4R8PK

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 23
structure length 105
sequence length 105
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r8pK00
1Z60A 3RTRB 1X4IA 3N9QA 5KH9A 4V3KC 3KV5A 4XI1A 1VYXA 2KE1A 2L5UA 2YQLA 3M99A 4MSXA 2Y43A 4YBMA 4AP4A 2ECGA 2L0BA 2MNYA 3N9PA 2HDPA 1IYMA 2YHOA 4A49A 1ZBDB 4L58A 5D1LB 2KIZA 1WEVA 3C5KA 2KGIA 2XB1A 2F6JA 4A0CD 2VJFA 4PTBA 4GNEA 1XWHA 1WIMA 3SOXA 1HYIA 2VJFB 3V43A 2KWJA 1WEPA 2VPEA 4S3OB 1LDKC 4IC2A 5B77A 4WZ0A 4LJNA 1WEUA 1WE9A 5KH7A 5FB1A 2K17A 2CSYA 5B78A 5G05B 2Y1MA 3LQHA 5TDWA 4FJCA 2KWNA 2NAAA 4NN2A 5FERA 2C2LA 5B76A 3L11A 2G6QA 2KFTA 4LLBA 2QIZA 5AITA 3M63A 1WEMA 2K16A 4L7XA 2KU3A 3T7LA 5B79A 3ASLA 3GL6A 3U5NA 3ZPV1 3PUQA 1JM7B 3O7AA 2M6MA 2YYRA 2MUMA 2YT5A 1X4UA 5AIUA 3PURA 5G0FA 3N9OA 2I50A 1U6GB 2ECJA 1T1HA 5H1UA 2MA5A 2K1JA 3SHBA 1BORA 1FP0A 2MNZA 1V87A 2LV9A 4X3GA 2FUIA 2XEUA 2LGGA 3GV4A 4UP0A 3HTKC 3NG2A 3HCUA 2LGKA 3PHDA 3DQVR 3U5PA 4UP5A 1WILA 2VJEA 2ECTA 4R8PK 1JOCA 3SOWA 2LGVA 2KREA 5H9MA 2VJEB 5LCWB 1HYJA 1VD4A 4LK9A 2LGLA 3U5MA 2MD8C 3O35A 4GB0A 2C2VS 3MHSA 2LXPC 4B86C 4C9ZA 1RMDA 4WZ2A 4ZQLA 5TRBA 4ZUXU 3I2DA 5KH3A 3M62A 2KYUA 5I3LA 5D1KB 4N3WA 2K4DA 1Z6UA 3ZTGA 5LKZA 4A4BA 2FSAA 1F62A 2G43A 2JMJA 4I7CA 4BHWA 4BBQA 3T6RA 4YC9A 5DINA 2JRJA 3RPGB 4YBSA 4LADB 4YAXA 3ZNIA 4CCGX 5TDRA 3N9LA 5TABA 4FK5A 4QF2A 2MIQA 2RI7A 3L1ZB 2HYED 2LN0A 3EB5A 1JM7A 2PNXA 3O37A 1DVPA 3EB6A 1MM3A 4ZDTA 1Z2QA 4P5OB 5LKTA 2G45A 4YBTA 3KNVA 4IC3A 4S3OC 2VP7A 3ZVZB 1E4UA 2ZETC 2OXQC 4QF3A 2CSZA 2YU4A 2M85A 4N4FA 2PUYA 4CA1A 4AYCA 2ECVA 2M1RA 2YW8A 3RPGC 4YABA 1WEWA 2AN6A 3KV6A 2E6RA 2F42A 2VNFA 4LKAA 3LQIA 4AYCB 1WFKA 1WEEA 2ECIA 3SOUA 3HCTA 2E6SA 3HCSA 3LQJA 4R2YA 3L1XA 2FUUA 2VPDA 1WGMA 2YURA 5B8DA 3C6WA 4I7BA 1K2FA 5H1VA 5FEYA 4A4CA 4GNGA 3O36A 4GNDA 5JG6A 5EYAF 4PPEA 3N9NA 1VFYA 3N9MA 5TBNA 2KR4A 3QZVA 2LXHC 5B75A 4GNFA 1FBVA 2YSMA 3KQIA 2VPBA 2ECWA 2JMDA 5LKXA 2BAYA 1X4JA 2DX8A 2EGPA 3O34A 3ZVYA 1WEQA 3U5OA 2ECNA 2UZGA 2LQ6A 3O70A 3IHPA 3VK6A 2CKLA 2YUCA 2YHNA 3LRQA 5LKUA 4W4UA 2QJ0A 4YADA 4I7DA 4AUQB 2Y1NA 4F52B 2CKLB 4WZ3B 2QICA 5G04B 2LDRA 5C13A 2L75A 2M3HA 3ZPVE 4AVXA 2EA6A 2YREA 2YSJA 2MD7B 4FO9A 2KGGA 3O33A 1WESA 4Q6FA 2EODA 5D1MB 4B7YC 5J3XA 5H1TA 3DPLR 3FL2A 4V3LC 2H0DA 2MA6A 2JMIA 2L43A 2IDAA 4YATA 2H0DB 5C11A 2MT5A 4TKPB 1WENA 4R7EA 2D8SA 1WEOA 2F6NA 2RSDA 4UI9B 3ZYQA 4WA6A 1CHCA 1MM2A 2L80A 2LRIC 2YQMA 2KWKA 2KWOA 2CT2A 2VPGA 4O64A 4FIPA 3MHHA 5FB0A 1N87A 4MVTA 5DKAA 1LDJB 1G25A
chains in the Genus database with same CATH superfamily
1Z60A 3RTRB 1X4IA 3N9QA 5KH9A 4V3KC 3KV5A 2KKXA 4XI1A 1VYXA 2KE1A 2L5UA 2YQLA 3M99A 4MSXA 2Y43A 3DDTA 5SVIB 4YBMA 4AP4A 2ECGA 2L0BA 3JUEA 2MNYA 3N9PA 2HDPA 4QQ4A 1IYMA 2YHOA 4A49A 1ZBDB 4L58A 2E61A 2KKYA 5D1LB 2KIZA 1WEVA 3C5KA 2KGIA 2XB1A 2F6JA 4A0CD 3LDYA 2VJFA 4PTBA 4GNEA 1XWHA 1WIMA 3SOXA 1HYIA 2VJFB 3V43A 2KWJA 1WEPA 2VPEA 4S3OB 1LDKC 4IC2A 5B77A 4WZ0A 4LJNA 1WEUA 1WE9A 2OWAA 5FB1A 5KH7A 2K17A 2CSYA 5B78A 5G05B 2Y1MA 3LQHA 5TDWA 3SUBA 4FJCA 2KWNA 2NAAA 4NN2A 5FERA 2C2LA 5B76A 3L11A 2G6QA 2KFTA 2CONA 4LLBA 3FJUB 2QIZA 5K3QA 5AITA 3FANA 2XOCA 3M63A 3DWDA 1WEMA 5SVYA 2K16A 4L7XA 2KU3A 3T7LA 5B79A 3ASLA 3GL6A 3U5NA 3ZPV1 3PUQA 1JM7B 3O7AA 2M6MA 2YYRA 4H9DA 2MUMA 2YT5A 1X4UA 5AIUA 3PURA 5G0FA 3N9OA 2I50A 1U6GB 2ECJA 1T1HA 5H1UA 2MA5A 2FFWA 2K1JA 3SHBA 1BORA 3O47A 1FP0A 2EXUA 2MNZA 1V87A 2LV9A 2LAUA 4X3GA 2FUIA 2XEUA 2LGGA 3GV4A 4UP0A 3HTKC 3NG2A 3HCUA 2LGKA 3PHDA 3DQVR 3U5PA 4UP5A 1WILA 2VJEA 2B0OE 2ECTA 4R8PK 1JOCA 3SOWA 2LGVA 2KREA 5H9MA 2VJEB 5LCWB 5SVIA 1HYJA 1VD4A 4Z0RA 4LK9A 5SVXA 2LGLA 3U5MA 2MD8C 3O35A 4GB0A 2C2VS 3MHSA 2LXPC 3PLWA 4B86C 4C9ZA 1RMDA 4WZ2A 4ZQLA 5TRBA 4ZUXU 3I2DA 5KH3A 2MKEA 3M62A 2KYUA 5I3LA 5D1KB 4N3WA 1DCQA 2K4DA 2DJAA 1Z6UA 3ZTGA 5LKZA 4A4BA 2FSAA 1F62A 2G43A 2JMJA 4I7CA 4BHWA 3H7HA 4BBQA 3T6RA 2CRRA 4YC9A 5DINA 2JRJA 3RPGB 4YBSA 4LADB 4YAXA 3ZNIA 4CCGX 5TDRA 3N9LA 5TABA 2CRWA 4FK5A 4QF2A 2MIQA 2RI7A 3L1ZB 2YVRA 2HYED 2LN0A 3EB5A 1JM7A 2PNXA 3O37A 3E2DA 1DVPA 3EB6A 1MM3A 4ZDTA 1Z2QA 4P5OB 5LKTA 2G45A 4YBTA 3KNVA 4IC3A 4S3OC 2VP7A 3MDBC 3ZVZB 1E4UA 2ZETC 2OXQC 4QF3A 2CSZA 2JM3A 2YU4A 3LJUX 2M85A 4Z0OA 4N4FA 2PUYA 4CA1A 4AYCA 2ECVA 2M1RA 2YW8A 3RPGC 4YABA 1WEWA 2AN6A 3FM8C 3KV6A 2E6RA 3KDEC 2F42A 2VNFA 4LKAA 3LQIA 4AYCB 1WFKA 1WEEA 2ECIA 3SOUA 3HCTA 2E6SA 3HCSA 3LQJA 4R2YA 3L1XA 2FUUA 2VPDA 1WGMA 2YURA 5B8DA 2DSMA 3C6WA 2XOZA 1K2FA 4I7BA 5FEYA 5H1VA 4A4CA 4GNGA 3Q1DA 3O36A 2XP0A 4GNDA 5JG6A 3FEHA 5EYAF 4PPEA 3N9NA 1VFYA 3N9MA 5TBNA 2JUNA 2KR4A 3QZVA 2LXHC 5B75A 4GNFA 4OGEA 1FBVA 3FAOA 2D8UA 2YSMA 3KQIA 2M13A 2VPBA 2ECWA 2JMDA 5LKXA 2BAYA 1X4JA 2IQJA 2DX8A 2EGPA 3O34A 3ZVYA 3LVRE 1WEQA 3U5OA 2ECNA 2RR4A 2UZGA 2LQ6A 3O70A 3IHPA 3VK6A 2CKLA 2YUCA 2YHNA 3LRQA 5LKUA 4W4UA 2QJ0A 4YADA 4I7DA 4AUQB 2Y1NA 4F52B 2CKLB 4WZ3B 2EGMA 2QICA 5G04B 2LDRA 4OGCA 5C13A 2L75A 2M3HA 3LVQE 3ZPVE 4AVXA 2EA6A 2YREA 2YSJA 2MD7B 4FO9A 2KGGA 2FD4A 3O33A 1WESA 4Q6FA 2EODA 5D1MB 4B7YC 5J3XA 5H1TA 3DPLR 3FL2A 2XOYA 4V3LC 3M7KA 2H0DA 2MA6A 2JMIA 2L43A 2IDAA 4YATA 4F1PA 2H0DB 5C11A 2MT5A 4TKPB 1WENA 4R7EA 2D8SA 1WEOA 2F6NA 2RSDA 4UI9B 3ZYQA 4WA6A 1CHCA 1MM2A 2L80A 2L7PA 2LRIC 2YQMA 4O62A 2KWKA 2KWOA 3T9KA 2CT2A 2VPGA 4O64A 4FIPA 3MHHA 5FB0A 1N87A 4MVTA 1MBMA 5DKAA 2CSVA 1LDJB 1G25A 2P57A
chains in the Genus database with same CATH topology
1Z60A 3RTRB 1X4IA 3N9QA 5KH9A 4V3KC 3KV5A 4XI1A 1VYXA 2KE1A 2L5UA 2YQLA 3M99A 4MSXA 2Y43A 4YBMA 4AP4A 2ECGA 2L0BA 2MNYA 3N9PA 2HDPA 1IYMA 2YHOA 4A49A 1ZBDB 4L58A 5D1LB 2KIZA 1WEVA 3C5KA 2KGIA 2XB1A 2F6JA 4A0CD 2VJFA 4PTBA 4GNEA 1XWHA 1WIMA 3SOXA 1HYIA 2VJFB 3V43A 2KWJA 1WEPA 2VPEA 4S3OB 1LDKC 4IC2A 5B77A 4WZ0A 4LJNA 1WEUA 1WE9A 5KH7A 5FB1A 2K17A 2CSYA 5B78A 5G05B 2Y1MA 3LQHA 5TDWA 4FJCA 2KWNA 2NAAA 4NN2A 5FERA 2C2LA 5B76A 3L11A 2G6QA 2KFTA 4LLBA 2QIZA 5AITA 3M63A 1WEMA 2K16A 4L7XA 2KU3A 3T7LA 5B79A 3ASLA 3GL6A 3U5NA 3ZPV1 3PUQA 1JM7B 3O7AA 2M6MA 2YYRA 2MUMA 2YT5A 1X4UA 5AIUA 3PURA 5G0FA 3N9OA 2I50A 1U6GB 2ECJA 1T1HA 5H1UA 2MA5A 2K1JA 3SHBA 1BORA 1FP0A 2MNZA 1V87A 2LV9A 4X3GA 2FUIA 2XEUA 2LGGA 3GV4A 4UP0A 3HTKC 3NG2A 3HCUA 2LGKA 3PHDA 3DQVR 3U5PA 4UP5A 1WILA 2VJEA 2ECTA 4R8PK 1JOCA 3SOWA 2LGVA 2KREA 5H9MA 2VJEB 5LCWB 1HYJA 1VD4A 4LK9A 2LGLA 3U5MA 2MD8C 3O35A 4GB0A 2C2VS 3MHSA 2LXPC 4B86C 4C9ZA 1RMDA 4WZ2A 4ZQLA 5TRBA 4ZUXU 3I2DA 5KH3A 3M62A 2KYUA 5I3LA 5D1KB 4N3WA 2K4DA 1Z6UA 3ZTGA 5LKZA 4A4BA 2FSAA 1F62A 2G43A 2JMJA 4I7CA 4BHWA 4BBQA 3T6RA 4YC9A 5DINA 2JRJA 3RPGB 4YBSA 4LADB 4YAXA 3ZNIA 4CCGX 5TDRA 3N9LA 5TABA 4FK5A 4QF2A 2MIQA 2RI7A 3L1ZB 2HYED 2LN0A 3EB5A 1JM7A 2PNXA 3O37A 1DVPA 3EB6A 1MM3A 4ZDTA 1Z2QA 4P5OB 5LKTA 2G45A 4YBTA 3KNVA 4IC3A 4S3OC 2VP7A 3ZVZB 1E4UA 2ZETC 2OXQC 4QF3A 2CSZA 2YU4A 2M85A 4N4FA 2PUYA 4CA1A 4AYCA 2ECVA 2M1RA 2YW8A 3RPGC 4YABA 1WEWA 2AN6A 3KV6A 2E6RA 2F42A 2VNFA 4LKAA 3LQIA 4AYCB 1WFKA 1WEEA 2ECIA 3SOUA 3HCTA 2E6SA 3HCSA 3LQJA 4R2YA 3L1XA 2FUUA 2VPDA 1WGMA 2YURA 5B8DA 3C6WA 4I7BA 1K2FA 5H1VA 5FEYA 4A4CA 4GNGA 3O36A 4GNDA 5JG6A 5EYAF 4PPEA 3N9NA 1VFYA 3N9MA 5TBNA 2KR4A 3QZVA 2LXHC 5B75A 4GNFA 1FBVA 2YSMA 3KQIA 2VPBA 2ECWA 2JMDA 5LKXA 2BAYA 1X4JA 2DX8A 2EGPA 3O34A 3ZVYA 1WEQA 3U5OA 2ECNA 2UZGA 2LQ6A 3O70A 3IHPA 3VK6A 2CKLA 2YUCA 2YHNA 3LRQA 5LKUA 4W4UA 2QJ0A 4YADA 4I7DA 4AUQB 2Y1NA 4F52B 2CKLB 4WZ3B 2QICA 5G04B 2LDRA 5C13A 2L75A 2M3HA 3ZPVE 4AVXA 2EA6A 2YREA 2YSJA 2MD7B 4FO9A 2KGGA 3O33A 1WESA 4Q6FA 2EODA 5D1MB 4B7YC 5J3XA 5H1TA 3DPLR 3FL2A 4V3LC 2H0DA 2MA6A 2JMIA 2L43A 2IDAA 4YATA 2H0DB 5C11A 2MT5A 4TKPB 1WENA 4R7EA 2D8SA 1WEOA 2F6NA 2RSDA 4UI9B 3ZYQA 4WA6A 1CHCA 1MM2A 2L80A 2LRIC 2YQMA 2KWKA 2KWOA 2CT2A 2VPGA 4O64A 4FIPA 3MHHA 5FB0A 1N87A 4MVTA 5DKAA 1LDJB 1G25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z60 A;  3RTR B;  1X4I A;  3N9Q A;  5KH9 A;  4V3K C;  3KV5 A;  4XI1 A;  1VYX A;  2KE1 A;  2L5U A;  2YQL A;  3M99 A;  4MSX A;  2Y43 A;  4YBM A;  4AP4 A;  2ECG A;  2L0B A;  2MNY A;  3N9P A;  2HDP A;  1IYM A;  2YHO A;  4A49 A;  1ZBD B;  4L58 A;  5D1L B;  2KIZ A;  1WEV A;  3C5K A;  2KGI A;  2XB1 A;  2F6J A;  4A0C D;  2VJF A;  4PTB A;  4GNE A;  1XWH A;  1WIM A;  3SOX A;  1HYI A;  2VJF B;  3V43 A;  2KWJ A;  1WEP A;  2VPE A;  4S3O B;  1LDK C;  4IC2 A;  5B77 A;  4WZ0 A;  4LJN A;  1WEU A;  1WE9 A;  5KH7 A;  5FB1 A;  2K17 A;  2CSY A;  5B78 A;  5G05 B;  2Y1M A;  3LQH A;  5TDW A;  4FJC A;  2KWN A;  2NAA A;  4NN2 A;  5FER A;  2C2L A;  5B76 A;  3L11 A;  2G6Q A;  2KFT A;  4LLB A;  2QIZ A;  5AIT A;  3M63 A;  1WEM A;  2K16 A;  4L7X A;  2KU3 A;  3T7L A;  5B79 A;  3ASL A;  3GL6 A;  3U5N A;  3ZPV 1;  3PUQ A;  1JM7 B;  3O7A A;  2M6M A;  2YYR A;  2MUM A;  2YT5 A;  1X4U A;  5AIU A;  3PUR A;  5G0F A;  3N9O A;  2I50 A;  1U6G B;  2ECJ A;  1T1H A;  5H1U A;  2MA5 A;  2K1J A;  3SHB A;  1BOR A;  1FP0 A;  2MNZ A;  1V87 A;  2LV9 A;  4X3G A;  2FUI A;  2XEU A;  2LGG A;  3GV4 A;  4UP0 A;  3HTK C;  3NG2 A;  3HCU A;  2LGK A;  3PHD A;  3DQV R;  3U5P A;  4UP5 A;  1WIL A;  2VJE A;  2ECT A;  4R8P K;  1JOC A;  3SOW A;  2LGV A;  2KRE A;  5H9M A;  2VJE B;  5LCW B;  1HYJ A;  1VD4 A;  4LK9 A;  2LGL A;  3U5M A;  2MD8 C;  3O35 A;  4GB0 A;  2C2V S;  3MHS A;  2LXP C;  4B86 C;  4C9Z A;  1RMD A;  4WZ2 A;  4ZQL A;  5TRB A;  4ZUX U;  3I2D A;  5KH3 A;  3M62 A;  2KYU A;  5I3L A;  5D1K B;  4N3W A;  2K4D A;  1Z6U A;  3ZTG A;  5LKZ A;  4A4B A;  2FSA A;  1F62 A;  2G43 A;  2JMJ A;  4I7C A;  4BHW A;  4BBQ A;  3T6R A;  4YC9 A;  5DIN A;  2JRJ A;  3RPG B;  4YBS A;  4LAD B;  4YAX A;  3ZNI A;  4CCG X;  5TDR A;  3N9L A;  5TAB A;  4FK5 A;  4QF2 A;  2MIQ A;  2RI7 A;  3L1Z B;  2HYE D;  2LN0 A;  3EB5 A;  1JM7 A;  2PNX A;  3O37 A;  1DVP A;  3EB6 A;  1MM3 A;  4ZDT A;  1Z2Q A;  4P5O B;  5LKT A;  2G45 A;  4YBT A;  3KNV A;  4IC3 A;  4S3O C;  2VP7 A;  3ZVZ B;  1E4U A;  2ZET C;  2OXQ C;  4QF3 A;  2CSZ A;  2YU4 A;  2M85 A;  4N4F A;  2PUY A;  4CA1 A;  4AYC A;  2ECV A;  2M1R A;  2YW8 A;  3RPG C;  4YAB A;  1WEW A;  2AN6 A;  3KV6 A;  2E6R A;  2F42 A;  2VNF A;  4LKA A;  3LQI A;  4AYC B;  1WFK A;  1WEE A;  2ECI A;  3SOU A;  3HCT A;  2E6S A;  3HCS A;  3LQJ A;  4R2Y A;  3L1X A;  2FUU A;  2VPD A;  1WGM A;  2YUR A;  5B8D A;  3C6W A;  4I7B A;  1K2F A;  5H1V A;  5FEY A;  4A4C A;  4GNG A;  3O36 A;  4GND A;  5JG6 A;  5EYA F;  4PPE A;  3N9N A;  1VFY A;  3N9M A;  5TBN A;  2KR4 A;  3QZV A;  2LXH C;  5B75 A;  4GNF A;  1FBV A;  2YSM A;  3KQI A;  2VPB A;  2ECW A;  2JMD A;  5LKX A;  2BAY A;  1X4J A;  2DX8 A;  2EGP A;  3O34 A;  3ZVY A;  1WEQ A;  3U5O A;  2ECN A;  2UZG A;  2LQ6 A;  3O70 A;  3IHP A;  3VK6 A;  2CKL A;  2YUC A;  2YHN A;  3LRQ A;  5LKU A;  4W4U A;  2QJ0 A;  4YAD A;  4I7D A;  4AUQ B;  2Y1N A;  4F52 B;  2CKL B;  4WZ3 B;  2QIC A;  5G04 B;  2LDR A;  5C13 A;  2L75 A;  2M3H A;  3ZPV E;  4AVX A;  2EA6 A;  2YRE A;  2YSJ A;  2MD7 B;  4FO9 A;  2KGG A;  3O33 A;  1WES A;  4Q6F A;  2EOD A;  5D1M B;  4B7Y C;  5J3X A;  5H1T A;  3DPL R;  3FL2 A;  4V3L C;  2H0D A;  2MA6 A;  2JMI A;  2L43 A;  2IDA A;  4YAT A;  2H0D B;  5C11 A;  2MT5 A;  4TKP B;  1WEN A;  4R7E A;  2D8S A;  1WEO A;  2F6N A;  2RSD A;  4UI9 B;  3ZYQ A;  4WA6 A;  1CHC A;  1MM2 A;  2L80 A;  2LRI C;  2YQM A;  2KWK A;  2KWO A;  2CT2 A;  2VPG A;  4O64 A;  4FIP A;  3MHH A;  5FB0 A;  1N87 A;  4MVT A;  5DKA A;  1LDJ B;  1G25 A; 
#chains in the Genus database with same CATH topology
 1Z60 A;  3RTR B;  1X4I A;  3N9Q A;  5KH9 A;  4V3K C;  3KV5 A;  2KKX A;  4XI1 A;  1VYX A;  2KE1 A;  2L5U A;  2YQL A;  3M99 A;  4MSX A;  2Y43 A;  3DDT A;  5SVI B;  4YBM A;  4AP4 A;  2ECG A;  2L0B A;  3JUE A;  2MNY A;  3N9P A;  2HDP A;  4QQ4 A;  1IYM A;  2YHO A;  4A49 A;  1ZBD B;  4L58 A;  2E61 A;  2KKY A;  5D1L B;  2KIZ A;  1WEV A;  3C5K A;  2KGI A;  2XB1 A;  2F6J A;  4A0C D;  3LDY A;  2VJF A;  4PTB A;  4GNE A;  1XWH A;  1WIM A;  3SOX A;  1HYI A;  2VJF B;  3V43 A;  2KWJ A;  1WEP A;  2VPE A;  4S3O B;  1LDK C;  4IC2 A;  5B77 A;  4WZ0 A;  4LJN A;  1WEU A;  1WE9 A;  2OWA A;  5FB1 A;  5KH7 A;  2K17 A;  2CSY A;  5B78 A;  5G05 B;  2Y1M A;  3LQH A;  5TDW A;  3SUB A;  4FJC A;  2KWN A;  2NAA A;  4NN2 A;  5FER A;  2C2L A;  5B76 A;  3L11 A;  2G6Q A;  2KFT A;  2CON A;  4LLB A;  3FJU B;  2QIZ A;  5K3Q A;  5AIT A;  3FAN A;  2XOC A;  3M63 A;  3DWD A;  1WEM A;  5SVY A;  2K16 A;  4L7X A;  2KU3 A;  3T7L A;  5B79 A;  3ASL A;  3GL6 A;  3U5N A;  3ZPV 1;  3PUQ A;  1JM7 B;  3O7A A;  2M6M A;  2YYR A;  4H9D A;  2MUM A;  2YT5 A;  1X4U A;  5AIU A;  3PUR A;  5G0F A;  3N9O A;  2I50 A;  1U6G B;  2ECJ A;  1T1H A;  5H1U A;  2MA5 A;  2FFW A;  2K1J A;  3SHB A;  1BOR A;  3O47 A;  1FP0 A;  2EXU A;  2MNZ A;  1V87 A;  2LV9 A;  2LAU A;  4X3G A;  2FUI A;  2XEU A;  2LGG A;  3GV4 A;  4UP0 A;  3HTK C;  3NG2 A;  3HCU A;  2LGK A;  3PHD A;  3DQV R;  3U5P A;  4UP5 A;  1WIL A;  2VJE A;  2B0O E;  2ECT A;  4R8P K;  1JOC A;  3SOW A;  2LGV A;  2KRE A;  5H9M A;  2VJE B;  5LCW B;  5SVI A;  1HYJ A;  1VD4 A;  4Z0R A;  4LK9 A;  5SVX A;  2LGL A;  3U5M A;  2MD8 C;  3O35 A;  4GB0 A;  2C2V S;  3MHS A;  2LXP C;  3PLW A;  4B86 C;  4C9Z A;  1RMD A;  4WZ2 A;  4ZQL A;  5TRB A;  4ZUX U;  3I2D A;  5KH3 A;  2MKE A;  3M62 A;  2KYU A;  5I3L A;  5D1K B;  4N3W A;  1DCQ A;  2K4D A;  2DJA A;  1Z6U A;  3ZTG A;  5LKZ A;  4A4B A;  2FSA A;  1F62 A;  2G43 A;  2JMJ A;  4I7C A;  4BHW A;  3H7H A;  4BBQ A;  3T6R A;  2CRR A;  4YC9 A;  5DIN A;  2JRJ A;  3RPG B;  4YBS A;  4LAD B;  4YAX A;  3ZNI A;  4CCG X;  5TDR A;  3N9L A;  5TAB A;  2CRW A;  4FK5 A;  4QF2 A;  2MIQ A;  2RI7 A;  3L1Z B;  2YVR A;  2HYE D;  2LN0 A;  3EB5 A;  1JM7 A;  2PNX A;  3O37 A;  3E2D A;  1DVP A;  3EB6 A;  1MM3 A;  4ZDT A;  1Z2Q A;  4P5O B;  5LKT A;  2G45 A;  4YBT A;  3KNV A;  4IC3 A;  4S3O C;  2VP7 A;  3MDB C;  3ZVZ B;  1E4U A;  2ZET C;  2OXQ C;  4QF3 A;  2CSZ A;  2JM3 A;  2YU4 A;  3LJU X;  2M85 A;  4Z0O A;  4N4F A;  2PUY A;  4CA1 A;  4AYC A;  2ECV A;  2M1R A;  2YW8 A;  3RPG C;  4YAB A;  1WEW A;  2AN6 A;  3FM8 C;  3KV6 A;  2E6R A;  3KDE C;  2F42 A;  2VNF A;  4LKA A;  3LQI A;  4AYC B;  1WFK A;  1WEE A;  2ECI A;  3SOU A;  3HCT A;  2E6S A;  3HCS A;  3LQJ A;  4R2Y A;  3L1X A;  2FUU A;  2VPD A;  1WGM A;  2YUR A;  5B8D A;  2DSM A;  3C6W A;  2XOZ A;  1K2F A;  4I7B A;  5FEY A;  5H1V A;  4A4C A;  4GNG A;  3Q1D A;  3O36 A;  2XP0 A;  4GND A;  5JG6 A;  3FEH A;  5EYA F;  4PPE A;  3N9N A;  1VFY A;  3N9M A;  5TBN A;  2JUN A;  2KR4 A;  3QZV A;  2LXH C;  5B75 A;  4GNF A;  4OGE A;  1FBV A;  3FAO A;  2D8U A;  2YSM A;  3KQI A;  2M13 A;  2VPB A;  2ECW A;  2JMD A;  5LKX A;  2BAY A;  1X4J A;  2IQJ A;  2DX8 A;  2EGP A;  3O34 A;  3ZVY A;  3LVR E;  1WEQ A;  3U5O A;  2ECN A;  2RR4 A;  2UZG A;  2LQ6 A;  3O70 A;  3IHP A;  3VK6 A;  2CKL A;  2YUC A;  2YHN A;  3LRQ A;  5LKU A;  4W4U A;  2QJ0 A;  4YAD A;  4I7D A;  4AUQ B;  2Y1N A;  4F52 B;  2CKL B;  4WZ3 B;  2EGM A;  2QIC A;  5G04 B;  2LDR A;  4OGC A;  5C13 A;  2L75 A;  2M3H A;  3LVQ E;  3ZPV E;  4AVX A;  2EA6 A;  2YRE A;  2YSJ A;  2MD7 B;  4FO9 A;  2KGG A;  2FD4 A;  3O33 A;  1WES A;  4Q6F A;  2EOD A;  5D1M B;  4B7Y C;  5J3X A;  5H1T A;  3DPL R;  3FL2 A;  2XOY A;  4V3L C;  3M7K A;  2H0D A;  2MA6 A;  2JMI A;  2L43 A;  2IDA A;  4YAT A;  4F1P A;  2H0D B;  5C11 A;  2MT5 A;  4TKP B;  1WEN A;  4R7E A;  2D8S A;  1WEO A;  2F6N A;  2RSD A;  4UI9 B;  3ZYQ A;  4WA6 A;  1CHC A;  1MM2 A;  2L80 A;  2L7P A;  2LRI C;  2YQM A;  4O62 A;  2KWK A;  2KWO A;  3T9K A;  2CT2 A;  2VPG A;  4O64 A;  4FIP A;  3MHH A;  5FB0 A;  1N87 A;  4MVT A;  1MBM A;  5DKA A;  2CSV A;  1LDJ B;  1G25 A;  2P57 A; 
#chains in the Genus database with same CATH homology
 1Z60 A;  3RTR B;  1X4I A;  3N9Q A;  5KH9 A;  4V3K C;  3KV5 A;  4XI1 A;  1VYX A;  2KE1 A;  2L5U A;  2YQL A;  3M99 A;  4MSX A;  2Y43 A;  4YBM A;  4AP4 A;  2ECG A;  2L0B A;  2MNY A;  3N9P A;  2HDP A;  1IYM A;  2YHO A;  4A49 A;  1ZBD B;  4L58 A;  5D1L B;  2KIZ A;  1WEV A;  3C5K A;  2KGI A;  2XB1 A;  2F6J A;  4A0C D;  2VJF A;  4PTB A;  4GNE A;  1XWH A;  1WIM A;  3SOX A;  1HYI A;  2VJF B;  3V43 A;  2KWJ A;  1WEP A;  2VPE A;  4S3O B;  1LDK C;  4IC2 A;  5B77 A;  4WZ0 A;  4LJN A;  1WEU A;  1WE9 A;  5KH7 A;  5FB1 A;  2K17 A;  2CSY A;  5B78 A;  5G05 B;  2Y1M A;  3LQH A;  5TDW A;  4FJC A;  2KWN A;  2NAA A;  4NN2 A;  5FER A;  2C2L A;  5B76 A;  3L11 A;  2G6Q A;  2KFT A;  4LLB A;  2QIZ A;  5AIT A;  3M63 A;  1WEM A;  2K16 A;  4L7X A;  2KU3 A;  3T7L A;  5B79 A;  3ASL A;  3GL6 A;  3U5N A;  3ZPV 1;  3PUQ A;  1JM7 B;  3O7A A;  2M6M A;  2YYR A;  2MUM A;  2YT5 A;  1X4U A;  5AIU A;  3PUR A;  5G0F A;  3N9O A;  2I50 A;  1U6G B;  2ECJ A;  1T1H A;  5H1U A;  2MA5 A;  2K1J A;  3SHB A;  1BOR A;  1FP0 A;  2MNZ A;  1V87 A;  2LV9 A;  4X3G A;  2FUI A;  2XEU A;  2LGG A;  3GV4 A;  4UP0 A;  3HTK C;  3NG2 A;  3HCU A;  2LGK A;  3PHD A;  3DQV R;  3U5P A;  4UP5 A;  1WIL A;  2VJE A;  2ECT A;  4R8P K;  1JOC A;  3SOW A;  2LGV A;  2KRE A;  5H9M A;  2VJE B;  5LCW B;  1HYJ A;  1VD4 A;  4LK9 A;  2LGL A;  3U5M A;  2MD8 C;  3O35 A;  4GB0 A;  2C2V S;  3MHS A;  2LXP C;  4B86 C;  4C9Z A;  1RMD A;  4WZ2 A;  4ZQL A;  5TRB A;  4ZUX U;  3I2D A;  5KH3 A;  3M62 A;  2KYU A;  5I3L A;  5D1K B;  4N3W A;  2K4D A;  1Z6U A;  3ZTG A;  5LKZ A;  4A4B A;  2FSA A;  1F62 A;  2G43 A;  2JMJ A;  4I7C A;  4BHW A;  4BBQ A;  3T6R A;  4YC9 A;  5DIN A;  2JRJ A;  3RPG B;  4YBS A;  4LAD B;  4YAX A;  3ZNI A;  4CCG X;  5TDR A;  3N9L A;  5TAB A;  4FK5 A;  4QF2 A;  2MIQ A;  2RI7 A;  3L1Z B;  2HYE D;  2LN0 A;  3EB5 A;  1JM7 A;  2PNX A;  3O37 A;  1DVP A;  3EB6 A;  1MM3 A;  4ZDT A;  1Z2Q A;  4P5O B;  5LKT A;  2G45 A;  4YBT A;  3KNV A;  4IC3 A;  4S3O C;  2VP7 A;  3ZVZ B;  1E4U A;  2ZET C;  2OXQ C;  4QF3 A;  2CSZ A;  2YU4 A;  2M85 A;  4N4F A;  2PUY A;  4CA1 A;  4AYC A;  2ECV A;  2M1R A;  2YW8 A;  3RPG C;  4YAB A;  1WEW A;  2AN6 A;  3KV6 A;  2E6R A;  2F42 A;  2VNF A;  4LKA A;  3LQI A;  4AYC B;  1WFK A;  1WEE A;  2ECI A;  3SOU A;  3HCT A;  2E6S A;  3HCS A;  3LQJ A;  4R2Y A;  3L1X A;  2FUU A;  2VPD A;  1WGM A;  2YUR A;  5B8D A;  3C6W A;  4I7B A;  1K2F A;  5H1V A;  5FEY A;  4A4C A;  4GNG A;  3O36 A;  4GND A;  5JG6 A;  5EYA F;  4PPE A;  3N9N A;  1VFY A;  3N9M A;  5TBN A;  2KR4 A;  3QZV A;  2LXH C;  5B75 A;  4GNF A;  1FBV A;  2YSM A;  3KQI A;  2VPB A;  2ECW A;  2JMD A;  5LKX A;  2BAY A;  1X4J A;  2DX8 A;  2EGP A;  3O34 A;  3ZVY A;  1WEQ A;  3U5O A;  2ECN A;  2UZG A;  2LQ6 A;  3O70 A;  3IHP A;  3VK6 A;  2CKL A;  2YUC A;  2YHN A;  3LRQ A;  5LKU A;  4W4U A;  2QJ0 A;  4YAD A;  4I7D A;  4AUQ B;  2Y1N A;  4F52 B;  2CKL B;  4WZ3 B;  2QIC A;  5G04 B;  2LDR A;  5C13 A;  2L75 A;  2M3H A;  3ZPV E;  4AVX A;  2EA6 A;  2YRE A;  2YSJ A;  2MD7 B;  4FO9 A;  2KGG A;  3O33 A;  1WES A;  4Q6F A;  2EOD A;  5D1M B;  4B7Y C;  5J3X A;  5H1T A;  3DPL R;  3FL2 A;  4V3L C;  2H0D A;  2MA6 A;  2JMI A;  2L43 A;  2IDA A;  4YAT A;  2H0D B;  5C11 A;  2MT5 A;  4TKP B;  1WEN A;  4R7E A;  2D8S A;  1WEO A;  2F6N A;  2RSD A;  4UI9 B;  3ZYQ A;  4WA6 A;  1CHC A;  1MM2 A;  2L80 A;  2LRI C;  2YQM A;  2KWK A;  2KWO A;  2CT2 A;  2VPG A;  4O64 A;  4FIP A;  3MHH A;  5FB0 A;  1N87 A;  4MVT A;  5DKA A;  1LDJ B;  1G25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...