5G04B

Structure of the human apc-cdc20-hsl1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g04B00
3L11A 2YUCA 3FL2A 3M62A 4YBMA 5H9MA 3N9PA 2VPBA 2KWOA 4YBSA 1JM7A 2FSAA 3SOWA 4MVTA 2ECNA 4BHWA 1FP0A 2YQLA 2YHOA 2BAYA 5KH3A 2F42A 2ECJA 2DX8A 2C2LA 4GNFA 2VPDA 2M85A 2MNYA 5D1LB 2YREA 4S3OC 3LRQA 4BBQA 5B75A 1WEQA 2MIQA 2KIZA 2UZGA 1T1HA 2M1RA 2YURA 1G25A 2QICA 2YHNA 1DVPA 3V43A 2LGGA 4LK9A 4GB0A 2YYRA 1WENA 1HYIA 3T6RA 3LQJA 2EA6A 3M63A 1X4UA 2L0BA 3O33A 3O37A 2YU4A 2CSYA 1VD4A 2XEUA 2LGKA 2MD7B 4ZQLA 2L80A 3ZPVE 4QF2A 4B86C 2E6SA 4PPEA 3MHSA 2VJEA 4L7XA 1ZBDB 5TBNA 1X4JA 5JG6A 3SOUA 5G05B 1XWHA 1WFKA 5LCWB 3VK6A 3U5NA 4LADB 5KH9A 3RPGB 2OXQC 1WEMA 2KR4A 5D1MB 3U5OA 4R8PK 4AYCA 2VNFA 2LGLA 4I7DA 2KWNA 4YBTA 4GNGA 5LKUA 4GNDA 2YQMA 4NN2A 1FBVA 4N3WA 3M99A 3DPLR 2ECVA 4UI9B 5H1UA 4ZUXU 4TKPB 2K17A 1X4IA 4LKAA 1WE9A 2LGVA 2LV9A 4XI1A 5EYAF 2JMJA 2EODA 2IDAA 3ASLA 2KYUA 4O64A 2ECGA 4UP0A 3RPGC 1WIMA 2Y1MA 4QF3A 2VPEA 3O7AA 2F6JA 4YADA 3HTKC 2MA6A 3ZNIA 1V87A 2H0DB 4IC3A 3IHPA 4FO9A 2YT5A 1WILA 3O36A 2C2VS 3U5PA 5TDRA 2HDPA 3ZTGA 3O34A 3HCUA 4R2YA 4WA6A 2L5UA 4YAXA 1BORA 4GNEA 5I3LA 5B76A 1WEEA 3PURA 5DINA 4B7YC 1MM2A 3RTRB 4UP5A 1HYJA 3LQIA 2K16A 1VYXA 4A0CD 3O70A 4R7EA 2LDRA 5FERA 4WZ0A 3U5MA 2H0DA 2K4DA 5H1VA 2LXHC 2RSDA 3KNVA 2CSZA 2MT5A 1WEWA 5TDWA 2M6MA 5FB1A 2KWJA 2G43A 2EGPA 2F6NA 2G6QA 1WEPA 2MNZA 2KU3A 2ZETC 4ZDTA 5LKTA 1Z2QA 2QIZA 4MSXA 3ZPV1 5DKAA 5B8DA 2AN6A 1LDKC 1VFYA 4IC2A 1WESA 2JRJA 4A4BA 4FJCA 3KV6A 5KH7A 5B77A 3I2DA 4C9ZA 2KGGA 3T7LA 4CA1A 4X3GA 5LKXA 1WGMA 3SHBA 3GV4A 3HCTA 1U6GB 2XB1A 4AVXA 2L75A 5D1KB 1WEVA 3L1ZB 2MUMA 2MD8C 3QZVA 2M3HA 2LXPC 3L1XA 2VJFB 2VP7A 2CKLB 4LJNA 2KGIA 2VPGA 3N9LA 3C6WA 4F52B 2G45A 1IYMA 2FUIA 2Y1NA 5FB0A 4PTBA 2LQ6A 2YW8A 2D8SA 1WEUA 5C13A 3MHHA 5TABA 1MM3A 3NG2A 3N9MA 1CHCA 2K1JA 2NAAA 5AIUA 2ECIA 4Q6FA 2I50A 4V3KC 3PUQA 4N4FA 2YSJA 5H1TA 5G0FA 5LKZA 2VJFA 2YSMA 2CKLA 4L58A 2ECWA 4A4CA 4FK5A 2VJEB 2RI7A 2Y43A 3EB6A 4CCGX 2PUYA 1RMDA 2JMIA 4FIPA 3PHDA 3N9QA 4W4UA 3ZYQA 4P5OB 4WZ2A 5AITA 4I7CA 3EB5A 1Z6UA 3ZVYA 3DQVR 4YABA 3KV5A 4I7BA 2L43A 3LQHA 4AYCB 2E6RA 5B79A 2KREA 3ZVZB 3GL6A 5J3XA 3HCSA 5C11A 3N9OA 4AUQB 5FEYA 2JMDA 2MA5A 3SOXA 2ECTA 2KE1A 1Z60A 3O35A 5B78A 1JOCA 2FUUA 1LDJB 5TRBA 1JM7B 4AP4A 4A49A 3N9NA 1E4UA 2KFTA 1WEOA 2HYED 2LRIC 2CT2A 3C5KA 1F62A 2LN0A 4S3OB 5G04B 4WZ3B 4YC9A 3KQIA 4LLBA 1N87A 2KWKA 2PNXA 1K2FA 4V3LC 4YATA 2QJ0A
chains in the Genus database with same CATH superfamily
3L11A 2YUCA 3FL2A 3M62A 4YBMA 5H9MA 3N9PA 2VPBA 2KWOA 4OGCA 4YBSA 1JM7A 2FSAA 3SOWA 4MVTA 2ECNA 4BHWA 1FP0A 2YQLA 2YHOA 2BAYA 5KH3A 2F42A 3SUBA 2ECJA 3FM8C 2DX8A 2C2LA 4GNFA 2VPDA 2DSMA 2M85A 2MNYA 5D1LB 2YREA 4S3OC 3LRQA 4BBQA 5B75A 1WEQA 2MIQA 2EXUA 2KIZA 2UZGA 1T1HA 2M1RA 2YURA 3T9KA 1G25A 2QICA 2YHNA 1DVPA 3V43A 2LGGA 4LK9A 4GB0A 2YYRA 1WENA 2L7PA 1HYIA 3T6RA 3LQJA 2EA6A 3M63A 1X4UA 2L0BA 3O33A 3O37A 2YU4A 2CSYA 1VD4A 5SVYA 2DJAA 2XEUA 2LGKA 2MD7B 3MDBC 4ZQLA 2L80A 3ZPVE 4QF2A 2RR4A 4B86C 3H7HA 2E6SA 4PPEA 3MHSA 2CRWA 2VJEA 4L7XA 1ZBDB 5TBNA 1X4JA 5JG6A 3SOUA 4H9DA 5G05B 1XWHA 1WFKA 5LCWB 3VK6A 3U5NA 4LADB 5KH9A 3RPGB 3PLWA 2OXQC 3LJUX 1WEMA 2KR4A 5SVXA 2EGMA 2KKXA 5D1MB 3U5OA 4R8PK 4AYCA 2VNFA 2LGLA 4I7DA 2KWNA 4YBTA 4GNGA 5LKUA 4GNDA 2YQMA 4NN2A 1FBVA 4N3WA 2E61A 3M99A 3DPLR 2ECVA 4UI9B 5H1UA 4Z0RA 3Q1DA 4ZUXU 4TKPB 2K17A 1X4IA 4LKAA 1WE9A 5K3QA 2LGVA 2LV9A 4XI1A 5EYAF 2JMJA 2EODA 2IDAA 3ASLA 2KYUA 4O64A 2IQJA 2ECGA 2FD4A 4UP0A 3RPGC 1WIMA 2LAUA 2Y1MA 4QF3A 2VPEA 3O7AA 2F6JA 4YADA 3HTKC 2MA6A 3ZNIA 4QQ4A 1V87A 2H0DB 4IC3A 3IHPA 4FO9A 2YT5A 1WILA 3O36A 2C2VS 3FANA 3U5PA 5TDRA 2HDPA 3ZTGA 3O34A 3HCUA 2YVRA 4R2YA 2MKEA 4WA6A 2L5UA 4YAXA 1DCQA 1BORA 4GNEA 5I3LA 2JUNA 5B76A 1WEEA 3PURA 5DINA 4B7YC 1MM2A 3RTRB 4UP5A 1HYJA 3E2DA 3LQIA 2K16A 1VYXA 4A0CD 3O70A 4R7EA 2LDRA 5FERA 4WZ0A 3U5MA 2H0DA 2K4DA 5H1VA 2LXHC 2RSDA 3KNVA 2CSZA 2MT5A 1WEWA 5TDWA 3KDEC 2M6MA 5FB1A 2KWJA 2G43A 3LVRE 2EGPA 1MBMA 2F6NA 2G6QA 1WEPA 2MNZA 2KU3A 3JUEA 2ZETC 4ZDTA 5LKTA 1Z2QA 3FJUB 2QIZA 4MSXA 3ZPV1 5DKAA 5B8DA 2AN6A 1LDKC 1VFYA 4IC2A 1WESA 2JRJA 4A4BA 4FJCA 3KV6A 5KH7A 5B77A 3I2DA 4C9ZA 2B0OE 2KGGA 2KKYA 3T7LA 4CA1A 4X3GA 5LKXA 1WGMA 3SHBA 3GV4A 3HCTA 1U6GB 2XB1A 2XOYA 4AVXA 2L75A 5D1KB 1WEVA 3L1ZB 2XOZA 2MUMA 2MD8C 3QZVA 2M3HA 2D8UA 2LXPC 3L1XA 2XP0A 2OWAA 2VJFB 2VP7A 4F1PA 2CKLB 4LJNA 3DWDA 3LVQE 2KGIA 2VPGA 3N9LA 3C6WA 4F52B 2G45A 1IYMA 2CSVA 2FUIA 2M13A 2Y1NA 5FB0A 4PTBA 2LQ6A 3M7KA 2YW8A 2D8SA 1WEUA 5C13A 3MHHA 5TABA 1MM3A 3NG2A 3N9MA 1CHCA 2K1JA 2CONA 2NAAA 5AIUA 2ECIA 4Q6FA 2I50A 2JM3A 4V3KC 3PUQA 3O47A 4N4FA 2YSJA 5H1TA 5G0FA 5LKZA 2VJFA 2YSMA 2CKLA 4L58A 3DDTA 2ECWA 4Z0OA 4A4CA 4FK5A 2VJEB 2RI7A 2Y43A 3EB6A 4CCGX 2PUYA 1RMDA 2JMIA 4FIPA 3PHDA 3N9QA 4W4UA 3ZYQA 4P5OB 4WZ2A 5AITA 4I7CA 3EB5A 1Z6UA 3ZVYA 3DQVR 4YABA 4OGEA 2CRRA 2FFWA 3KV5A 4I7BA 2L43A 3LQHA 5SVIB 4AYCB 2E6RA 5B79A 2KREA 3ZVZB 3GL6A 5J3XA 3HCSA 5C11A 3N9OA 4AUQB 5FEYA 2JMDA 2MA5A 3SOXA 3FAOA 2ECTA 3FEHA 2KE1A 1Z60A 3O35A 5B78A 1JOCA 2FUUA 1LDJB 5TRBA 1JM7B 4AP4A 4A49A 2XOCA 3N9NA 1E4UA 3LDYA 2KFTA 1WEOA 2HYED 2LRIC 2CT2A 4O62A 3C5KA 1F62A 2LN0A 4S3OB 5G04B 4WZ3B 4YC9A 3KQIA 4LLBA 1N87A 5SVIA 2KWKA 2PNXA 1K2FA 4V3LC 2P57A 4YATA 2QJ0A
chains in the Genus database with same CATH topology
3L11A 2YUCA 3FL2A 3M62A 4YBMA 5H9MA 3N9PA 2VPBA 2KWOA 4YBSA 1JM7A 2FSAA 3SOWA 4MVTA 2ECNA 4BHWA 1FP0A 2YQLA 2YHOA 2BAYA 5KH3A 2F42A 2ECJA 2DX8A 2C2LA 4GNFA 2VPDA 2M85A 2MNYA 5D1LB 2YREA 4S3OC 3LRQA 4BBQA 5B75A 1WEQA 2MIQA 2KIZA 2UZGA 1T1HA 2M1RA 2YURA 1G25A 2QICA 2YHNA 1DVPA 3V43A 2LGGA 4LK9A 4GB0A 2YYRA 1WENA 1HYIA 3T6RA 3LQJA 2EA6A 3M63A 1X4UA 2L0BA 3O33A 3O37A 2YU4A 2CSYA 1VD4A 2XEUA 2LGKA 2MD7B 4ZQLA 2L80A 3ZPVE 4QF2A 4B86C 2E6SA 4PPEA 3MHSA 2VJEA 4L7XA 1ZBDB 5TBNA 1X4JA 5JG6A 3SOUA 5G05B 1XWHA 1WFKA 5LCWB 3VK6A 3U5NA 4LADB 5KH9A 3RPGB 2OXQC 1WEMA 2KR4A 5D1MB 3U5OA 4R8PK 4AYCA 2VNFA 2LGLA 4I7DA 2KWNA 4YBTA 4GNGA 5LKUA 4GNDA 2YQMA 4NN2A 1FBVA 4N3WA 3M99A 3DPLR 2ECVA 4UI9B 5H1UA 4ZUXU 4TKPB 2K17A 1X4IA 4LKAA 1WE9A 2LGVA 2LV9A 4XI1A 5EYAF 2JMJA 2EODA 2IDAA 3ASLA 2KYUA 4O64A 2ECGA 4UP0A 3RPGC 1WIMA 2Y1MA 4QF3A 2VPEA 3O7AA 2F6JA 4YADA 3HTKC 2MA6A 3ZNIA 1V87A 2H0DB 4IC3A 3IHPA 4FO9A 2YT5A 1WILA 3O36A 2C2VS 3U5PA 5TDRA 2HDPA 3ZTGA 3O34A 3HCUA 4R2YA 4WA6A 2L5UA 4YAXA 1BORA 4GNEA 5I3LA 5B76A 1WEEA 3PURA 5DINA 4B7YC 1MM2A 3RTRB 4UP5A 1HYJA 3LQIA 2K16A 1VYXA 4A0CD 3O70A 4R7EA 2LDRA 5FERA 4WZ0A 3U5MA 2H0DA 2K4DA 5H1VA 2LXHC 2RSDA 3KNVA 2CSZA 2MT5A 1WEWA 5TDWA 2M6MA 5FB1A 2KWJA 2G43A 2EGPA 2F6NA 2G6QA 1WEPA 2MNZA 2KU3A 2ZETC 4ZDTA 5LKTA 1Z2QA 2QIZA 4MSXA 3ZPV1 5DKAA 5B8DA 2AN6A 1LDKC 1VFYA 4IC2A 1WESA 2JRJA 4A4BA 4FJCA 3KV6A 5KH7A 5B77A 3I2DA 4C9ZA 2KGGA 3T7LA 4CA1A 4X3GA 5LKXA 1WGMA 3SHBA 3GV4A 3HCTA 1U6GB 2XB1A 4AVXA 2L75A 5D1KB 1WEVA 3L1ZB 2MUMA 2MD8C 3QZVA 2M3HA 2LXPC 3L1XA 2VJFB 2VP7A 2CKLB 4LJNA 2KGIA 2VPGA 3N9LA 3C6WA 4F52B 2G45A 1IYMA 2FUIA 2Y1NA 5FB0A 4PTBA 2LQ6A 2YW8A 2D8SA 1WEUA 5C13A 3MHHA 5TABA 1MM3A 3NG2A 3N9MA 1CHCA 2K1JA 2NAAA 5AIUA 2ECIA 4Q6FA 2I50A 4V3KC 3PUQA 4N4FA 2YSJA 5H1TA 5G0FA 5LKZA 2VJFA 2YSMA 2CKLA 4L58A 2ECWA 4A4CA 4FK5A 2VJEB 2RI7A 2Y43A 3EB6A 4CCGX 2PUYA 1RMDA 2JMIA 4FIPA 3PHDA 3N9QA 4W4UA 3ZYQA 4P5OB 4WZ2A 5AITA 4I7CA 3EB5A 1Z6UA 3ZVYA 3DQVR 4YABA 3KV5A 4I7BA 2L43A 3LQHA 4AYCB 2E6RA 5B79A 2KREA 3ZVZB 3GL6A 5J3XA 3HCSA 5C11A 3N9OA 4AUQB 5FEYA 2JMDA 2MA5A 3SOXA 2ECTA 2KE1A 1Z60A 3O35A 5B78A 1JOCA 2FUUA 1LDJB 5TRBA 1JM7B 4AP4A 4A49A 3N9NA 1E4UA 2KFTA 1WEOA 2HYED 2LRIC 2CT2A 3C5KA 1F62A 2LN0A 4S3OB 5G04B 4WZ3B 4YC9A 3KQIA 4LLBA 1N87A 2KWKA 2PNXA 1K2FA 4V3LC 4YATA 2QJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  2YUC A;  3FL2 A;  3M62 A;  4YBM A;  5H9M A;  3N9P A;  2VPB A;  2KWO A;  4YBS A;  1JM7 A;  2FSA A;  3SOW A;  4MVT A;  2ECN A;  4BHW A;  1FP0 A;  2YQL A;  2YHO A;  2BAY A;  5KH3 A;  2F42 A;  2ECJ A;  2DX8 A;  2C2L A;  4GNF A;  2VPD A;  2M85 A;  2MNY A;  5D1L B;  2YRE A;  4S3O C;  3LRQ A;  4BBQ A;  5B75 A;  1WEQ A;  2MIQ A;  2KIZ A;  2UZG A;  1T1H A;  2M1R A;  2YUR A;  1G25 A;  2QIC A;  2YHN A;  1DVP A;  3V43 A;  2LGG A;  4LK9 A;  4GB0 A;  2YYR A;  1WEN A;  1HYI A;  3T6R A;  3LQJ A;  2EA6 A;  3M63 A;  1X4U A;  2L0B A;  3O33 A;  3O37 A;  2YU4 A;  2CSY A;  1VD4 A;  2XEU A;  2LGK A;  2MD7 B;  4ZQL A;  2L80 A;  3ZPV E;  4QF2 A;  4B86 C;  2E6S A;  4PPE A;  3MHS A;  2VJE A;  4L7X A;  1ZBD B;  5TBN A;  1X4J A;  5JG6 A;  3SOU A;  5G05 B;  1XWH A;  1WFK A;  5LCW B;  3VK6 A;  3U5N A;  4LAD B;  5KH9 A;  3RPG B;  2OXQ C;  1WEM A;  2KR4 A;  5D1M B;  3U5O A;  4R8P K;  4AYC A;  2VNF A;  2LGL A;  4I7D A;  2KWN A;  4YBT A;  4GNG A;  5LKU A;  4GND A;  2YQM A;  4NN2 A;  1FBV A;  4N3W A;  3M99 A;  3DPL R;  2ECV A;  4UI9 B;  5H1U A;  4ZUX U;  4TKP B;  2K17 A;  1X4I A;  4LKA A;  1WE9 A;  2LGV A;  2LV9 A;  4XI1 A;  5EYA F;  2JMJ A;  2EOD A;  2IDA A;  3ASL A;  2KYU A;  4O64 A;  2ECG A;  4UP0 A;  3RPG C;  1WIM A;  2Y1M A;  4QF3 A;  2VPE A;  3O7A A;  2F6J A;  4YAD A;  3HTK C;  2MA6 A;  3ZNI A;  1V87 A;  2H0D B;  4IC3 A;  3IHP A;  4FO9 A;  2YT5 A;  1WIL A;  3O36 A;  2C2V S;  3U5P A;  5TDR A;  2HDP A;  3ZTG A;  3O34 A;  3HCU A;  4R2Y A;  4WA6 A;  2L5U A;  4YAX A;  1BOR A;  4GNE A;  5I3L A;  5B76 A;  1WEE A;  3PUR A;  5DIN A;  4B7Y C;  1MM2 A;  3RTR B;  4UP5 A;  1HYJ A;  3LQI A;  2K16 A;  1VYX A;  4A0C D;  3O70 A;  4R7E A;  2LDR A;  5FER A;  4WZ0 A;  3U5M A;  2H0D A;  2K4D A;  5H1V A;  2LXH C;  2RSD A;  3KNV A;  2CSZ A;  2MT5 A;  1WEW A;  5TDW A;  2M6M A;  5FB1 A;  2KWJ A;  2G43 A;  2EGP A;  2F6N A;  2G6Q A;  1WEP A;  2MNZ A;  2KU3 A;  2ZET C;  4ZDT A;  5LKT A;  1Z2Q A;  2QIZ A;  4MSX A;  3ZPV 1;  5DKA A;  5B8D A;  2AN6 A;  1LDK C;  1VFY A;  4IC2 A;  1WES A;  2JRJ A;  4A4B A;  4FJC A;  3KV6 A;  5KH7 A;  5B77 A;  3I2D A;  4C9Z A;  2KGG A;  3T7L A;  4CA1 A;  4X3G A;  5LKX A;  1WGM A;  3SHB A;  3GV4 A;  3HCT A;  1U6G B;  2XB1 A;  4AVX A;  2L75 A;  5D1K B;  1WEV A;  3L1Z B;  2MUM A;  2MD8 C;  3QZV A;  2M3H A;  2LXP C;  3L1X A;  2VJF B;  2VP7 A;  2CKL B;  4LJN A;  2KGI A;  2VPG A;  3N9L A;  3C6W A;  4F52 B;  2G45 A;  1IYM A;  2FUI A;  2Y1N A;  5FB0 A;  4PTB A;  2LQ6 A;  2YW8 A;  2D8S A;  1WEU A;  5C13 A;  3MHH A;  5TAB A;  1MM3 A;  3NG2 A;  3N9M A;  1CHC A;  2K1J A;  2NAA A;  5AIU A;  2ECI A;  4Q6F A;  2I50 A;  4V3K C;  3PUQ A;  4N4F A;  2YSJ A;  5H1T A;  5G0F A;  5LKZ A;  2VJF A;  2YSM A;  2CKL A;  4L58 A;  2ECW A;  4A4C A;  4FK5 A;  2VJE B;  2RI7 A;  2Y43 A;  3EB6 A;  4CCG X;  2PUY A;  1RMD A;  2JMI A;  4FIP A;  3PHD A;  3N9Q A;  4W4U A;  3ZYQ A;  4P5O B;  4WZ2 A;  5AIT A;  4I7C A;  3EB5 A;  1Z6U A;  3ZVY A;  3DQV R;  4YAB A;  3KV5 A;  4I7B A;  2L43 A;  3LQH A;  4AYC B;  2E6R A;  5B79 A;  2KRE A;  3ZVZ B;  3GL6 A;  5J3X A;  3HCS A;  5C11 A;  3N9O A;  4AUQ B;  5FEY A;  2JMD A;  2MA5 A;  3SOX A;  2ECT A;  2KE1 A;  1Z60 A;  3O35 A;  5B78 A;  1JOC A;  2FUU A;  1LDJ B;  5TRB A;  1JM7 B;  4AP4 A;  4A49 A;  3N9N A;  1E4U A;  2KFT A;  1WEO A;  2HYE D;  2LRI C;  2CT2 A;  3C5K A;  1F62 A;  2LN0 A;  4S3O B;  5G04 B;  4WZ3 B;  4YC9 A;  3KQI A;  4LLB A;  1N87 A;  2KWK A;  2PNX A;  1K2F A;  4V3L C;  4YAT A;  2QJ0 A; 
#chains in the Genus database with same CATH topology
 3L11 A;  2YUC A;  3FL2 A;  3M62 A;  4YBM A;  5H9M A;  3N9P A;  2VPB A;  2KWO A;  4OGC A;  4YBS A;  1JM7 A;  2FSA A;  3SOW A;  4MVT A;  2ECN A;  4BHW A;  1FP0 A;  2YQL A;  2YHO A;  2BAY A;  5KH3 A;  2F42 A;  3SUB A;  2ECJ A;  3FM8 C;  2DX8 A;  2C2L A;  4GNF A;  2VPD A;  2DSM A;  2M85 A;  2MNY A;  5D1L B;  2YRE A;  4S3O C;  3LRQ A;  4BBQ A;  5B75 A;  1WEQ A;  2MIQ A;  2EXU A;  2KIZ A;  2UZG A;  1T1H A;  2M1R A;  2YUR A;  3T9K A;  1G25 A;  2QIC A;  2YHN A;  1DVP A;  3V43 A;  2LGG A;  4LK9 A;  4GB0 A;  2YYR A;  1WEN A;  2L7P A;  1HYI A;  3T6R A;  3LQJ A;  2EA6 A;  3M63 A;  1X4U A;  2L0B A;  3O33 A;  3O37 A;  2YU4 A;  2CSY A;  1VD4 A;  5SVY A;  2DJA A;  2XEU A;  2LGK A;  2MD7 B;  3MDB C;  4ZQL A;  2L80 A;  3ZPV E;  4QF2 A;  2RR4 A;  4B86 C;  3H7H A;  2E6S A;  4PPE A;  3MHS A;  2CRW A;  2VJE A;  4L7X A;  1ZBD B;  5TBN A;  1X4J A;  5JG6 A;  3SOU A;  4H9D A;  5G05 B;  1XWH A;  1WFK A;  5LCW B;  3VK6 A;  3U5N A;  4LAD B;  5KH9 A;  3RPG B;  3PLW A;  2OXQ C;  3LJU X;  1WEM A;  2KR4 A;  5SVX A;  2EGM A;  2KKX A;  5D1M B;  3U5O A;  4R8P K;  4AYC A;  2VNF A;  2LGL A;  4I7D A;  2KWN A;  4YBT A;  4GNG A;  5LKU A;  4GND A;  2YQM A;  4NN2 A;  1FBV A;  4N3W A;  2E61 A;  3M99 A;  3DPL R;  2ECV A;  4UI9 B;  5H1U A;  4Z0R A;  3Q1D A;  4ZUX U;  4TKP B;  2K17 A;  1X4I A;  4LKA A;  1WE9 A;  5K3Q A;  2LGV A;  2LV9 A;  4XI1 A;  5EYA F;  2JMJ A;  2EOD A;  2IDA A;  3ASL A;  2KYU A;  4O64 A;  2IQJ A;  2ECG A;  2FD4 A;  4UP0 A;  3RPG C;  1WIM A;  2LAU A;  2Y1M A;  4QF3 A;  2VPE A;  3O7A A;  2F6J A;  4YAD A;  3HTK C;  2MA6 A;  3ZNI A;  4QQ4 A;  1V87 A;  2H0D B;  4IC3 A;  3IHP A;  4FO9 A;  2YT5 A;  1WIL A;  3O36 A;  2C2V S;  3FAN A;  3U5P A;  5TDR A;  2HDP A;  3ZTG A;  3O34 A;  3HCU A;  2YVR A;  4R2Y A;  2MKE A;  4WA6 A;  2L5U A;  4YAX A;  1DCQ A;  1BOR A;  4GNE A;  5I3L A;  2JUN A;  5B76 A;  1WEE A;  3PUR A;  5DIN A;  4B7Y C;  1MM2 A;  3RTR B;  4UP5 A;  1HYJ A;  3E2D A;  3LQI A;  2K16 A;  1VYX A;  4A0C D;  3O70 A;  4R7E A;  2LDR A;  5FER A;  4WZ0 A;  3U5M A;  2H0D A;  2K4D A;  5H1V A;  2LXH C;  2RSD A;  3KNV A;  2CSZ A;  2MT5 A;  1WEW A;  5TDW A;  3KDE C;  2M6M A;  5FB1 A;  2KWJ A;  2G43 A;  3LVR E;  2EGP A;  1MBM A;  2F6N A;  2G6Q A;  1WEP A;  2MNZ A;  2KU3 A;  3JUE A;  2ZET C;  4ZDT A;  5LKT A;  1Z2Q A;  3FJU B;  2QIZ A;  4MSX A;  3ZPV 1;  5DKA A;  5B8D A;  2AN6 A;  1LDK C;  1VFY A;  4IC2 A;  1WES A;  2JRJ A;  4A4B A;  4FJC A;  3KV6 A;  5KH7 A;  5B77 A;  3I2D A;  4C9Z A;  2B0O E;  2KGG A;  2KKY A;  3T7L A;  4CA1 A;  4X3G A;  5LKX A;  1WGM A;  3SHB A;  3GV4 A;  3HCT A;  1U6G B;  2XB1 A;  2XOY A;  4AVX A;  2L75 A;  5D1K B;  1WEV A;  3L1Z B;  2XOZ A;  2MUM A;  2MD8 C;  3QZV A;  2M3H A;  2D8U A;  2LXP C;  3L1X A;  2XP0 A;  2OWA A;  2VJF B;  2VP7 A;  4F1P A;  2CKL B;  4LJN A;  3DWD A;  3LVQ E;  2KGI A;  2VPG A;  3N9L A;  3C6W A;  4F52 B;  2G45 A;  1IYM A;  2CSV A;  2FUI A;  2M13 A;  2Y1N A;  5FB0 A;  4PTB A;  2LQ6 A;  3M7K A;  2YW8 A;  2D8S A;  1WEU A;  5C13 A;  3MHH A;  5TAB A;  1MM3 A;  3NG2 A;  3N9M A;  1CHC A;  2K1J A;  2CON A;  2NAA A;  5AIU A;  2ECI A;  4Q6F A;  2I50 A;  2JM3 A;  4V3K C;  3PUQ A;  3O47 A;  4N4F A;  2YSJ A;  5H1T A;  5G0F A;  5LKZ A;  2VJF A;  2YSM A;  2CKL A;  4L58 A;  3DDT A;  2ECW A;  4Z0O A;  4A4C A;  4FK5 A;  2VJE B;  2RI7 A;  2Y43 A;  3EB6 A;  4CCG X;  2PUY A;  1RMD A;  2JMI A;  4FIP A;  3PHD A;  3N9Q A;  4W4U A;  3ZYQ A;  4P5O B;  4WZ2 A;  5AIT A;  4I7C A;  3EB5 A;  1Z6U A;  3ZVY A;  3DQV R;  4YAB A;  4OGE A;  2CRR A;  2FFW A;  3KV5 A;  4I7B A;  2L43 A;  3LQH A;  5SVI B;  4AYC B;  2E6R A;  5B79 A;  2KRE A;  3ZVZ B;  3GL6 A;  5J3X A;  3HCS A;  5C11 A;  3N9O A;  4AUQ B;  5FEY A;  2JMD A;  2MA5 A;  3SOX A;  3FAO A;  2ECT A;  3FEH A;  2KE1 A;  1Z60 A;  3O35 A;  5B78 A;  1JOC A;  2FUU A;  1LDJ B;  5TRB A;  1JM7 B;  4AP4 A;  4A49 A;  2XOC A;  3N9N A;  1E4U A;  3LDY A;  2KFT A;  1WEO A;  2HYE D;  2LRI C;  2CT2 A;  4O62 A;  3C5K A;  1F62 A;  2LN0 A;  4S3O B;  5G04 B;  4WZ3 B;  4YC9 A;  3KQI A;  4LLB A;  1N87 A;  5SVI A;  2KWK A;  2PNX A;  1K2F A;  4V3L C;  2P57 A;  4YAT A;  2QJ0 A; 
#chains in the Genus database with same CATH homology
 3L11 A;  2YUC A;  3FL2 A;  3M62 A;  4YBM A;  5H9M A;  3N9P A;  2VPB A;  2KWO A;  4YBS A;  1JM7 A;  2FSA A;  3SOW A;  4MVT A;  2ECN A;  4BHW A;  1FP0 A;  2YQL A;  2YHO A;  2BAY A;  5KH3 A;  2F42 A;  2ECJ A;  2DX8 A;  2C2L A;  4GNF A;  2VPD A;  2M85 A;  2MNY A;  5D1L B;  2YRE A;  4S3O C;  3LRQ A;  4BBQ A;  5B75 A;  1WEQ A;  2MIQ A;  2KIZ A;  2UZG A;  1T1H A;  2M1R A;  2YUR A;  1G25 A;  2QIC A;  2YHN A;  1DVP A;  3V43 A;  2LGG A;  4LK9 A;  4GB0 A;  2YYR A;  1WEN A;  1HYI A;  3T6R A;  3LQJ A;  2EA6 A;  3M63 A;  1X4U A;  2L0B A;  3O33 A;  3O37 A;  2YU4 A;  2CSY A;  1VD4 A;  2XEU A;  2LGK A;  2MD7 B;  4ZQL A;  2L80 A;  3ZPV E;  4QF2 A;  4B86 C;  2E6S A;  4PPE A;  3MHS A;  2VJE A;  4L7X A;  1ZBD B;  5TBN A;  1X4J A;  5JG6 A;  3SOU A;  5G05 B;  1XWH A;  1WFK A;  5LCW B;  3VK6 A;  3U5N A;  4LAD B;  5KH9 A;  3RPG B;  2OXQ C;  1WEM A;  2KR4 A;  5D1M B;  3U5O A;  4R8P K;  4AYC A;  2VNF A;  2LGL A;  4I7D A;  2KWN A;  4YBT A;  4GNG A;  5LKU A;  4GND A;  2YQM A;  4NN2 A;  1FBV A;  4N3W A;  3M99 A;  3DPL R;  2ECV A;  4UI9 B;  5H1U A;  4ZUX U;  4TKP B;  2K17 A;  1X4I A;  4LKA A;  1WE9 A;  2LGV A;  2LV9 A;  4XI1 A;  5EYA F;  2JMJ A;  2EOD A;  2IDA A;  3ASL A;  2KYU A;  4O64 A;  2ECG A;  4UP0 A;  3RPG C;  1WIM A;  2Y1M A;  4QF3 A;  2VPE A;  3O7A A;  2F6J A;  4YAD A;  3HTK C;  2MA6 A;  3ZNI A;  1V87 A;  2H0D B;  4IC3 A;  3IHP A;  4FO9 A;  2YT5 A;  1WIL A;  3O36 A;  2C2V S;  3U5P A;  5TDR A;  2HDP A;  3ZTG A;  3O34 A;  3HCU A;  4R2Y A;  4WA6 A;  2L5U A;  4YAX A;  1BOR A;  4GNE A;  5I3L A;  5B76 A;  1WEE A;  3PUR A;  5DIN A;  4B7Y C;  1MM2 A;  3RTR B;  4UP5 A;  1HYJ A;  3LQI A;  2K16 A;  1VYX A;  4A0C D;  3O70 A;  4R7E A;  2LDR A;  5FER A;  4WZ0 A;  3U5M A;  2H0D A;  2K4D A;  5H1V A;  2LXH C;  2RSD A;  3KNV A;  2CSZ A;  2MT5 A;  1WEW A;  5TDW A;  2M6M A;  5FB1 A;  2KWJ A;  2G43 A;  2EGP A;  2F6N A;  2G6Q A;  1WEP A;  2MNZ A;  2KU3 A;  2ZET C;  4ZDT A;  5LKT A;  1Z2Q A;  2QIZ A;  4MSX A;  3ZPV 1;  5DKA A;  5B8D A;  2AN6 A;  1LDK C;  1VFY A;  4IC2 A;  1WES A;  2JRJ A;  4A4B A;  4FJC A;  3KV6 A;  5KH7 A;  5B77 A;  3I2D A;  4C9Z A;  2KGG A;  3T7L A;  4CA1 A;  4X3G A;  5LKX A;  1WGM A;  3SHB A;  3GV4 A;  3HCT A;  1U6G B;  2XB1 A;  4AVX A;  2L75 A;  5D1K B;  1WEV A;  3L1Z B;  2MUM A;  2MD8 C;  3QZV A;  2M3H A;  2LXP C;  3L1X A;  2VJF B;  2VP7 A;  2CKL B;  4LJN A;  2KGI A;  2VPG A;  3N9L A;  3C6W A;  4F52 B;  2G45 A;  1IYM A;  2FUI A;  2Y1N A;  5FB0 A;  4PTB A;  2LQ6 A;  2YW8 A;  2D8S A;  1WEU A;  5C13 A;  3MHH A;  5TAB A;  1MM3 A;  3NG2 A;  3N9M A;  1CHC A;  2K1J A;  2NAA A;  5AIU A;  2ECI A;  4Q6F A;  2I50 A;  4V3K C;  3PUQ A;  4N4F A;  2YSJ A;  5H1T A;  5G0F A;  5LKZ A;  2VJF A;  2YSM A;  2CKL A;  4L58 A;  2ECW A;  4A4C A;  4FK5 A;  2VJE B;  2RI7 A;  2Y43 A;  3EB6 A;  4CCG X;  2PUY A;  1RMD A;  2JMI A;  4FIP A;  3PHD A;  3N9Q A;  4W4U A;  3ZYQ A;  4P5O B;  4WZ2 A;  5AIT A;  4I7C A;  3EB5 A;  1Z6U A;  3ZVY A;  3DQV R;  4YAB A;  3KV5 A;  4I7B A;  2L43 A;  3LQH A;  4AYC B;  2E6R A;  5B79 A;  2KRE A;  3ZVZ B;  3GL6 A;  5J3X A;  3HCS A;  5C11 A;  3N9O A;  4AUQ B;  5FEY A;  2JMD A;  2MA5 A;  3SOX A;  2ECT A;  2KE1 A;  1Z60 A;  3O35 A;  5B78 A;  1JOC A;  2FUU A;  1LDJ B;  5TRB A;  1JM7 B;  4AP4 A;  4A49 A;  3N9N A;  1E4U A;  2KFT A;  1WEO A;  2HYE D;  2LRI C;  2CT2 A;  3C5K A;  1F62 A;  2LN0 A;  4S3O B;  5G04 B;  4WZ3 B;  4YC9 A;  3KQI A;  4LLB A;  1N87 A;  2KWK A;  2PNX A;  1K2F A;  4V3L C;  4YAT A;  2QJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...