2JMJA 2JMIA 2CSZA 2YQMA 1JM7B 2MIQA 5G05B 3NG2A 4O64A 5H1UA 1WILA 2YQLA 3ZPV1 2F6JA 3HCSA 2ECVA 3PHDA 3EB6A 2MA6A 2RSDA 2ECIA 2PNXA 5D1KB 4I7CA 2LGLA 4BHWA 3SOXA 3RTRB 3MHSA 5B77A 5KH9A 5G04B 2KWKA 3ZNIA 1K2FA 3O7AA 2YSJA 2MNYA 3O34A 2ECWA 4P5OB 1JM7A 2K1JA 4YATA 5LKZA 4PPEA 4S3OB 1WEWA 3U5MA 3DQVR 2RI7A 4TKPB 3N9MA 1WE9A 5EYAF 2ZETC 4AUQB 2LXHC 4UP0A 5G0FA 4AP4A 2PUYA 2UZGA 5D1LB 4CCGX 2Y1NA 1WFKA 2M3HA 3LQIA 2M6MA 3M99A 5JG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  2YW8 A;  2HDP A;  4YAX A;  1FP0 A;  3KNV A;  5TRB A;  3L1X A;  2KWN A;  3N9P A;  4PTB A;  2KGI A;  1FBV A;  2M1R A;  2KR4 A;  2E6S A;  3RPG B;  1VFY A;  1ZBD B;  4A0C D;  1WEU A;  2ECJ A;  5TAB A;  3ZTG A;  2VPD A;  5B75 A;  4UP5 A;  1Z6U A;  2EA6 A;  2OXQ C;  2VNF A;  5FER A;  2LRI C;  2D8S A;  5KH7 A;  4V3L C;  1WEE A;  2LGK A;  4FIP A;  3PUR A;  4F52 B;  3HCU A;  4Q6F A;  4A4C A;  2ECN A;  2NAA A;  5DIN A;  1DVP A;  1WEM A;  4GB0 A;  1X4U A;  4LJN A;  1WIM A;  3O35 A;  4N3W A;  2C2L A;  3C5K A;  2VP7 A;  4MVT A;  2YU4 A;  3LQJ A;  4YAB A;  2VPE A;  1LDK C;  2KU3 A;  3V43 A;  5DKA A;  4I7B A;  2FSA A;  2Y1M A;  2MT5 A;  4A4B A;  3HTK C;  3KQI A;  2YYR A;  4LKA A;  2EGP A;  1HYJ A;  3LQH A;  3GL6 A;  4V3K C;  3ZVY A;  3C6W A;  5LKX A;  3U5N A;  4YAD A;  4AVX A;  3SOU A;  2LDR A;  2L43 A;  4I7D A;  2H0D B;  5B78 A;  2JMD A;  5FB0 A;  2MNZ A;  2L0B A;  2CKL B;  1U6G B;  3ZPV E;  1JOC A;  5H1V A;  4CA1 A;  1MM3 A;  4MSX A;  5AIU A;  1HYI A;  2HYE D;  5AIT A;  2LQ6 A;  2YSM A;  2G45 A;  2K17 A;  2L5U A;  3IHP A;  4ZDT A;  3O33 A;  5LCW B;  4N4F A;  4R7E A;  4FK5 A;  4LLB A;  5LKT A;  3N9O A;  2KWO A;  3N9Q A;  4GNG A;  1IYM A;  4GNE A;  3T7L A;  2CT2 A;  3PUQ A;  2H0D A;  4R2Y A;  4QF2 A;  4L7X A;  3GV4 A;  5TDR A;  4UI9 B;  2CKL A;  2E6R A;  2G6Q A;  4QF3 A;  3N9N A;  4IC2 A;  3KV5 A;  5B76 A;  5TBN A;  5B79 A;  3MHH A;  1Z2Q A;  1G25 A;  2DX8 A;  2C2V S;  2LXP C;  2XEU A;  2L80 A;  5LKU A;  2K16 A;  1VD4 A;  1WEQ A;  2KE1 A;  2L75 A;  2YUR A;  2CSY A;  5C11 A;  1N87 A;  5KH3 A;  2MD7 B;  2KRE A;  1V87 A;  2LGV A;  5H1T A;  3I2D A;  5B8D A;  2K4D A;  4GNF A;  1WES A;  3U5O A;  2BAY A;  2ECG A;  3O36 A;  4W4U A;  1X4I A;  4WA6 A;  2F42 A;  3N9L A;  2AN6 A;  1WEO A;  2F6N A;  4GND A;  3ZYQ A;  1WEV A;  2KFT A;  2MUM A;  2JRJ A;  4FJC A;  2KYU A;  2VJF B;  5TDW A;  3HCT A;  1BOR A;  4YBT A;  4LAD B;  2Y43 A;  1CHC A;  1E4U A;  3RPG C;  2QIZ A;  4L58 A;  2MD8 C;  2LGG A;  2ECT A;  4WZ2 A;  3QZV A;  4AYC B;  5J3X A;  4LK9 A;  4YC9 A;  2KIZ A;  2KWJ A;  4YBM A;  1Z60 A;  3EB5 A;  2LN0 A;  4C9Z A;  5D1M B;  2VPB A;  2YHO A;  1RMD A;  4B86 C;  4FO9 A;  2YT5 A;  5I3L A;  2VJF A;  3M62 A;  1X4J A;  3L1Z B;  4ZQL A;  4WZ3 B;  2EOD A;  5FEY A;  3LRQ A;  3L11 A;  1VYX A;  5C13 A;  2QJ0 A;  2LV9 A;  4R8P K;  2VPG A;  4AYC A;  3FL2 A;  4ZUX U;  4A49 A;  2YUC A;  1LDJ B;  1T1H A;  4WZ0 A;  3T6R A;  1MM2 A;  2XB1 A;  2YRE A;  2MA5 A;  2M85 A;  2KGG A;  4NN2 A;  1WEN A;  2G43 A;  1WEP A;  3SHB A;  2YHN A;  3DPL R;  4S3O C;  1WGM A;  4X3G A;  3ASL A;  2IDA A;  2FUI A;  3O70 A;  3O37 A;  2I50 A;  4BBQ A;  2VJE A;  3KV6 A;  3SOW A;  5FB1 A;  1F62 A;  3M63 A;  4XI1 A;  1XWH A;  3U5P A;  2QIC A;  4IC3 A;  3ZVZ B;  5H9M A;  4YBS A;  4B7Y C;  2FUU A;  3VK6 A;  2JMJ A;  2JMI A;  2CSZ A;  2YQM A;  1JM7 B;  2MIQ A;  5G05 B;  3NG2 A;  4O64 A;  5H1U A;  1WIL A;  2YQL A;  3ZPV 1;  2F6J A;  3HCS A;  2ECV A;  3PHD A;  3EB6 A;  2MA6 A;  2RSD A;  2ECI A;  2PNX A;  5D1K B;  4I7C A;  2LGL A;  4BHW A;  3SOX A;  3RTR B;  3MHS A;  5B77 A;  5KH9 A;  5G04 B;  2KWK A;  3ZNI A;  1K2F A;  3O7A A;  2YSJ A;  2MNY A;  3O34 A;  2ECW A;  4P5O B;  1JM7 A;  2K1J A;  4YAT A;  5LKZ A;  4PPE A;  4S3O B;  1WEW A;  3U5M A;  3DQV R;  2RI7 A;  4TKP B;  3N9M A;  1WE9 A;  5EYA F;  2ZET C;  4AUQ B;  2LXH C;  4UP0 A;  5G0F A;  4AP4 A;  2PUY A;  2UZG A;  5D1L B;  4CCG X;  2Y1N A;  1WFK A;  2M3H A;  3LQI A;  2M6M A;  3M99 A;  5JG6 A; 
#chains in the Genus database with same CATH topology
 2VJE B;  2CRR A;  2YW8 A;  2XOC A;  2HDP A;  4YAX A;  1FP0 A;  3KNV A;  2LAU A;  5TRB A;  3L1X A;  2KWN A;  3N9P A;  4PTB A;  2KGI A;  1FBV A;  2M1R A;  2KR4 A;  2E6S A;  3RPG B;  1VFY A;  1ZBD B;  4A0C D;  1WEU A;  2ECJ A;  5TAB A;  3ZTG A;  2VPD A;  5B75 A;  4UP5 A;  2E61 A;  1Z6U A;  3PLW A;  2EA6 A;  2OXQ C;  2VNF A;  5FER A;  2LRI C;  4OGC A;  2D8S A;  3E2D A;  5KH7 A;  4V3L C;  1WEE A;  2DSM A;  2LGK A;  4FIP A;  3PUR A;  4F52 B;  3HCU A;  4Q6F A;  4A4C A;  2ECN A;  2NAA A;  5DIN A;  1DVP A;  4H9D A;  2XOZ A;  1WEM A;  4GB0 A;  1X4U A;  4LJN A;  1WIM A;  2FD4 A;  3O35 A;  4N3W A;  3M7K A;  2C2L A;  3C5K A;  2VP7 A;  4MVT A;  2YU4 A;  3LQJ A;  3JUE A;  4YAB A;  2VPE A;  1LDK C;  2KU3 A;  3T9K A;  3V43 A;  5DKA A;  4I7B A;  2FSA A;  2Y1M A;  2MT5 A;  4A4B A;  3HTK C;  3KQI A;  2YYR A;  3FEH A;  4LKA A;  3LJU X;  2KKX A;  2EGP A;  1HYJ A;  3LQH A;  3GL6 A;  4V3K C;  3ZVY A;  3C6W A;  5LKX A;  3U5N A;  4YAD A;  4AVX A;  3SOU A;  2LDR A;  2L43 A;  4I7D A;  2H0D B;  5B78 A;  2JMD A;  5FB0 A;  2MNZ A;  2L0B A;  2CKL B;  1U6G B;  2OWA A;  3ZPV E;  1JOC A;  5H1V A;  4CA1 A;  1MM3 A;  4MSX A;  5AIU A;  1HYI A;  2HYE D;  4OGE A;  2LQ6 A;  5AIT A;  2YSM A;  2G45 A;  2K17 A;  2L5U A;  3IHP A;  4ZDT A;  5SVY A;  3O33 A;  5LCW B;  4N4F A;  4R7E A;  4FK5 A;  4LLB A;  5LKT A;  3N9O A;  1DCQ A;  2KWO A;  2YVR A;  3N9Q A;  4GNG A;  1IYM A;  3SUB A;  4GNE A;  3T7L A;  2CT2 A;  3PUQ A;  2H0D A;  4R2Y A;  4QF2 A;  4L7X A;  3GV4 A;  5TDR A;  4UI9 B;  2CKL A;  2E6R A;  2CSV A;  2G6Q A;  4QF3 A;  3N9N A;  4IC2 A;  3KV5 A;  5B76 A;  2XOY A;  5TBN A;  5B79 A;  3MHH A;  1Z2Q A;  1G25 A;  2DX8 A;  2C2V S;  2LXP C;  2XEU A;  2L80 A;  5LKU A;  2K16 A;  3LVR E;  3MDB C;  3FJU B;  1VD4 A;  1WEQ A;  2KE1 A;  2L75 A;  2YUR A;  2CSY A;  2FFW A;  5C11 A;  1N87 A;  5KH3 A;  2MD7 B;  2KRE A;  1V87 A;  2JUN A;  2LGV A;  5H1T A;  3I2D A;  5B8D A;  2K4D A;  4GNF A;  1WES A;  2XP0 A;  3U5O A;  2BAY A;  3Q1D A;  2ECG A;  3O36 A;  4W4U A;  1X4I A;  4WA6 A;  2F42 A;  2M13 A;  3N9L A;  2AN6 A;  1WEO A;  2F6N A;  4GND A;  3ZYQ A;  3FAN A;  1WEV A;  2KFT A;  2MUM A;  2JRJ A;  4FJC A;  2KYU A;  2VJF B;  5TDW A;  3HCT A;  2D8U A;  5SVX A;  3FM8 C;  1BOR A;  4YBT A;  4LAD B;  2Y43 A;  1CHC A;  1E4U A;  3FAO A;  3RPG C;  2QIZ A;  4L58 A;  2MD8 C;  2LGG A;  2ECT A;  4WZ2 A;  3QZV A;  5K3Q A;  4AYC B;  5J3X A;  4LK9 A;  4YC9 A;  2KIZ A;  2KWJ A;  4YBM A;  1Z60 A;  3EB5 A;  2LN0 A;  4C9Z A;  5D1M B;  2VPB A;  3DDT A;  2L7P A;  2JM3 A;  2YHO A;  2B0O E;  1RMD A;  4B86 C;  4FO9 A;  2YT5 A;  5I3L A;  2VJF A;  4O62 A;  3M62 A;  1X4J A;  3L1Z B;  4ZQL A;  4WZ3 B;  2EOD A;  2CRW A;  5FEY A;  1MBM A;  2P57 A;  3L11 A;  3LRQ A;  1VYX A;  5C13 A;  2QJ0 A;  2LV9 A;  4R8P K;  2VPG A;  4AYC A;  3FL2 A;  4ZUX U;  4A49 A;  2IQJ A;  2YUC A;  4Z0R A;  1LDJ B;  1T1H A;  4WZ0 A;  3T6R A;  1MM2 A;  2XB1 A;  2YRE A;  2MA5 A;  2M85 A;  2DJA A;  2KGG A;  4NN2 A;  1WEN A;  2G43 A;  2MKE A;  5SVI B;  4Z0O A;  1WEP A;  3SHB A;  2YHN A;  3DPL R;  4S3O C;  1WGM A;  4X3G A;  2EGM A;  3ASL A;  2IDA A;  2FUI A;  3O70 A;  3O37 A;  2I50 A;  4BBQ A;  2VJE A;  3KV6 A;  3SOW A;  5FB1 A;  1F62 A;  3M63 A;  4XI1 A;  1XWH A;  3U5P A;  2QIC A;  4IC3 A;  3ZVZ B;  5H9M A;  4YBS A;  4B7Y C;  2FUU A;  3VK6 A;  2JMJ A;  2JMI A;  2CSZ A;  2YQM A;  1JM7 B;  2MIQ A;  2RR4 A;  5G05 B;  3NG2 A;  4O64 A;  5H1U A;  1WIL A;  2YQL A;  3ZPV 1;  2F6J A;  5SVI A;  3HCS A;  2ECV A;  3PHD A;  3EB6 A;  3DWD A;  2MA6 A;  2RSD A;  2ECI A;  2EXU A;  2PNX A;  5D1K B;  3LVQ E;  4I7C A;  2LGL A;  4BHW A;  2KKY A;  3SOX A;  3RTR B;  3MHS A;  5B77 A;  5KH9 A;  5G04 B;  2KWK A;  3ZNI A;  1K2F A;  3O7A A;  2YSJ A;  2CON A;  2MNY A;  3H7H A;  3O34 A;  4QQ4 A;  2ECW A;  4P5O B;  1JM7 A;  2K1J A;  4YAT A;  5LKZ A;  4PPE A;  4S3O B;  4F1P A;  1WEW A;  3U5M A;  3DQV R;  3LDY A;  2RI7 A;  4TKP B;  3N9M A;  1WE9 A;  5EYA F;  2ZET C;  4AUQ B;  2LXH C;  4UP0 A;  5G0F A;  4AP4 A;  2PUY A;  2UZG A;  5D1L B;  4CCG X;  3KDE C;  2Y1N A;  1WFK A;  2M3H A;  3LQI A;  2M6M A;  3O47 A;  3M99 A;  5JG6 A; 
#chains in the Genus database with same CATH homology
 2VJE B;  2YW8 A;  2HDP A;  4YAX A;  1FP0 A;  3KNV A;  5TRB A;  3L1X A;  2KWN A;  3N9P A;  4PTB A;  2KGI A;  1FBV A;  2M1R A;  2KR4 A;  2E6S A;  3RPG B;  1VFY A;  1ZBD B;  4A0C D;  1WEU A;  2ECJ A;  5TAB A;  3ZTG A;  2VPD A;  5B75 A;  4UP5 A;  1Z6U A;  2EA6 A;  2OXQ C;  2VNF A;  5FER A;  2LRI C;  2D8S A;  5KH7 A;  4V3L C;  1WEE A;  2LGK A;  4FIP A;  3PUR A;  4F52 B;  3HCU A;  4Q6F A;  4A4C A;  2ECN A;  2NAA A;  5DIN A;  1DVP A;  1WEM A;  4GB0 A;  1X4U A;  4LJN A;  1WIM A;  3O35 A;  4N3W A;  2C2L A;  3C5K A;  2VP7 A;  4MVT A;  2YU4 A;  3LQJ A;  4YAB A;  2VPE A;  1LDK C;  2KU3 A;  3V43 A;  5DKA A;  4I7B A;  2FSA A;  2Y1M A;  2MT5 A;  4A4B A;  3HTK C;  3KQI A;  2YYR A;  4LKA A;  2EGP A;  1HYJ A;  3LQH A;  3GL6 A;  4V3K C;  3ZVY A;  3C6W A;  5LKX A;  3U5N A;  4YAD A;  4AVX A;  3SOU A;  2LDR A;  2L43 A;  4I7D A;  2H0D B;  5B78 A;  2JMD A;  5FB0 A;  2MNZ A;  2L0B A;  2CKL B;  1U6G B;  3ZPV E;  1JOC A;  5H1V A;  4CA1 A;  1MM3 A;  4MSX A;  5AIU A;  1HYI A;  2HYE D;  5AIT A;  2LQ6 A;  2YSM A;  2G45 A;  2K17 A;  2L5U A;  3IHP A;  4ZDT A;  3O33 A;  5LCW B;  4N4F A;  4R7E A;  4FK5 A;  4LLB A;  5LKT A;  3N9O A;  2KWO A;  3N9Q A;  4GNG A;  1IYM A;  4GNE A;  3T7L A;  2CT2 A;  3PUQ A;  2H0D A;  4R2Y A;  4QF2 A;  4L7X A;  3GV4 A;  5TDR A;  4UI9 B;  2CKL A;  2E6R A;  2G6Q A;  4QF3 A;  3N9N A;  4IC2 A;  3KV5 A;  5B76 A;  5TBN A;  5B79 A;  3MHH A;  1Z2Q A;  1G25 A;  2DX8 A;  2C2V S;  2LXP C;  2XEU A;  2L80 A;  5LKU A;  2K16 A;  1VD4 A;  1WEQ A;  2KE1 A;  2L75 A;  2YUR A;  2CSY A;  5C11 A;  1N87 A;  5KH3 A;  2MD7 B;  2KRE A;  1V87 A;  2LGV A;  5H1T A;  3I2D A;  5B8D A;  2K4D A;  4GNF A;  1WES A;  3U5O A;  2BAY A;  2ECG A;  3O36 A;  4W4U A;  1X4I A;  4WA6 A;  2F42 A;  3N9L A;  2AN6 A;  1WEO A;  2F6N A;  4GND A;  3ZYQ A;  1WEV A;  2KFT A;  2MUM A;  2JRJ A;  4FJC A;  2KYU A;  2VJF B;  5TDW A;  3HCT A;  1BOR A;  4YBT A;  4LAD B;  2Y43 A;  1CHC A;  1E4U A;  3RPG C;  2QIZ A;  4L58 A;  2MD8 C;  2LGG A;  2ECT A;  4WZ2 A;  3QZV A;  4AYC B;  5J3X A;  4LK9 A;  4YC9 A;  2KIZ A;  2KWJ A;  4YBM A;  1Z60 A;  3EB5 A;  2LN0 A;  4C9Z A;  5D1M B;  2VPB A;  2YHO A;  1RMD A;  4B86 C;  4FO9 A;  2YT5 A;  5I3L A;  2VJF A;  3M62 A;  1X4J A;  3L1Z B;  4ZQL A;  4WZ3 B;  2EOD A;  5FEY A;  3LRQ A;  3L11 A;  1VYX A;  5C13 A;  2QJ0 A;  2LV9 A;  4R8P K;  2VPG A;  4AYC A;  3FL2 A;  4ZUX U;  4A49 A;  2YUC A;  1LDJ B;  1T1H A;  4WZ0 A;  3T6R A;  1MM2 A;  2XB1 A;  2YRE A;  2MA5 A;  2M85 A;  2KGG A;  4NN2 A;  1WEN A;  2G43 A;  1WEP A;  3SHB A;  2YHN A;  3DPL R;  4S3O C;  1WGM A;  4X3G A;  3ASL A;  2IDA A;  2FUI A;  3O70 A;  3O37 A;  2I50 A;  4BBQ A;  2VJE A;  3KV6 A;  3SOW A;  5FB1 A;  1F62 A;  3M63 A;  4XI1 A;  1XWH A;  3U5P A;  2QIC A;  4IC3 A;  3ZVZ B;  5H9M A;  4YBS A;  4B7Y C;  2FUU A;  3VK6 A;  2JMJ A;  2JMI A;  2CSZ A;  2YQM A;  1JM7 B;  2MIQ A;  5G05 B;  3NG2 A;  4O64 A;  5H1U A;  1WIL A;  2YQL A;  3ZPV 1;  2F6J A;  3HCS A;  2ECV A;  3PHD A;  3EB6 A;  2MA6 A;  2RSD A;  2ECI A;  2PNX A;  5D1K B;  4I7C A;  2LGL A;  4BHW A;  3SOX A;  3RTR B;  3MHS A;  5B77 A;  5KH9 A;  5G04 B;  2KWK A;  3ZNI A;  1K2F A;  3O7A A;  2YSJ A;  2MNY A;  3O34 A;  2ECW A;  4P5O B;  1JM7 A;  2K1J A;  4YAT A;  5LKZ A;  4PPE A;  4S3O B;  1WEW A;  3U5M A;  3DQV R;  2RI7 A;  4TKP B;  3N9M A;  1WE9 A;  5EYA F;  2ZET C;  4AUQ B;  2LXH C;  4UP0 A;  5G0F A;  4AP4 A;  2PUY A;  2UZG A;  5D1L B;  4CCG X;  2Y1N A;  1WFK A;  2M3H A;  3LQI A;  2M6M A;  3M99 A;  5JG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...