5G04B

Structure of the human apc-cdc20-hsl1 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
b'MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g04B00
4W4UA 2PUYA 2XEUA 4ZDTA 1X4IA 3HTKC 4YAXA 3L1XA 4WZ3B 5H1VA 1MM2A 2L80A 4GNFA 4S3OB 3RPGB 1HYJA 3SOUA 4AYCA 2ECVA 2C2LA 1BORA 2YT5A 1U6GB 4C9ZA 4FJCA 3T7LA 2F6NA 1XWHA 3DPLR 5D1MB 4WZ0A 3MHHA 1WILA 2AN6A 2VJFB 2E6SA 5KH7A 1F62A 2VNFA 1E4UA 4P5OB 1CHCA 2KU3A 2M1RA 2LQ6A 3SOWA 1Z6UA 3ZPV1 5KH3A 3N9PA 3KQIA 5B79A 1WENA 1ZBDB 2BAYA 3SHBA 5FEYA 3T6RA 4BHWA 2VJEB 3ZPVE 2EA6A 4BBQA 1K2FA 5TABA 2MIQA 2KR4A 4YBSA 1VFYA 2MA5A 3KNVA 3NG2A 1MM3A 2I50A 2VPBA 2KIZA 2M85A 4LK9A 4S3OC 2K17A 3RPGC 4WA6A 2NAAA 5B77A 4YADA 2C2VS 1X4JA 4ZQLA 4MVTA 1WEQA 4QF2A 5I3LA 3PURA 4CCGX 3VK6A 2FUIA 2KGIA 5B78A 2MT5A 4A4BA 4I7CA 2MA6A 4YABA 5B76A 3O70A 2XB1A 2RSDA 5D1KB 2CKLB 1V87A 4TKPB 2LRIC 2KWNA 2L0BA 2YREA 5C13A 1G25A 5TDRA 2YSJA 2K1JA 5AIUA 2QJ0A 5TDWA 5KH9A 4LLBA 1WEVA 2Y1NA 3O36A 2YHOA 2JMJA 4O64A 4QF3A 2VJFA 3ZVYA 1Z2QA 1WIMA 2CT2A 1VYXA 3O35A 3EB5A 4X3GA 4LADB 2LN0A 4Q6FA 4ZUXU 3M62A 2KE1A 1JM7B 3M99A 4GNEA 2FUUA 1FP0A 4N3WA 3LQHA 2VJEA 2JMDA 4UP5A 3U5MA 1WEOA 3C5KA 4AP4A 5TBNA 4WZ2A 1FBVA 3V43A 2Y1MA 2ECWA 3MHSA 4NN2A 4AYCB 3GL6A 4L7XA 2L75A 2E6RA 2LDRA 2ECTA 3ASLA 4AUQB 4R2YA 2ECNA 1WESA 4UI9B 2MD8C 2M6MA 3L11A 2VP7A 3LRQA 4B86C 2CSYA 1Z60A 1WEWA 4V3KC 3KV5A 2VPEA 1WEEA 3PHDA 2LGGA 4PTBA 1LDKC 3GV4A 2EGPA 2CKLA 4UP0A 3RTRB 5LKUA 2UZGA 2K16A 5G0FA 2OXQC 2YQMA 3EB6A 2LXHC 3O33A 1LDJB 1WFKA 4R7EA 5J3XA 3HCSA 2LGLA 3DQVR 2G45A 1JOCA 2YW8A 2RI7A 2ECJA 2HDPA 3HCTA 4LKAA 4PPEA 1WEPA 4FK5A 3N9NA 2KWJA 2F6JA 2PNXA 5H1TA 4IC3A 4IC2A 2QICA 4B7YC 2KREA 3N9OA 2KGGA 3KV6A 3L1ZB 2ECIA 2HYED 2YU4A 3QZVA 3I2DA 4CA1A 1IYMA 2LGVA 3U5OA 2MD7B 4YC9A 1WEUA 2IDAA 2KWOA 3N9MA 4GNGA 2Y43A 3ZTGA 5LKTA 4LJNA 2KWKA 2H0DB 2M3HA 5FB0A 2JRJA 2YQLA 3C6WA 4A4CA 2CSZA 5FERA 1WEMA 5EYAF 4FIPA 4I7BA 4GNDA 3U5NA 3LQJA 4R8PK 5JG6A 3O7AA 5B75A 4XI1A 2F42A 3ZVZB 4I7DA 3N9QA 2ZETC 3O37A 2DX8A 2JMIA 4A0CD 2KYUA 4GB0A 1RMDA 2FSAA 4A49A 2YYRA 4AVXA 2G43A 2VPGA 5G05B 3ZNIA 3PUQA 2EODA 2MNZA 2L43A 5DINA 4YBMA 4FO9A 5LCWB 2L5UA 5G04B 5D1LB 1X4UA 5H1UA 4YBTA 2YSMA 5TRBA 4L58A 3N9LA 2QIZA 3HCUA 3ZYQA 4YATA 2KFTA 2MUMA 1T1HA 3LQIA 1WGMA 4V3LC 5AITA 5LKXA 2D8SA 1DVPA 2K4DA 4MSXA 4N4FA 2G6QA 5C11A 2YURA 5FB1A 5DKAA 4F52B 3SOXA 3M63A 5LKZA 2LV9A 2LXPC 1WE9A 2ECGA 3IHPA 1HYIA 3FL2A 1VD4A 2LGKA 5H9MA 3U5PA 2YHNA 2MNYA 2H0DA 2VPDA 1JM7A 5B8DA 1N87A 3O34A 2YUCA
chains in the Genus database with same CATH superfamily
4W4UA 2PUYA 2P57A 2XEUA 3FAOA 2M13A 4ZDTA 1X4IA 3HTKC 4YAXA 3L1XA 4WZ3B 5H1VA 1MM2A 2L80A 4GNFA 4S3OB 3RPGB 1HYJA 3SOUA 4QQ4A 3LJUX 4AYCA 2ECVA 2C2LA 1BORA 2YT5A 1U6GB 4C9ZA 4FJCA 3T7LA 2JUNA 2F6NA 1XWHA 3DPLR 5D1MB 4OGEA 4WZ0A 3MHHA 1WILA 2AN6A 2VJFB 2E6SA 2KKYA 5KH7A 3PLWA 1F62A 2VNFA 1E4UA 4P5OB 1CHCA 2KU3A 2M1RA 2LQ6A 3SOWA 1Z6UA 3ZPV1 5SVYA 3DWDA 5KH3A 2LAUA 3N9PA 3KQIA 5B79A 1WENA 1ZBDB 2BAYA 3SHBA 5FEYA 3T6RA 4BHWA 2VJEB 3ZPVE 2KKXA 2EA6A 4BBQA 2RR4A 1K2FA 5TABA 2MIQA 2KR4A 4YBSA 1VFYA 2MA5A 3KNVA 3NG2A 1MM3A 2I50A 2VPBA 2KIZA 2M85A 4LK9A 4S3OC 2K17A 3RPGC 4WA6A 2NAAA 5B77A 4YADA 2C2VS 1X4JA 4ZQLA 3SUBA 4MVTA 1WEQA 4QF2A 5I3LA 3PURA 4CCGX 3VK6A 2FUIA 2KGIA 5B78A 5K3QA 2MT5A 4A4BA 4I7CA 3O47A 2MA6A 4YABA 4O62A 5B76A 3O70A 2XB1A 2RSDA 5D1KB 2CKLB 1V87A 4TKPB 2LRIC 3E2DA 2KWNA 2L0BA 2YREA 5C13A 1G25A 5TDRA 5SVIA 2YSJA 2K1JA 5AIUA 2QJ0A 5TDWA 5KH9A 4LLBA 1WEVA 2Y1NA 3O36A 2YHOA 2JMJA 2XP0A 4O64A 3Q1DA 4QF3A 2VJFA 3ZVYA 1Z2QA 1WIMA 2CT2A 1VYXA 3O35A 3EB5A 4X3GA 4LADB 2LN0A 1MBMA 3FJUB 4Q6FA 3JUEA 4ZUXU 3M62A 2KE1A 1JM7B 3M99A 4GNEA 2FUUA 1FP0A 1DCQA 4N3WA 3LQHA 2VJEA 2JMDA 4UP5A 3U5MA 1WEOA 3C5KA 4F1PA 4AP4A 5TBNA 4WZ2A 1FBVA 4H9DA 3V43A 2Y1MA 5SVXA 2ECWA 3MHSA 4NN2A 4AYCB 3GL6A 4L7XA 2L75A 2XOCA 2E6RA 2LDRA 2ECTA 3ASLA 4AUQB 4R2YA 2ECNA 1WESA 4UI9B 3FEHA 2MD8C 2M6MA 3L11A 2VP7A 3LRQA 4B86C 2CSYA 1Z60A 3FM8C 1WEWA 4V3KC 3KV5A 2VPEA 1WEEA 3PHDA 3H7HA 2LGGA 4PTBA 1LDKC 3GV4A 2YVRA 2EGPA 2CKLA 4UP0A 3RTRB 5LKUA 2UZGA 2K16A 5G0FA 2OXQC 2DSMA 2YQMA 2CONA 3EB6A 2LXHC 3O33A 1LDJB 3KDEC 1WFKA 4R7EA 2E61A 5J3XA 3HCSA 2L7PA 2LGLA 3DQVR 4OGCA 2G45A 1JOCA 2YW8A 3DDTA 2RI7A 2ECJA 2HDPA 3HCTA 4LKAA 2OWAA 4PPEA 1WEPA 4FK5A 3N9NA 2FD4A 2KWJA 2F6JA 2PNXA 5H1TA 4IC3A 4IC2A 2QICA 4B7YC 2KREA 3N9OA 2KGGA 3KV6A 3L1ZB 2ECIA 2EGMA 2HYED 2YU4A 3QZVA 2B0OE 3LVRE 3I2DA 4CA1A 1IYMA 2LGVA 3U5OA 2MD7B 4YC9A 1WEUA 2IDAA 2KWOA 3N9MA 4GNGA 2CSVA 2Y43A 3ZTGA 5LKTA 2XOYA 4LJNA 2KWKA 2H0DB 2M3HA 3LDYA 5FB0A 2JRJA 2YQLA 3C6WA 4A4CA 3M7KA 2CSZA 5SVIB 3MDBC 5FERA 1WEMA 5EYAF 3FANA 4FIPA 4I7BA 4GNDA 3U5NA 3LQJA 2D8UA 4R8PK 5JG6A 3O7AA 2CRWA 5B75A 2EXUA 4XI1A 4Z0RA 2F42A 3ZVZB 4I7DA 3N9QA 2ZETC 3O37A 2DX8A 2JMIA 4A0CD 2KYUA 4GB0A 1RMDA 2FSAA 4A49A 2YYRA 4AVXA 2G43A 2DJAA 2VPGA 5G05B 3ZNIA 3PUQA 2EODA 2MNZA 2L43A 5DINA 4YBMA 4FO9A 5LCWB 4Z0OA 2L5UA 5G04B 5D1LB 1X4UA 3LVQE 5H1UA 4YBTA 2YSMA 5TRBA 4L58A 2IQJA 3N9LA 2QIZA 3HCUA 3ZYQA 4YATA 2KFTA 2MUMA 1T1HA 3LQIA 1WGMA 4V3LC 5AITA 5LKXA 2D8SA 1DVPA 2K4DA 4MSXA 4N4FA 2G6QA 5C11A 2YURA 5FB1A 5DKAA 2FFWA 4F52B 3SOXA 3M63A 5LKZA 2LV9A 2LXPC 1WE9A 2ECGA 3IHPA 1HYIA 3FL2A 1VD4A 2LGKA 5H9MA 3U5PA 2MKEA 2YHNA 2MNYA 2CRRA 2H0DA 3T9KA 2VPDA 2XOZA 1JM7A 5B8DA 1N87A 3O34A 2YUCA 2JM3A
chains in the Genus database with same CATH topology
4W4UA 2PUYA 2XEUA 4ZDTA 1X4IA 3HTKC 4YAXA 3L1XA 4WZ3B 5H1VA 1MM2A 2L80A 4GNFA 4S3OB 3RPGB 1HYJA 3SOUA 4AYCA 2ECVA 2C2LA 1BORA 2YT5A 1U6GB 4C9ZA 4FJCA 3T7LA 2F6NA 1XWHA 3DPLR 5D1MB 4WZ0A 3MHHA 1WILA 2AN6A 2VJFB 2E6SA 5KH7A 1F62A 2VNFA 1E4UA 4P5OB 1CHCA 2KU3A 2M1RA 2LQ6A 3SOWA 1Z6UA 3ZPV1 5KH3A 3N9PA 3KQIA 5B79A 1WENA 1ZBDB 2BAYA 3SHBA 5FEYA 3T6RA 4BHWA 2VJEB 3ZPVE 2EA6A 4BBQA 1K2FA 5TABA 2MIQA 2KR4A 4YBSA 1VFYA 2MA5A 3KNVA 3NG2A 1MM3A 2I50A 2VPBA 2KIZA 2M85A 4LK9A 4S3OC 2K17A 3RPGC 4WA6A 2NAAA 5B77A 4YADA 2C2VS 1X4JA 4ZQLA 4MVTA 1WEQA 4QF2A 5I3LA 3PURA 4CCGX 3VK6A 2FUIA 2KGIA 5B78A 2MT5A 4A4BA 4I7CA 2MA6A 4YABA 5B76A 3O70A 2XB1A 2RSDA 5D1KB 2CKLB 1V87A 4TKPB 2LRIC 2KWNA 2L0BA 2YREA 5C13A 1G25A 5TDRA 2YSJA 2K1JA 5AIUA 2QJ0A 5TDWA 5KH9A 4LLBA 1WEVA 2Y1NA 3O36A 2YHOA 2JMJA 4O64A 4QF3A 2VJFA 3ZVYA 1Z2QA 1WIMA 2CT2A 1VYXA 3O35A 3EB5A 4X3GA 4LADB 2LN0A 4Q6FA 4ZUXU 3M62A 2KE1A 1JM7B 3M99A 4GNEA 2FUUA 1FP0A 4N3WA 3LQHA 2VJEA 2JMDA 4UP5A 3U5MA 1WEOA 3C5KA 4AP4A 5TBNA 4WZ2A 1FBVA 3V43A 2Y1MA 2ECWA 3MHSA 4NN2A 4AYCB 3GL6A 4L7XA 2L75A 2E6RA 2LDRA 2ECTA 3ASLA 4AUQB 4R2YA 2ECNA 1WESA 4UI9B 2MD8C 2M6MA 3L11A 2VP7A 3LRQA 4B86C 2CSYA 1Z60A 1WEWA 4V3KC 3KV5A 2VPEA 1WEEA 3PHDA 2LGGA 4PTBA 1LDKC 3GV4A 2EGPA 2CKLA 4UP0A 3RTRB 5LKUA 2UZGA 2K16A 5G0FA 2OXQC 2YQMA 3EB6A 2LXHC 3O33A 1LDJB 1WFKA 4R7EA 5J3XA 3HCSA 2LGLA 3DQVR 2G45A 1JOCA 2YW8A 2RI7A 2ECJA 2HDPA 3HCTA 4LKAA 4PPEA 1WEPA 4FK5A 3N9NA 2KWJA 2F6JA 2PNXA 5H1TA 4IC3A 4IC2A 2QICA 4B7YC 2KREA 3N9OA 2KGGA 3KV6A 3L1ZB 2ECIA 2HYED 2YU4A 3QZVA 3I2DA 4CA1A 1IYMA 2LGVA 3U5OA 2MD7B 4YC9A 1WEUA 2IDAA 2KWOA 3N9MA 4GNGA 2Y43A 3ZTGA 5LKTA 4LJNA 2KWKA 2H0DB 2M3HA 5FB0A 2JRJA 2YQLA 3C6WA 4A4CA 2CSZA 5FERA 1WEMA 5EYAF 4FIPA 4I7BA 4GNDA 3U5NA 3LQJA 4R8PK 5JG6A 3O7AA 5B75A 4XI1A 2F42A 3ZVZB 4I7DA 3N9QA 2ZETC 3O37A 2DX8A 2JMIA 4A0CD 2KYUA 4GB0A 1RMDA 2FSAA 4A49A 2YYRA 4AVXA 2G43A 2VPGA 5G05B 3ZNIA 3PUQA 2EODA 2MNZA 2L43A 5DINA 4YBMA 4FO9A 5LCWB 2L5UA 5G04B 5D1LB 1X4UA 5H1UA 4YBTA 2YSMA 5TRBA 4L58A 3N9LA 2QIZA 3HCUA 3ZYQA 4YATA 2KFTA 2MUMA 1T1HA 3LQIA 1WGMA 4V3LC 5AITA 5LKXA 2D8SA 1DVPA 2K4DA 4MSXA 4N4FA 2G6QA 5C11A 2YURA 5FB1A 5DKAA 4F52B 3SOXA 3M63A 5LKZA 2LV9A 2LXPC 1WE9A 2ECGA 3IHPA 1HYIA 3FL2A 1VD4A 2LGKA 5H9MA 3U5PA 2YHNA 2MNYA 2H0DA 2VPDA 1JM7A 5B8DA 1N87A 3O34A 2YUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  2PUY A;  2XEU A;  4ZDT A;  1X4I A;  3HTK C;  4YAX A;  3L1X A;  4WZ3 B;  5H1V A;  1MM2 A;  2L80 A;  4GNF A;  4S3O B;  3RPG B;  1HYJ A;  3SOU A;  4AYC A;  2ECV A;  2C2L A;  1BOR A;  2YT5 A;  1U6G B;  4C9Z A;  4FJC A;  3T7L A;  2F6N A;  1XWH A;  3DPL R;  5D1M B;  4WZ0 A;  3MHH A;  1WIL A;  2AN6 A;  2VJF B;  2E6S A;  5KH7 A;  1F62 A;  2VNF A;  1E4U A;  4P5O B;  1CHC A;  2KU3 A;  2M1R A;  2LQ6 A;  3SOW A;  1Z6U A;  3ZPV 1;  5KH3 A;  3N9P A;  3KQI A;  5B79 A;  1WEN A;  1ZBD B;  2BAY A;  3SHB A;  5FEY A;  3T6R A;  4BHW A;  2VJE B;  3ZPV E;  2EA6 A;  4BBQ A;  1K2F A;  5TAB A;  2MIQ A;  2KR4 A;  4YBS A;  1VFY A;  2MA5 A;  3KNV A;  3NG2 A;  1MM3 A;  2I50 A;  2VPB A;  2KIZ A;  2M85 A;  4LK9 A;  4S3O C;  2K17 A;  3RPG C;  4WA6 A;  2NAA A;  5B77 A;  4YAD A;  2C2V S;  1X4J A;  4ZQL A;  4MVT A;  1WEQ A;  4QF2 A;  5I3L A;  3PUR A;  4CCG X;  3VK6 A;  2FUI A;  2KGI A;  5B78 A;  2MT5 A;  4A4B A;  4I7C A;  2MA6 A;  4YAB A;  5B76 A;  3O70 A;  2XB1 A;  2RSD A;  5D1K B;  2CKL B;  1V87 A;  4TKP B;  2LRI C;  2KWN A;  2L0B A;  2YRE A;  5C13 A;  1G25 A;  5TDR A;  2YSJ A;  2K1J A;  5AIU A;  2QJ0 A;  5TDW A;  5KH9 A;  4LLB A;  1WEV A;  2Y1N A;  3O36 A;  2YHO A;  2JMJ A;  4O64 A;  4QF3 A;  2VJF A;  3ZVY A;  1Z2Q A;  1WIM A;  2CT2 A;  1VYX A;  3O35 A;  3EB5 A;  4X3G A;  4LAD B;  2LN0 A;  4Q6F A;  4ZUX U;  3M62 A;  2KE1 A;  1JM7 B;  3M99 A;  4GNE A;  2FUU A;  1FP0 A;  4N3W A;  3LQH A;  2VJE A;  2JMD A;  4UP5 A;  3U5M A;  1WEO A;  3C5K A;  4AP4 A;  5TBN A;  4WZ2 A;  1FBV A;  3V43 A;  2Y1M A;  2ECW A;  3MHS A;  4NN2 A;  4AYC B;  3GL6 A;  4L7X A;  2L75 A;  2E6R A;  2LDR A;  2ECT A;  3ASL A;  4AUQ B;  4R2Y A;  2ECN A;  1WES A;  4UI9 B;  2MD8 C;  2M6M A;  3L11 A;  2VP7 A;  3LRQ A;  4B86 C;  2CSY A;  1Z60 A;  1WEW A;  4V3K C;  3KV5 A;  2VPE A;  1WEE A;  3PHD A;  2LGG A;  4PTB A;  1LDK C;  3GV4 A;  2EGP A;  2CKL A;  4UP0 A;  3RTR B;  5LKU A;  2UZG A;  2K16 A;  5G0F A;  2OXQ C;  2YQM A;  3EB6 A;  2LXH C;  3O33 A;  1LDJ B;  1WFK A;  4R7E A;  5J3X A;  3HCS A;  2LGL A;  3DQV R;  2G45 A;  1JOC A;  2YW8 A;  2RI7 A;  2ECJ A;  2HDP A;  3HCT A;  4LKA A;  4PPE A;  1WEP A;  4FK5 A;  3N9N A;  2KWJ A;  2F6J A;  2PNX A;  5H1T A;  4IC3 A;  4IC2 A;  2QIC A;  4B7Y C;  2KRE A;  3N9O A;  2KGG A;  3KV6 A;  3L1Z B;  2ECI A;  2HYE D;  2YU4 A;  3QZV A;  3I2D A;  4CA1 A;  1IYM A;  2LGV A;  3U5O A;  2MD7 B;  4YC9 A;  1WEU A;  2IDA A;  2KWO A;  3N9M A;  4GNG A;  2Y43 A;  3ZTG A;  5LKT A;  4LJN A;  2KWK A;  2H0D B;  2M3H A;  5FB0 A;  2JRJ A;  2YQL A;  3C6W A;  4A4C A;  2CSZ A;  5FER A;  1WEM A;  5EYA F;  4FIP A;  4I7B A;  4GND A;  3U5N A;  3LQJ A;  4R8P K;  5JG6 A;  3O7A A;  5B75 A;  4XI1 A;  2F42 A;  3ZVZ B;  4I7D A;  3N9Q A;  2ZET C;  3O37 A;  2DX8 A;  2JMI A;  4A0C D;  2KYU A;  4GB0 A;  1RMD A;  2FSA A;  4A49 A;  2YYR A;  4AVX A;  2G43 A;  2VPG A;  5G05 B;  3ZNI A;  3PUQ A;  2EOD A;  2MNZ A;  2L43 A;  5DIN A;  4YBM A;  4FO9 A;  5LCW B;  2L5U A;  5G04 B;  5D1L B;  1X4U A;  5H1U A;  4YBT A;  2YSM A;  5TRB A;  4L58 A;  3N9L A;  2QIZ A;  3HCU A;  3ZYQ A;  4YAT A;  2KFT A;  2MUM A;  1T1H A;  3LQI A;  1WGM A;  4V3L C;  5AIT A;  5LKX A;  2D8S A;  1DVP A;  2K4D A;  4MSX A;  4N4F A;  2G6Q A;  5C11 A;  2YUR A;  5FB1 A;  5DKA A;  4F52 B;  3SOX A;  3M63 A;  5LKZ A;  2LV9 A;  2LXP C;  1WE9 A;  2ECG A;  3IHP A;  1HYI A;  3FL2 A;  1VD4 A;  2LGK A;  5H9M A;  3U5P A;  2YHN A;  2MNY A;  2H0D A;  2VPD A;  1JM7 A;  5B8D A;  1N87 A;  3O34 A;  2YUC A; 
#chains in the Genus database with same CATH topology
 4W4U A;  2PUY A;  2P57 A;  2XEU A;  3FAO A;  2M13 A;  4ZDT A;  1X4I A;  3HTK C;  4YAX A;  3L1X A;  4WZ3 B;  5H1V A;  1MM2 A;  2L80 A;  4GNF A;  4S3O B;  3RPG B;  1HYJ A;  3SOU A;  4QQ4 A;  3LJU X;  4AYC A;  2ECV A;  2C2L A;  1BOR A;  2YT5 A;  1U6G B;  4C9Z A;  4FJC A;  3T7L A;  2JUN A;  2F6N A;  1XWH A;  3DPL R;  5D1M B;  4OGE A;  4WZ0 A;  3MHH A;  1WIL A;  2AN6 A;  2VJF B;  2E6S A;  2KKY A;  5KH7 A;  3PLW A;  1F62 A;  2VNF A;  1E4U A;  4P5O B;  1CHC A;  2KU3 A;  2M1R A;  2LQ6 A;  3SOW A;  1Z6U A;  3ZPV 1;  5SVY A;  3DWD A;  5KH3 A;  2LAU A;  3N9P A;  3KQI A;  5B79 A;  1WEN A;  1ZBD B;  2BAY A;  3SHB A;  5FEY A;  3T6R A;  4BHW A;  2VJE B;  3ZPV E;  2KKX A;  2EA6 A;  4BBQ A;  2RR4 A;  1K2F A;  5TAB A;  2MIQ A;  2KR4 A;  4YBS A;  1VFY A;  2MA5 A;  3KNV A;  3NG2 A;  1MM3 A;  2I50 A;  2VPB A;  2KIZ A;  2M85 A;  4LK9 A;  4S3O C;  2K17 A;  3RPG C;  4WA6 A;  2NAA A;  5B77 A;  4YAD A;  2C2V S;  1X4J A;  4ZQL A;  3SUB A;  4MVT A;  1WEQ A;  4QF2 A;  5I3L A;  3PUR A;  4CCG X;  3VK6 A;  2FUI A;  2KGI A;  5B78 A;  5K3Q A;  2MT5 A;  4A4B A;  4I7C A;  3O47 A;  2MA6 A;  4YAB A;  4O62 A;  5B76 A;  3O70 A;  2XB1 A;  2RSD A;  5D1K B;  2CKL B;  1V87 A;  4TKP B;  2LRI C;  3E2D A;  2KWN A;  2L0B A;  2YRE A;  5C13 A;  1G25 A;  5TDR A;  5SVI A;  2YSJ A;  2K1J A;  5AIU A;  2QJ0 A;  5TDW A;  5KH9 A;  4LLB A;  1WEV A;  2Y1N A;  3O36 A;  2YHO A;  2JMJ A;  2XP0 A;  4O64 A;  3Q1D A;  4QF3 A;  2VJF A;  3ZVY A;  1Z2Q A;  1WIM A;  2CT2 A;  1VYX A;  3O35 A;  3EB5 A;  4X3G A;  4LAD B;  2LN0 A;  1MBM A;  3FJU B;  4Q6F A;  3JUE A;  4ZUX U;  3M62 A;  2KE1 A;  1JM7 B;  3M99 A;  4GNE A;  2FUU A;  1FP0 A;  1DCQ A;  4N3W A;  3LQH A;  2VJE A;  2JMD A;  4UP5 A;  3U5M A;  1WEO A;  3C5K A;  4F1P A;  4AP4 A;  5TBN A;  4WZ2 A;  1FBV A;  4H9D A;  3V43 A;  2Y1M A;  5SVX A;  2ECW A;  3MHS A;  4NN2 A;  4AYC B;  3GL6 A;  4L7X A;  2L75 A;  2XOC A;  2E6R A;  2LDR A;  2ECT A;  3ASL A;  4AUQ B;  4R2Y A;  2ECN A;  1WES A;  4UI9 B;  3FEH A;  2MD8 C;  2M6M A;  3L11 A;  2VP7 A;  3LRQ A;  4B86 C;  2CSY A;  1Z60 A;  3FM8 C;  1WEW A;  4V3K C;  3KV5 A;  2VPE A;  1WEE A;  3PHD A;  3H7H A;  2LGG A;  4PTB A;  1LDK C;  3GV4 A;  2YVR A;  2EGP A;  2CKL A;  4UP0 A;  3RTR B;  5LKU A;  2UZG A;  2K16 A;  5G0F A;  2OXQ C;  2DSM A;  2YQM A;  2CON A;  3EB6 A;  2LXH C;  3O33 A;  1LDJ B;  3KDE C;  1WFK A;  4R7E A;  2E61 A;  5J3X A;  3HCS A;  2L7P A;  2LGL A;  3DQV R;  4OGC A;  2G45 A;  1JOC A;  2YW8 A;  3DDT A;  2RI7 A;  2ECJ A;  2HDP A;  3HCT A;  4LKA A;  2OWA A;  4PPE A;  1WEP A;  4FK5 A;  3N9N A;  2FD4 A;  2KWJ A;  2F6J A;  2PNX A;  5H1T A;  4IC3 A;  4IC2 A;  2QIC A;  4B7Y C;  2KRE A;  3N9O A;  2KGG A;  3KV6 A;  3L1Z B;  2ECI A;  2EGM A;  2HYE D;  2YU4 A;  3QZV A;  2B0O E;  3LVR E;  3I2D A;  4CA1 A;  1IYM A;  2LGV A;  3U5O A;  2MD7 B;  4YC9 A;  1WEU A;  2IDA A;  2KWO A;  3N9M A;  4GNG A;  2CSV A;  2Y43 A;  3ZTG A;  5LKT A;  2XOY A;  4LJN A;  2KWK A;  2H0D B;  2M3H A;  3LDY A;  5FB0 A;  2JRJ A;  2YQL A;  3C6W A;  4A4C A;  3M7K A;  2CSZ A;  5SVI B;  3MDB C;  5FER A;  1WEM A;  5EYA F;  3FAN A;  4FIP A;  4I7B A;  4GND A;  3U5N A;  3LQJ A;  2D8U A;  4R8P K;  5JG6 A;  3O7A A;  2CRW A;  5B75 A;  2EXU A;  4XI1 A;  4Z0R A;  2F42 A;  3ZVZ B;  4I7D A;  3N9Q A;  2ZET C;  3O37 A;  2DX8 A;  2JMI A;  4A0C D;  2KYU A;  4GB0 A;  1RMD A;  2FSA A;  4A49 A;  2YYR A;  4AVX A;  2G43 A;  2DJA A;  2VPG A;  5G05 B;  3ZNI A;  3PUQ A;  2EOD A;  2MNZ A;  2L43 A;  5DIN A;  4YBM A;  4FO9 A;  5LCW B;  4Z0O A;  2L5U A;  5G04 B;  5D1L B;  1X4U A;  3LVQ E;  5H1U A;  4YBT A;  2YSM A;  5TRB A;  4L58 A;  2IQJ A;  3N9L A;  2QIZ A;  3HCU A;  3ZYQ A;  4YAT A;  2KFT A;  2MUM A;  1T1H A;  3LQI A;  1WGM A;  4V3L C;  5AIT A;  5LKX A;  2D8S A;  1DVP A;  2K4D A;  4MSX A;  4N4F A;  2G6Q A;  5C11 A;  2YUR A;  5FB1 A;  5DKA A;  2FFW A;  4F52 B;  3SOX A;  3M63 A;  5LKZ A;  2LV9 A;  2LXP C;  1WE9 A;  2ECG A;  3IHP A;  1HYI A;  3FL2 A;  1VD4 A;  2LGK A;  5H9M A;  3U5P A;  2MKE A;  2YHN A;  2MNY A;  2CRR A;  2H0D A;  3T9K A;  2VPD A;  2XOZ A;  1JM7 A;  5B8D A;  1N87 A;  3O34 A;  2YUC A;  2JM3 A; 
#chains in the Genus database with same CATH homology
 4W4U A;  2PUY A;  2XEU A;  4ZDT A;  1X4I A;  3HTK C;  4YAX A;  3L1X A;  4WZ3 B;  5H1V A;  1MM2 A;  2L80 A;  4GNF A;  4S3O B;  3RPG B;  1HYJ A;  3SOU A;  4AYC A;  2ECV A;  2C2L A;  1BOR A;  2YT5 A;  1U6G B;  4C9Z A;  4FJC A;  3T7L A;  2F6N A;  1XWH A;  3DPL R;  5D1M B;  4WZ0 A;  3MHH A;  1WIL A;  2AN6 A;  2VJF B;  2E6S A;  5KH7 A;  1F62 A;  2VNF A;  1E4U A;  4P5O B;  1CHC A;  2KU3 A;  2M1R A;  2LQ6 A;  3SOW A;  1Z6U A;  3ZPV 1;  5KH3 A;  3N9P A;  3KQI A;  5B79 A;  1WEN A;  1ZBD B;  2BAY A;  3SHB A;  5FEY A;  3T6R A;  4BHW A;  2VJE B;  3ZPV E;  2EA6 A;  4BBQ A;  1K2F A;  5TAB A;  2MIQ A;  2KR4 A;  4YBS A;  1VFY A;  2MA5 A;  3KNV A;  3NG2 A;  1MM3 A;  2I50 A;  2VPB A;  2KIZ A;  2M85 A;  4LK9 A;  4S3O C;  2K17 A;  3RPG C;  4WA6 A;  2NAA A;  5B77 A;  4YAD A;  2C2V S;  1X4J A;  4ZQL A;  4MVT A;  1WEQ A;  4QF2 A;  5I3L A;  3PUR A;  4CCG X;  3VK6 A;  2FUI A;  2KGI A;  5B78 A;  2MT5 A;  4A4B A;  4I7C A;  2MA6 A;  4YAB A;  5B76 A;  3O70 A;  2XB1 A;  2RSD A;  5D1K B;  2CKL B;  1V87 A;  4TKP B;  2LRI C;  2KWN A;  2L0B A;  2YRE A;  5C13 A;  1G25 A;  5TDR A;  2YSJ A;  2K1J A;  5AIU A;  2QJ0 A;  5TDW A;  5KH9 A;  4LLB A;  1WEV A;  2Y1N A;  3O36 A;  2YHO A;  2JMJ A;  4O64 A;  4QF3 A;  2VJF A;  3ZVY A;  1Z2Q A;  1WIM A;  2CT2 A;  1VYX A;  3O35 A;  3EB5 A;  4X3G A;  4LAD B;  2LN0 A;  4Q6F A;  4ZUX U;  3M62 A;  2KE1 A;  1JM7 B;  3M99 A;  4GNE A;  2FUU A;  1FP0 A;  4N3W A;  3LQH A;  2VJE A;  2JMD A;  4UP5 A;  3U5M A;  1WEO A;  3C5K A;  4AP4 A;  5TBN A;  4WZ2 A;  1FBV A;  3V43 A;  2Y1M A;  2ECW A;  3MHS A;  4NN2 A;  4AYC B;  3GL6 A;  4L7X A;  2L75 A;  2E6R A;  2LDR A;  2ECT A;  3ASL A;  4AUQ B;  4R2Y A;  2ECN A;  1WES A;  4UI9 B;  2MD8 C;  2M6M A;  3L11 A;  2VP7 A;  3LRQ A;  4B86 C;  2CSY A;  1Z60 A;  1WEW A;  4V3K C;  3KV5 A;  2VPE A;  1WEE A;  3PHD A;  2LGG A;  4PTB A;  1LDK C;  3GV4 A;  2EGP A;  2CKL A;  4UP0 A;  3RTR B;  5LKU A;  2UZG A;  2K16 A;  5G0F A;  2OXQ C;  2YQM A;  3EB6 A;  2LXH C;  3O33 A;  1LDJ B;  1WFK A;  4R7E A;  5J3X A;  3HCS A;  2LGL A;  3DQV R;  2G45 A;  1JOC A;  2YW8 A;  2RI7 A;  2ECJ A;  2HDP A;  3HCT A;  4LKA A;  4PPE A;  1WEP A;  4FK5 A;  3N9N A;  2KWJ A;  2F6J A;  2PNX A;  5H1T A;  4IC3 A;  4IC2 A;  2QIC A;  4B7Y C;  2KRE A;  3N9O A;  2KGG A;  3KV6 A;  3L1Z B;  2ECI A;  2HYE D;  2YU4 A;  3QZV A;  3I2D A;  4CA1 A;  1IYM A;  2LGV A;  3U5O A;  2MD7 B;  4YC9 A;  1WEU A;  2IDA A;  2KWO A;  3N9M A;  4GNG A;  2Y43 A;  3ZTG A;  5LKT A;  4LJN A;  2KWK A;  2H0D B;  2M3H A;  5FB0 A;  2JRJ A;  2YQL A;  3C6W A;  4A4C A;  2CSZ A;  5FER A;  1WEM A;  5EYA F;  4FIP A;  4I7B A;  4GND A;  3U5N A;  3LQJ A;  4R8P K;  5JG6 A;  3O7A A;  5B75 A;  4XI1 A;  2F42 A;  3ZVZ B;  4I7D A;  3N9Q A;  2ZET C;  3O37 A;  2DX8 A;  2JMI A;  4A0C D;  2KYU A;  4GB0 A;  1RMD A;  2FSA A;  4A49 A;  2YYR A;  4AVX A;  2G43 A;  2VPG A;  5G05 B;  3ZNI A;  3PUQ A;  2EOD A;  2MNZ A;  2L43 A;  5DIN A;  4YBM A;  4FO9 A;  5LCW B;  2L5U A;  5G04 B;  5D1L B;  1X4U A;  5H1U A;  4YBT A;  2YSM A;  5TRB A;  4L58 A;  3N9L A;  2QIZ A;  3HCU A;  3ZYQ A;  4YAT A;  2KFT A;  2MUM A;  1T1H A;  3LQI A;  1WGM A;  4V3L C;  5AIT A;  5LKX A;  2D8S A;  1DVP A;  2K4D A;  4MSX A;  4N4F A;  2G6Q A;  5C11 A;  2YUR A;  5FB1 A;  5DKA A;  4F52 B;  3SOX A;  3M63 A;  5LKZ A;  2LV9 A;  2LXP C;  1WE9 A;  2ECG A;  3IHP A;  1HYI A;  3FL2 A;  1VD4 A;  2LGK A;  5H9M A;  3U5P A;  2YHN A;  2MNY A;  2H0D A;  2VPD A;  1JM7 A;  5B8D A;  1N87 A;  3O34 A;  2YUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...