2ECNA

Solution structure of the ring domain of the human ring finger protein 141
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RING finger protein 141
publication title Solution structure of the RING domain of the human RING finger protein 141
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecnA01
3LQJA 2VNFA 3RTRB 3PHDA 1RMDA 2LXHC 5LKZA 1BORA 4ZQLA 3PURA 2YURA 3O70A 2ECJA 3HCTA 5TRBA 1WE9A 2KWNA 4N4FA 3LQIA 5D1LB 2KU3A 1K2FA 1Z2QA 2MNZA 4N3WA 1G25A 1WEPA 1F62A 2D8SA 2YQLA 3L1XA 4CA1A 5DKAA 2CSYA 3ZYQA 2LRIC 3HTKC 1X4IA 3L11A 1MM2A 2F42A 4S3OB 2F6NA 2ZETC 1X4JA 2KWJA 2VPEA 3ZPV1 3U5NA 3EB6A 4L58A 1E4UA 2XEUA 2Y1MA 5KH9A 4B86C 4A49A 1WEWA 2MNYA 4LLBA 4MSXA 1N87A 3O37A 3U5PA 4AYCA 1WGMA 4FK5A 4YC9A 2RSDA 2CSZA 2QJ0A 2AN6A 3EB5A 2ECVA 1JOCA 3QZVA 1Z6UA 5H1UA 2G6QA 5I3LA 2EA6A 3U5MA 5C11A 5TDWA 1LDKC 1WILA 4I7CA 4FO9A 2M85A 1FP0A 5AITA 3M63A 1T1HA 2YHOA 5D1MB 2K4DA 4YBTA 2PUYA 5G05B 3SOWA 4IC2A 4AP4A 5TDRA 2L75A 2KR4A 4WZ2A 4GNGA 2LGKA 2VPBA 1WEOA 2VPDA 4GNFA 2QICA 3N9MA 3I2DA 1V87A 4WZ0A 4LADB 5D1KB 3SOXA 3C5KA 5FB1A 4YADA 4O64A 2YT5A 4R2YA 2KGGA 2YYRA 2L80A 3O35A 4V3KC 3DQVR 5LKXA 2JMDA 5B77A 4Q6FA 3ZVYA 2LGVA 4BHWA 4GNDA 4A0CD 4QF3A 2YQMA 3U5OA 2Y1NA 2LV9A 3SOUA 5DINA 4XI1A 5H1VA 3ZPVE 2KWOA 2M6MA 2VJEB 2BAYA 2RI7A 2YSJA 4P5OB 1VFYA 2L5UA 4MVTA 2H0DB 4WZ3B 1X4UA 4NN2A 1WEQA 1FBVA 2ECTA 3C6WA 5G04B 2VJFB 1IYMA 2EGPA 4UI9B 3HCUA 1XWHA 2LDRA 3RPGC 2I50A 2MA6A 1HYJA 2KYUA 2PNXA 2LGGA 2C2LA 4V3LC 4A4BA 2ECWA 4F52B 3IHPA 3M62A 3KQIA 4YBSA 4AVXA 2YSMA 3T7LA 4S3OC 4QF2A 3LRQA 2E6RA 2XB1A 2VJEA 4CCGX 1LDJB 2YU4A 2EODA 4ZUXU 2LGLA 2H0DA 1CHCA 2FSAA 2KGIA 5B76A 3ZNIA 2QIZA 1Z60A 2JMIA 3PUQA 5LKTA 2LXPC 4AUQB 2VJFA 3O36A 5FEYA 2KIZA 2YUCA 2KREA 5FB0A 5J3XA 3L1ZB 2F6JA 2FUIA 1JM7B 3N9LA 5B78A 4IC3A 3HCSA 5AIUA 2KWKA 3MHSA 5B75A 5EYAF 5KH7A 5B79A 3O34A 4C9ZA 3KNVA 1WENA 4YBMA 5TABA 2CKLB 2ECNA 1DVPA 3KV6A 4PTBA 2MT5A 3GL6A 2JRJA 4B7YC 2JMJA 5H9MA 3V43A 3ZVZB 3FL2A 4BBQA 2ECGA 2YREA 1VD4A 3LQHA 2MD8C 4UP0A 5FERA 5LKUA 3RPGB 3N9PA 5C13A 1JM7A 2VPGA 2IDAA 3M99A 3N9QA 2L0BA 1MM3A 5B8DA 2C2VS 2G43A 1WIMA 1ZBDB 2LQ6A 2DX8A 2MA5A 3KV5A 4YAXA 2UZGA 2KE1A 4YABA 5KH3A 2MIQA 2CKLA 4TKPB 2G45A 2K1JA 3ASLA 4FIPA 5LCWB 2OXQC 1WESA 3N9NA 3NG2A 4R7EA 5G0FA 2NAAA 4A4CA 4GB0A 3DPLR 3GV4A 2HYED 4W4UA 4X3GA 3N9OA 1WEMA 5H1TA 4WA6A 2MD7B 2MUMA 2K16A 2KFTA 1WEVA 1WEUA 3ZTGA 3VK6A 4R8PK 3T6RA 4I7DA 2YHNA 2ECIA 3O33A 4I7BA 4GNEA 2Y43A 4LJNA 4FJCA 4UP5A 4PPEA 2HDPA 2LN0A 2K17A 2VP7A 2E6SA 1HYIA 3O7AA 2FUUA 4YATA 1WEEA 2CT2A 3SHBA 4L7XA 1U6GB 4ZDTA 5TBNA 1VYXA 4LKAA 3MHHA 2L43A 2M3HA 5JG6A 2M1RA 2YW8A 1WFKA 4LK9A 4AYCB
chains in the Genus database with same CATH superfamily
3LQJA 3PLWA 2VNFA 3RTRB 3PHDA 1RMDA 2LXHC 2MKEA 5LKZA 1BORA 3PURA 4ZQLA 2YURA 3FM8C 3O70A 2ECJA 3HCTA 5TRBA 1WE9A 2KWNA 4N4FA 3LQIA 5D1LB 2KU3A 1K2FA 1Z2QA 2MNZA 4N3WA 1G25A 4QQ4A 1WEPA 1F62A 2D8SA 2B0OE 2YQLA 3L1XA 2XP0A 4CA1A 5DKAA 2CSYA 3ZYQA 2RR4A 2LRIC 3HTKC 1X4IA 3L11A 1MM2A 2F42A 4S3OB 2P57A 2F6NA 2ZETC 1X4JA 2KWJA 2VPEA 3ZPV1 3U5NA 3EB6A 4L58A 1E4UA 2XEUA 2Y1MA 5KH9A 4B86C 4A49A 1WEWA 2MNYA 5SVIB 4LLBA 4MSXA 1N87A 3O37A 3U5PA 4AYCA 1WGMA 4FK5A 4YC9A 4OGEA 2RSDA 2CSZA 3FJUB 2QJ0A 3T9KA 2AN6A 3EB5A 2ECVA 1JOCA 3QZVA 1Z6UA 2JM3A 5H1UA 2G6QA 5I3LA 2EA6A 3U5MA 5C11A 4Z0RA 5TDWA 1LDKC 1WILA 4I7CA 4FO9A 2M85A 1FP0A 5AITA 3M63A 1T1HA 2YHOA 5D1MB 2K4DA 4YBTA 2PUYA 4IC2A 5G05B 3SOWA 4AP4A 5TDRA 2L75A 2KR4A 4WZ2A 4GNGA 2LGKA 2VPBA 1WEOA 2VPDA 4GNFA 2QICA 3N9MA 3I2DA 1V87A 4WZ0A 4LADB 5D1KB 3M7KA 3SOXA 3C5KA 5FB1A 4YADA 4O64A 2YT5A 4R2YA 3MDBC 2KGGA 2YVRA 2YYRA 2L80A 3O35A 4V3KC 3DQVR 5LKXA 2JMDA 5K3QA 2D8UA 4Q6FA 5B77A 3ZVYA 2LGVA 4BHWA 4GNDA 4A0CD 4QF3A 2YQMA 3U5OA 2M13A 2Y1NA 1MBMA 2LV9A 3SOUA 5DINA 4XI1A 5H1VA 3ZPVE 2KWOA 2M6MA 2VJEB 2BAYA 2RI7A 2YSJA 4P5OB 1VFYA 2L5UA 4MVTA 2H0DB 4WZ3B 1X4UA 4NN2A 1WEQA 1FBVA 3SUBA 2ECTA 3C6WA 5G04B 2VJFB 2XOCA 1IYMA 2EGPA 4UI9B 3HCUA 1XWHA 2LDRA 2FD4A 3RPGC 2I50A 2MA6A 1HYJA 3LDYA 2KYUA 2PNXA 2LGGA 2C2LA 5SVYA 4V3LC 4A4BA 2ECWA 4F52B 3IHPA 3M62A 3KQIA 4YBSA 4AVXA 2YSMA 3T7LA 2KKYA 4S3OC 4QF2A 3LRQA 2E6RA 2XB1A 3LVRE 2VJEA 4CCGX 4Z0OA 1LDJB 2YU4A 2EODA 4ZUXU 2LGLA 2H0DA 4OGCA 1CHCA 4F1PA 2FSAA 2KGIA 5B76A 3ZNIA 3FANA 2QIZA 1DCQA 1Z60A 2JMIA 3PUQA 5LKTA 3LVQE 2LXPC 4AUQB 2VJFA 3O36A 2DSMA 5FEYA 2KIZA 2YUCA 5SVIA 2KREA 5FB0A 5J3XA 3L1ZB 3DDTA 2F6JA 2FUIA 1JM7B 3N9LA 5B78A 4IC3A 3JUEA 2XOYA 3HCSA 5AIUA 2KWKA 3MHSA 5B75A 5EYAF 2OWAA 5KH7A 2LAUA 5B79A 3O34A 4C9ZA 3KNVA 1WENA 4YBMA 5TABA 2CKLB 2ECNA 1DVPA 3KV6A 4PTBA 2MT5A 2FFWA 3GL6A 2JRJA 5SVXA 4B7YC 2JMJA 5H9MA 3V43A 3ZVZB 3FL2A 3DWDA 4BBQA 2ECGA 2CONA 2YREA 1VD4A 3LQHA 2MD8C 4UP0A 5FERA 5LKUA 2CSVA 3RPGB 3N9PA 5C13A 1JM7A 2VPGA 2IDAA 3M99A 3N9QA 2L0BA 1MM3A 3Q1DA 5B8DA 2C2VS 2G43A 1WIMA 1ZBDB 2EXUA 2DX8A 2LQ6A 2E61A 2MA5A 3FEHA 3KV5A 4YAXA 2UZGA 2CRWA 2KE1A 4YABA 5KH3A 4O62A 2MIQA 2CKLA 2KKXA 2G45A 2JUNA 4TKPB 2K1JA 3ASLA 2IQJA 4FIPA 5LCWB 3H7HA 2OXQC 1WESA 2DJAA 2EGMA 3N9NA 3NG2A 4R7EA 5G0FA 2NAAA 4A4CA 4GB0A 3E2DA 3DPLR 3GV4A 2HYED 4W4UA 4X3GA 3N9OA 1WEMA 5H1TA 4WA6A 2MD7B 2MUMA 2K16A 3LJUX 2KFTA 1WEVA 1WEUA 3ZTGA 3VK6A 4R8PK 3T6RA 2XOZA 2CRRA 4I7DA 2YHNA 2ECIA 3O33A 3KDEC 4I7BA 2L7PA 4GNEA 2Y43A 4LJNA 4FJCA 4UP5A 4PPEA 2HDPA 2LN0A 2K17A 2VP7A 2E6SA 1HYIA 3O7AA 2FUUA 4YATA 1WEEA 2CT2A 3SHBA 4L7XA 4H9DA 1U6GB 3FAOA 4ZDTA 5TBNA 3O47A 1VYXA 4LKAA 3MHHA 2L43A 2M3HA 5JG6A 2M1RA 2YW8A 1WFKA 4LK9A 4AYCB
chains in the Genus database with same CATH topology
3LQJA 2VNFA 3RTRB 3PHDA 1RMDA 2LXHC 5LKZA 1BORA 4ZQLA 3PURA 2YURA 3O70A 2ECJA 3HCTA 5TRBA 1WE9A 2KWNA 4N4FA 3LQIA 5D1LB 2KU3A 1K2FA 1Z2QA 2MNZA 4N3WA 1G25A 1WEPA 1F62A 2D8SA 2YQLA 3L1XA 4CA1A 5DKAA 2CSYA 3ZYQA 2LRIC 3HTKC 1X4IA 3L11A 1MM2A 2F42A 4S3OB 2F6NA 2ZETC 1X4JA 2KWJA 2VPEA 3ZPV1 3U5NA 3EB6A 4L58A 1E4UA 2XEUA 2Y1MA 5KH9A 4B86C 4A49A 1WEWA 2MNYA 4LLBA 4MSXA 1N87A 3O37A 3U5PA 4AYCA 1WGMA 4FK5A 4YC9A 2RSDA 2CSZA 2QJ0A 2AN6A 3EB5A 2ECVA 1JOCA 3QZVA 1Z6UA 5H1UA 2G6QA 5I3LA 2EA6A 3U5MA 5C11A 5TDWA 1LDKC 1WILA 4I7CA 4FO9A 2M85A 1FP0A 5AITA 3M63A 1T1HA 2YHOA 5D1MB 2K4DA 4YBTA 2PUYA 5G05B 3SOWA 4IC2A 4AP4A 5TDRA 2L75A 2KR4A 4WZ2A 4GNGA 2LGKA 2VPBA 1WEOA 2VPDA 4GNFA 2QICA 3N9MA 3I2DA 1V87A 4WZ0A 4LADB 5D1KB 3SOXA 3C5KA 5FB1A 4YADA 4O64A 2YT5A 4R2YA 2KGGA 2YYRA 2L80A 3O35A 4V3KC 3DQVR 5LKXA 2JMDA 5B77A 4Q6FA 3ZVYA 2LGVA 4BHWA 4GNDA 4A0CD 4QF3A 2YQMA 3U5OA 2Y1NA 2LV9A 3SOUA 5DINA 4XI1A 5H1VA 3ZPVE 2KWOA 2M6MA 2VJEB 2BAYA 2RI7A 2YSJA 4P5OB 1VFYA 2L5UA 4MVTA 2H0DB 4WZ3B 1X4UA 4NN2A 1WEQA 1FBVA 2ECTA 3C6WA 5G04B 2VJFB 1IYMA 2EGPA 4UI9B 3HCUA 1XWHA 2LDRA 3RPGC 2I50A 2MA6A 1HYJA 2KYUA 2PNXA 2LGGA 2C2LA 4V3LC 4A4BA 2ECWA 4F52B 3IHPA 3M62A 3KQIA 4YBSA 4AVXA 2YSMA 3T7LA 4S3OC 4QF2A 3LRQA 2E6RA 2XB1A 2VJEA 4CCGX 1LDJB 2YU4A 2EODA 4ZUXU 2LGLA 2H0DA 1CHCA 2FSAA 2KGIA 5B76A 3ZNIA 2QIZA 1Z60A 2JMIA 3PUQA 5LKTA 2LXPC 4AUQB 2VJFA 3O36A 5FEYA 2KIZA 2YUCA 2KREA 5FB0A 5J3XA 3L1ZB 2F6JA 2FUIA 1JM7B 3N9LA 5B78A 4IC3A 3HCSA 5AIUA 2KWKA 3MHSA 5B75A 5EYAF 5KH7A 5B79A 3O34A 4C9ZA 3KNVA 1WENA 4YBMA 5TABA 2CKLB 2ECNA 1DVPA 3KV6A 4PTBA 2MT5A 3GL6A 2JRJA 4B7YC 2JMJA 5H9MA 3V43A 3ZVZB 3FL2A 4BBQA 2ECGA 2YREA 1VD4A 3LQHA 2MD8C 4UP0A 5FERA 5LKUA 3RPGB 3N9PA 5C13A 1JM7A 2VPGA 2IDAA 3M99A 3N9QA 2L0BA 1MM3A 5B8DA 2C2VS 2G43A 1WIMA 1ZBDB 2LQ6A 2DX8A 2MA5A 3KV5A 4YAXA 2UZGA 2KE1A 4YABA 5KH3A 2MIQA 2CKLA 4TKPB 2G45A 2K1JA 3ASLA 4FIPA 5LCWB 2OXQC 1WESA 3N9NA 3NG2A 4R7EA 5G0FA 2NAAA 4A4CA 4GB0A 3DPLR 3GV4A 2HYED 4W4UA 4X3GA 3N9OA 1WEMA 5H1TA 4WA6A 2MD7B 2MUMA 2K16A 2KFTA 1WEVA 1WEUA 3ZTGA 3VK6A 4R8PK 3T6RA 4I7DA 2YHNA 2ECIA 3O33A 4I7BA 4GNEA 2Y43A 4LJNA 4FJCA 4UP5A 4PPEA 2HDPA 2LN0A 2K17A 2VP7A 2E6SA 1HYIA 3O7AA 2FUUA 4YATA 1WEEA 2CT2A 3SHBA 4L7XA 1U6GB 4ZDTA 5TBNA 1VYXA 4LKAA 3MHHA 2L43A 2M3HA 5JG6A 2M1RA 2YW8A 1WFKA 4LK9A 4AYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQJ A;  2VNF A;  3RTR B;  3PHD A;  1RMD A;  2LXH C;  5LKZ A;  1BOR A;  4ZQL A;  3PUR A;  2YUR A;  3O70 A;  2ECJ A;  3HCT A;  5TRB A;  1WE9 A;  2KWN A;  4N4F A;  3LQI A;  5D1L B;  2KU3 A;  1K2F A;  1Z2Q A;  2MNZ A;  4N3W A;  1G25 A;  1WEP A;  1F62 A;  2D8S A;  2YQL A;  3L1X A;  4CA1 A;  5DKA A;  2CSY A;  3ZYQ A;  2LRI C;  3HTK C;  1X4I A;  3L11 A;  1MM2 A;  2F42 A;  4S3O B;  2F6N A;  2ZET C;  1X4J A;  2KWJ A;  2VPE A;  3ZPV 1;  3U5N A;  3EB6 A;  4L58 A;  1E4U A;  2XEU A;  2Y1M A;  5KH9 A;  4B86 C;  4A49 A;  1WEW A;  2MNY A;  4LLB A;  4MSX A;  1N87 A;  3O37 A;  3U5P A;  4AYC A;  1WGM A;  4FK5 A;  4YC9 A;  2RSD A;  2CSZ A;  2QJ0 A;  2AN6 A;  3EB5 A;  2ECV A;  1JOC A;  3QZV A;  1Z6U A;  5H1U A;  2G6Q A;  5I3L A;  2EA6 A;  3U5M A;  5C11 A;  5TDW A;  1LDK C;  1WIL A;  4I7C A;  4FO9 A;  2M85 A;  1FP0 A;  5AIT A;  3M63 A;  1T1H A;  2YHO A;  5D1M B;  2K4D A;  4YBT A;  2PUY A;  5G05 B;  3SOW A;  4IC2 A;  4AP4 A;  5TDR A;  2L75 A;  2KR4 A;  4WZ2 A;  4GNG A;  2LGK A;  2VPB A;  1WEO A;  2VPD A;  4GNF A;  2QIC A;  3N9M A;  3I2D A;  1V87 A;  4WZ0 A;  4LAD B;  5D1K B;  3SOX A;  3C5K A;  5FB1 A;  4YAD A;  4O64 A;  2YT5 A;  4R2Y A;  2KGG A;  2YYR A;  2L80 A;  3O35 A;  4V3K C;  3DQV R;  5LKX A;  2JMD A;  5B77 A;  4Q6F A;  3ZVY A;  2LGV A;  4BHW A;  4GND A;  4A0C D;  4QF3 A;  2YQM A;  3U5O A;  2Y1N A;  2LV9 A;  3SOU A;  5DIN A;  4XI1 A;  5H1V A;  3ZPV E;  2KWO A;  2M6M A;  2VJE B;  2BAY A;  2RI7 A;  2YSJ A;  4P5O B;  1VFY A;  2L5U A;  4MVT A;  2H0D B;  4WZ3 B;  1X4U A;  4NN2 A;  1WEQ A;  1FBV A;  2ECT A;  3C6W A;  5G04 B;  2VJF B;  1IYM A;  2EGP A;  4UI9 B;  3HCU A;  1XWH A;  2LDR A;  3RPG C;  2I50 A;  2MA6 A;  1HYJ A;  2KYU A;  2PNX A;  2LGG A;  2C2L A;  4V3L C;  4A4B A;  2ECW A;  4F52 B;  3IHP A;  3M62 A;  3KQI A;  4YBS A;  4AVX A;  2YSM A;  3T7L A;  4S3O C;  4QF2 A;  3LRQ A;  2E6R A;  2XB1 A;  2VJE A;  4CCG X;  1LDJ B;  2YU4 A;  2EOD A;  4ZUX U;  2LGL A;  2H0D A;  1CHC A;  2FSA A;  2KGI A;  5B76 A;  3ZNI A;  2QIZ A;  1Z60 A;  2JMI A;  3PUQ A;  5LKT A;  2LXP C;  4AUQ B;  2VJF A;  3O36 A;  5FEY A;  2KIZ A;  2YUC A;  2KRE A;  5FB0 A;  5J3X A;  3L1Z B;  2F6J A;  2FUI A;  1JM7 B;  3N9L A;  5B78 A;  4IC3 A;  3HCS A;  5AIU A;  2KWK A;  3MHS A;  5B75 A;  5EYA F;  5KH7 A;  5B79 A;  3O34 A;  4C9Z A;  3KNV A;  1WEN A;  4YBM A;  5TAB A;  2CKL B;  2ECN A;  1DVP A;  3KV6 A;  4PTB A;  2MT5 A;  3GL6 A;  2JRJ A;  4B7Y C;  2JMJ A;  5H9M A;  3V43 A;  3ZVZ B;  3FL2 A;  4BBQ A;  2ECG A;  2YRE A;  1VD4 A;  3LQH A;  2MD8 C;  4UP0 A;  5FER A;  5LKU A;  3RPG B;  3N9P A;  5C13 A;  1JM7 A;  2VPG A;  2IDA A;  3M99 A;  3N9Q A;  2L0B A;  1MM3 A;  5B8D A;  2C2V S;  2G43 A;  1WIM A;  1ZBD B;  2LQ6 A;  2DX8 A;  2MA5 A;  3KV5 A;  4YAX A;  2UZG A;  2KE1 A;  4YAB A;  5KH3 A;  2MIQ A;  2CKL A;  4TKP B;  2G45 A;  2K1J A;  3ASL A;  4FIP A;  5LCW B;  2OXQ C;  1WES A;  3N9N A;  3NG2 A;  4R7E A;  5G0F A;  2NAA A;  4A4C A;  4GB0 A;  3DPL R;  3GV4 A;  2HYE D;  4W4U A;  4X3G A;  3N9O A;  1WEM A;  5H1T A;  4WA6 A;  2MD7 B;  2MUM A;  2K16 A;  2KFT A;  1WEV A;  1WEU A;  3ZTG A;  3VK6 A;  4R8P K;  3T6R A;  4I7D A;  2YHN A;  2ECI A;  3O33 A;  4I7B A;  4GNE A;  2Y43 A;  4LJN A;  4FJC A;  4UP5 A;  4PPE A;  2HDP A;  2LN0 A;  2K17 A;  2VP7 A;  2E6S A;  1HYI A;  3O7A A;  2FUU A;  4YAT A;  1WEE A;  2CT2 A;  3SHB A;  4L7X A;  1U6G B;  4ZDT A;  5TBN A;  1VYX A;  4LKA A;  3MHH A;  2L43 A;  2M3H A;  5JG6 A;  2M1R A;  2YW8 A;  1WFK A;  4LK9 A;  4AYC B; 
#chains in the Genus database with same CATH topology
 3LQJ A;  3PLW A;  2VNF A;  3RTR B;  3PHD A;  1RMD A;  2LXH C;  2MKE A;  5LKZ A;  1BOR A;  3PUR A;  4ZQL A;  2YUR A;  3FM8 C;  3O70 A;  2ECJ A;  3HCT A;  5TRB A;  1WE9 A;  2KWN A;  4N4F A;  3LQI A;  5D1L B;  2KU3 A;  1K2F A;  1Z2Q A;  2MNZ A;  4N3W A;  1G25 A;  4QQ4 A;  1WEP A;  1F62 A;  2D8S A;  2B0O E;  2YQL A;  3L1X A;  2XP0 A;  4CA1 A;  5DKA A;  2CSY A;  3ZYQ A;  2RR4 A;  2LRI C;  3HTK C;  1X4I A;  3L11 A;  1MM2 A;  2F42 A;  4S3O B;  2P57 A;  2F6N A;  2ZET C;  1X4J A;  2KWJ A;  2VPE A;  3ZPV 1;  3U5N A;  3EB6 A;  4L58 A;  1E4U A;  2XEU A;  2Y1M A;  5KH9 A;  4B86 C;  4A49 A;  1WEW A;  2MNY A;  5SVI B;  4LLB A;  4MSX A;  1N87 A;  3O37 A;  3U5P A;  4AYC A;  1WGM A;  4FK5 A;  4YC9 A;  4OGE A;  2RSD A;  2CSZ A;  3FJU B;  2QJ0 A;  3T9K A;  2AN6 A;  3EB5 A;  2ECV A;  1JOC A;  3QZV A;  1Z6U A;  2JM3 A;  5H1U A;  2G6Q A;  5I3L A;  2EA6 A;  3U5M A;  5C11 A;  4Z0R A;  5TDW A;  1LDK C;  1WIL A;  4I7C A;  4FO9 A;  2M85 A;  1FP0 A;  5AIT A;  3M63 A;  1T1H A;  2YHO A;  5D1M B;  2K4D A;  4YBT A;  2PUY A;  4IC2 A;  5G05 B;  3SOW A;  4AP4 A;  5TDR A;  2L75 A;  2KR4 A;  4WZ2 A;  4GNG A;  2LGK A;  2VPB A;  1WEO A;  2VPD A;  4GNF A;  2QIC A;  3N9M A;  3I2D A;  1V87 A;  4WZ0 A;  4LAD B;  5D1K B;  3M7K A;  3SOX A;  3C5K A;  5FB1 A;  4YAD A;  4O64 A;  2YT5 A;  4R2Y A;  3MDB C;  2KGG A;  2YVR A;  2YYR A;  2L80 A;  3O35 A;  4V3K C;  3DQV R;  5LKX A;  2JMD A;  5K3Q A;  2D8U A;  4Q6F A;  5B77 A;  3ZVY A;  2LGV A;  4BHW A;  4GND A;  4A0C D;  4QF3 A;  2YQM A;  3U5O A;  2M13 A;  2Y1N A;  1MBM A;  2LV9 A;  3SOU A;  5DIN A;  4XI1 A;  5H1V A;  3ZPV E;  2KWO A;  2M6M A;  2VJE B;  2BAY A;  2RI7 A;  2YSJ A;  4P5O B;  1VFY A;  2L5U A;  4MVT A;  2H0D B;  4WZ3 B;  1X4U A;  4NN2 A;  1WEQ A;  1FBV A;  3SUB A;  2ECT A;  3C6W A;  5G04 B;  2VJF B;  2XOC A;  1IYM A;  2EGP A;  4UI9 B;  3HCU A;  1XWH A;  2LDR A;  2FD4 A;  3RPG C;  2I50 A;  2MA6 A;  1HYJ A;  3LDY A;  2KYU A;  2PNX A;  2LGG A;  2C2L A;  5SVY A;  4V3L C;  4A4B A;  2ECW A;  4F52 B;  3IHP A;  3M62 A;  3KQI A;  4YBS A;  4AVX A;  2YSM A;  3T7L A;  2KKY A;  4S3O C;  4QF2 A;  3LRQ A;  2E6R A;  2XB1 A;  3LVR E;  2VJE A;  4CCG X;  4Z0O A;  1LDJ B;  2YU4 A;  2EOD A;  4ZUX U;  2LGL A;  2H0D A;  4OGC A;  1CHC A;  4F1P A;  2FSA A;  2KGI A;  5B76 A;  3ZNI A;  3FAN A;  2QIZ A;  1DCQ A;  1Z60 A;  2JMI A;  3PUQ A;  5LKT A;  3LVQ E;  2LXP C;  4AUQ B;  2VJF A;  3O36 A;  2DSM A;  5FEY A;  2KIZ A;  2YUC A;  5SVI A;  2KRE A;  5FB0 A;  5J3X A;  3L1Z B;  3DDT A;  2F6J A;  2FUI A;  1JM7 B;  3N9L A;  5B78 A;  4IC3 A;  3JUE A;  2XOY A;  3HCS A;  5AIU A;  2KWK A;  3MHS A;  5B75 A;  5EYA F;  2OWA A;  5KH7 A;  2LAU A;  5B79 A;  3O34 A;  4C9Z A;  3KNV A;  1WEN A;  4YBM A;  5TAB A;  2CKL B;  2ECN A;  1DVP A;  3KV6 A;  4PTB A;  2MT5 A;  2FFW A;  3GL6 A;  2JRJ A;  5SVX A;  4B7Y C;  2JMJ A;  5H9M A;  3V43 A;  3ZVZ B;  3FL2 A;  3DWD A;  4BBQ A;  2ECG A;  2CON A;  2YRE A;  1VD4 A;  3LQH A;  2MD8 C;  4UP0 A;  5FER A;  5LKU A;  2CSV A;  3RPG B;  3N9P A;  5C13 A;  1JM7 A;  2VPG A;  2IDA A;  3M99 A;  3N9Q A;  2L0B A;  1MM3 A;  3Q1D A;  5B8D A;  2C2V S;  2G43 A;  1WIM A;  1ZBD B;  2EXU A;  2DX8 A;  2LQ6 A;  2E61 A;  2MA5 A;  3FEH A;  3KV5 A;  4YAX A;  2UZG A;  2CRW A;  2KE1 A;  4YAB A;  5KH3 A;  4O62 A;  2MIQ A;  2CKL A;  2KKX A;  2G45 A;  2JUN A;  4TKP B;  2K1J A;  3ASL A;  2IQJ A;  4FIP A;  5LCW B;  3H7H A;  2OXQ C;  1WES A;  2DJA A;  2EGM A;  3N9N A;  3NG2 A;  4R7E A;  5G0F A;  2NAA A;  4A4C A;  4GB0 A;  3E2D A;  3DPL R;  3GV4 A;  2HYE D;  4W4U A;  4X3G A;  3N9O A;  1WEM A;  5H1T A;  4WA6 A;  2MD7 B;  2MUM A;  2K16 A;  3LJU X;  2KFT A;  1WEV A;  1WEU A;  3ZTG A;  3VK6 A;  4R8P K;  3T6R A;  2XOZ A;  2CRR A;  4I7D A;  2YHN A;  2ECI A;  3O33 A;  3KDE C;  4I7B A;  2L7P A;  4GNE A;  2Y43 A;  4LJN A;  4FJC A;  4UP5 A;  4PPE A;  2HDP A;  2LN0 A;  2K17 A;  2VP7 A;  2E6S A;  1HYI A;  3O7A A;  2FUU A;  4YAT A;  1WEE A;  2CT2 A;  3SHB A;  4L7X A;  4H9D A;  1U6G B;  3FAO A;  4ZDT A;  5TBN A;  3O47 A;  1VYX A;  4LKA A;  3MHH A;  2L43 A;  2M3H A;  5JG6 A;  2M1R A;  2YW8 A;  1WFK A;  4LK9 A;  4AYC B; 
#chains in the Genus database with same CATH homology
 3LQJ A;  2VNF A;  3RTR B;  3PHD A;  1RMD A;  2LXH C;  5LKZ A;  1BOR A;  4ZQL A;  3PUR A;  2YUR A;  3O70 A;  2ECJ A;  3HCT A;  5TRB A;  1WE9 A;  2KWN A;  4N4F A;  3LQI A;  5D1L B;  2KU3 A;  1K2F A;  1Z2Q A;  2MNZ A;  4N3W A;  1G25 A;  1WEP A;  1F62 A;  2D8S A;  2YQL A;  3L1X A;  4CA1 A;  5DKA A;  2CSY A;  3ZYQ A;  2LRI C;  3HTK C;  1X4I A;  3L11 A;  1MM2 A;  2F42 A;  4S3O B;  2F6N A;  2ZET C;  1X4J A;  2KWJ A;  2VPE A;  3ZPV 1;  3U5N A;  3EB6 A;  4L58 A;  1E4U A;  2XEU A;  2Y1M A;  5KH9 A;  4B86 C;  4A49 A;  1WEW A;  2MNY A;  4LLB A;  4MSX A;  1N87 A;  3O37 A;  3U5P A;  4AYC A;  1WGM A;  4FK5 A;  4YC9 A;  2RSD A;  2CSZ A;  2QJ0 A;  2AN6 A;  3EB5 A;  2ECV A;  1JOC A;  3QZV A;  1Z6U A;  5H1U A;  2G6Q A;  5I3L A;  2EA6 A;  3U5M A;  5C11 A;  5TDW A;  1LDK C;  1WIL A;  4I7C A;  4FO9 A;  2M85 A;  1FP0 A;  5AIT A;  3M63 A;  1T1H A;  2YHO A;  5D1M B;  2K4D A;  4YBT A;  2PUY A;  5G05 B;  3SOW A;  4IC2 A;  4AP4 A;  5TDR A;  2L75 A;  2KR4 A;  4WZ2 A;  4GNG A;  2LGK A;  2VPB A;  1WEO A;  2VPD A;  4GNF A;  2QIC A;  3N9M A;  3I2D A;  1V87 A;  4WZ0 A;  4LAD B;  5D1K B;  3SOX A;  3C5K A;  5FB1 A;  4YAD A;  4O64 A;  2YT5 A;  4R2Y A;  2KGG A;  2YYR A;  2L80 A;  3O35 A;  4V3K C;  3DQV R;  5LKX A;  2JMD A;  5B77 A;  4Q6F A;  3ZVY A;  2LGV A;  4BHW A;  4GND A;  4A0C D;  4QF3 A;  2YQM A;  3U5O A;  2Y1N A;  2LV9 A;  3SOU A;  5DIN A;  4XI1 A;  5H1V A;  3ZPV E;  2KWO A;  2M6M A;  2VJE B;  2BAY A;  2RI7 A;  2YSJ A;  4P5O B;  1VFY A;  2L5U A;  4MVT A;  2H0D B;  4WZ3 B;  1X4U A;  4NN2 A;  1WEQ A;  1FBV A;  2ECT A;  3C6W A;  5G04 B;  2VJF B;  1IYM A;  2EGP A;  4UI9 B;  3HCU A;  1XWH A;  2LDR A;  3RPG C;  2I50 A;  2MA6 A;  1HYJ A;  2KYU A;  2PNX A;  2LGG A;  2C2L A;  4V3L C;  4A4B A;  2ECW A;  4F52 B;  3IHP A;  3M62 A;  3KQI A;  4YBS A;  4AVX A;  2YSM A;  3T7L A;  4S3O C;  4QF2 A;  3LRQ A;  2E6R A;  2XB1 A;  2VJE A;  4CCG X;  1LDJ B;  2YU4 A;  2EOD A;  4ZUX U;  2LGL A;  2H0D A;  1CHC A;  2FSA A;  2KGI A;  5B76 A;  3ZNI A;  2QIZ A;  1Z60 A;  2JMI A;  3PUQ A;  5LKT A;  2LXP C;  4AUQ B;  2VJF A;  3O36 A;  5FEY A;  2KIZ A;  2YUC A;  2KRE A;  5FB0 A;  5J3X A;  3L1Z B;  2F6J A;  2FUI A;  1JM7 B;  3N9L A;  5B78 A;  4IC3 A;  3HCS A;  5AIU A;  2KWK A;  3MHS A;  5B75 A;  5EYA F;  5KH7 A;  5B79 A;  3O34 A;  4C9Z A;  3KNV A;  1WEN A;  4YBM A;  5TAB A;  2CKL B;  2ECN A;  1DVP A;  3KV6 A;  4PTB A;  2MT5 A;  3GL6 A;  2JRJ A;  4B7Y C;  2JMJ A;  5H9M A;  3V43 A;  3ZVZ B;  3FL2 A;  4BBQ A;  2ECG A;  2YRE A;  1VD4 A;  3LQH A;  2MD8 C;  4UP0 A;  5FER A;  5LKU A;  3RPG B;  3N9P A;  5C13 A;  1JM7 A;  2VPG A;  2IDA A;  3M99 A;  3N9Q A;  2L0B A;  1MM3 A;  5B8D A;  2C2V S;  2G43 A;  1WIM A;  1ZBD B;  2LQ6 A;  2DX8 A;  2MA5 A;  3KV5 A;  4YAX A;  2UZG A;  2KE1 A;  4YAB A;  5KH3 A;  2MIQ A;  2CKL A;  4TKP B;  2G45 A;  2K1J A;  3ASL A;  4FIP A;  5LCW B;  2OXQ C;  1WES A;  3N9N A;  3NG2 A;  4R7E A;  5G0F A;  2NAA A;  4A4C A;  4GB0 A;  3DPL R;  3GV4 A;  2HYE D;  4W4U A;  4X3G A;  3N9O A;  1WEM A;  5H1T A;  4WA6 A;  2MD7 B;  2MUM A;  2K16 A;  2KFT A;  1WEV A;  1WEU A;  3ZTG A;  3VK6 A;  4R8P K;  3T6R A;  4I7D A;  2YHN A;  2ECI A;  3O33 A;  4I7B A;  4GNE A;  2Y43 A;  4LJN A;  4FJC A;  4UP5 A;  4PPE A;  2HDP A;  2LN0 A;  2K17 A;  2VP7 A;  2E6S A;  1HYI A;  3O7A A;  2FUU A;  4YAT A;  1WEE A;  2CT2 A;  3SHB A;  4L7X A;  1U6G B;  4ZDT A;  5TBN A;  1VYX A;  4LKA A;  3MHH A;  2L43 A;  2M3H A;  5JG6 A;  2M1R A;  2YW8 A;  1WFK A;  4LK9 A;  4AYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...