2YREA

Solution structure of the zinc finger domains (1-87) from human f-box only protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
GSSGSSGMEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFTMARNKVAEHLEMCPASVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-box only protein 30
publication title Solution structure of the zinc finger domains (1-87) from human F-box only protein
rcsb
source organism Homo sapiens
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yreA02
3.30.40.150 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2yreA01
1LDKC 3N9PA 5TDWA 2JMJA 2PUYA 5B78A 2YQLA 2NAAA 4FIPA 2VPGA 1MM3A 5D1KB 3SOWA 2Y1MA 1JOCA 2JMIA 2L5UA 1XWHA 3N9LA 2MNZA 4S3OC 1WEVA 3LQJA 2VPBA 3U5MA 4A4BA 2C2LA 1ZBDB 5B75A 2Y43A 1VFYA 4X3GA 1WGMA 5G04B 3N9NA 4CA1A 5KH9A 2JMDA 4YAXA 1WEMA 2KGGA 5B79A 3O34A 4FK5A 2YUCA 1X4IA 3T6RA 2KGIA 3O7AA 2MD7B 4LK9A 3LQIA 4N4FA 1IYMA 3M99A 4YBTA 2C2VS 4YABA 1HYIA 2KWNA 3MHSA 3C5KA 3LQHA 5LKXA 4PPEA 2YURA 2LGGA 2L43A 2FUIA 3FL2A 4ZQLA 4AYCB 3L1XA 2UZGA 2BAYA 4CCGX 5AITA 3ZPVE 2YSMA 3L1ZB 1WIMA 2KU3A 1CHCA 2MNYA 2ECVA 2CKLA 3N9OA 3N9QA 2KWJA 2MA6A 3M62A 2G6QA 3M63A 2MUMA 4LADB 2AN6A 4MSXA 4WA6A 5DKAA 2E6SA 3T7LA 2L0BA 2EODA 4GB0A 3EB6A 3O33A 1U6GB 2VJFB 5J3XA 2F42A 2VJEB 2YQMA 2ECTA 5FB0A 2YT5A 3L11A 2JRJA 1LDJB 1FP0A 2YREA 2LRIC 3IHPA 2L80A 4V3LC 1WEOA 2KWKA 1Z6UA 1T1HA 4AYCA 4C9ZA 3GV4A 4LKAA 3DQVR 3KV6A 3N9MA 3EB5A 4I7DA 4L58A 2YYRA 5FEYA 2M1RA 2YW8A 4UP5A 4QF2A 4S3OB 2DX8A 4GNEA 4R2YA 3ZTGA 1K2FA 1MM2A 2YHOA 5TRBA 3ZVZB 4PTBA 4V3KC 5G05B 4ZDTA 2CSYA 4BBQA 1V87A 2XEUA 4YATA 1E4UA 2H0DA 2KWOA 3DPLR 4B86C 1JM7B 2Y1NA 3ZVYA 2CT2A 5EYAF 2LXHC 2HDPA 4FJCA 2MT5A 4YADA 3KNVA 5B8DA 5H1TA 3SOXA 4R8PK 3PHDA 3VK6A 2VP7A 2EGPA 4NN2A 5LKTA 1RMDA 1WEWA 5JG6A 1X4UA 5DINA 4IC2A 5TABA 5FERA 5KH7A 5B77A 3PURA 2M85A 5TBNA 3RPGC 1N87A 1WESA 2MIQA 2M6MA 4QF3A 2KFTA 3ZYQA 2XB1A 3RPGB 4LJNA 2K17A 5C13A 3C6WA 2F6NA 2ECNA 1Z2QA 2K16A 5AIUA 5D1LB 2LGKA 4UI9B 5G0FA 2ECJA 4WZ3B 3NG2A 3MHHA 2MA5A 4FO9A 2KIZA 2K1JA 4N3WA 1WEEA 5D1MB 2F6JA 3U5NA 3ASLA 4YC9A 2ECIA 3O36A 4BHWA 4GNGA 1Z60A 2FSAA 3HCTA 5FB1A 2RSDA 3O70A 4YBMA 5H1UA 5C11A 5LKZA 2YHNA 1WEUA 2I50A 4R7EA 2QJ0A 1WEQA 3ZNIA 2ZETC 1WEPA 2LN0A 3KQIA 5LCWB 1BORA 4ZUXU 4XI1A 2HYED 3U5OA 2CSZA 2ECWA 2VJFA 2YU4A 4WZ2A 2LGVA 2M3HA 1WENA 5TDRA 2KR4A 2VJEA 4UP0A 4AVXA 4F52B 2K4DA 5H9MA 2G43A 3GL6A 2OXQC 4WZ0A 5LKUA 2LV9A 3ZPV1 2LXPC 2KREA 1VD4A 3O37A 2QIZA 4GNFA 2CKLB 3U5PA 3LRQA 5H1VA 2MD8C 2KE1A 2RI7A 1F62A 5I3LA 4I7CA 2EA6A 3KV5A 2QICA 3SHBA 2VNFA 2LGLA 4B7YC 3SOUA 4GNDA 4I7BA 3V43A 2FUUA 4AP4A 3HCUA 4TKPB 2YSJA 4IC3A 1WFKA 4W4UA 1FBVA 1G25A 2VPEA 1VYXA 1DVPA 1X4JA 3HTKC 2KYUA 4L7XA 2IDAA 4MVTA 4P5OB 1WE9A 4O64A 3I2DA 1JM7A 3QZVA 4YBSA 4A0CD 2ECGA 3O35A 3PUQA 2VPDA 4LLBA 5B76A 2D8SA 3HCSA 2E6RA 2LQ6A 1HYJA 1WILA 4A49A 2LDRA 4AUQB 5KH3A 2L75A 2G45A 4A4CA 2PNXA 3RTRB 4Q6FA 2H0DB
chains in the Genus database with same CATH superfamily
1LDKC 3N9PA 5TDWA 2JMJA 2PUYA 3E2DA 5B78A 2YQLA 2NAAA 4FIPA 2VPGA 1MM3A 5D1KB 3SOWA 4QQ4A 2Y1MA 1JOCA 2JMIA 2L5UA 1XWHA 3N9LA 2MNZA 4S3OC 1WEVA 3LQJA 2VPBA 3U5MA 4A4BA 2C2LA 1ZBDB 5B75A 2Y43A 1VFYA 4X3GA 1WGMA 5G04B 3SUBA 3N9NA 4CA1A 5KH9A 2JMDA 4YAXA 1WEMA 5K3QA 2KGGA 5B79A 3O34A 3FJUB 4FK5A 2YUCA 1X4IA 3T6RA 4OGCA 2P57A 2XOCA 2KGIA 3O7AA 2MD7B 3FAOA 4LK9A 3LQIA 4N4FA 1IYMA 3M99A 4YBTA 2C2VS 4YABA 1HYIA 2KWNA 3MHSA 3C5KA 3LQHA 5LKXA 4PPEA 2YURA 2LGGA 2L43A 2FUIA 2IQJA 3FL2A 4ZQLA 4AYCB 3L1XA 2UZGA 2BAYA 1MBMA 2KKXA 5AITA 3ZPVE 4CCGX 2YSMA 3L1ZB 1WIMA 2KU3A 1CHCA 2MNYA 2ECVA 2CKLA 3N9OA 3N9QA 2KWJA 2MA6A 3M62A 2G6QA 3M63A 2MUMA 4LADB 2AN6A 4MSXA 4WA6A 5DKAA 2E6SA 3T7LA 2L0BA 2EODA 4GB0A 3EB6A 3O33A 2JM3A 1U6GB 2VJFB 2CSVA 5J3XA 2F42A 2VJEB 2YQMA 2ECTA 5FB0A 2YT5A 2E61A 4Z0OA 3L11A 2JRJA 2EXUA 1LDJB 1FP0A 2YREA 2LRIC 3IHPA 2L80A 3PLWA 3DDTA 4V3LC 1WEOA 2KWKA 1Z6UA 1T1HA 4AYCA 4C9ZA 3GV4A 4LKAA 3DQVR 3KV6A 2M13A 2RR4A 3N9MA 3EB5A 4I7DA 4L58A 2YYRA 5FEYA 2M1RA 2YW8A 4UP5A 4QF2A 4S3OB 2DX8A 4GNEA 4R2YA 3ZTGA 1K2FA 1MM2A 2YHOA 5TRBA 3ZVZB 4PTBA 3JUEA 4V3KC 5G05B 2CRRA 4ZDTA 2CSYA 4BBQA 2CONA 1V87A 2XEUA 4YATA 1E4UA 2H0DA 2KWOA 3DPLR 4B86C 1JM7B 2XOYA 2Y1NA 3ZVYA 2CT2A 5EYAF 2LXHC 2HDPA 4FJCA 2MT5A 4YADA 3KNVA 5B8DA 5H1TA 3SOXA 4R8PK 3PHDA 3VK6A 2VP7A 2EGPA 4NN2A 5LKTA 1RMDA 3Q1DA 1WEWA 5JG6A 1X4UA 2D8UA 5DINA 3LJUX 4IC2A 5TABA 5FERA 5KH7A 4OGEA 5B77A 3PURA 2M85A 5SVIB 5TBNA 3RPGC 1N87A 1WESA 3T9KA 3DWDA 2MIQA 2M6MA 4QF3A 2KFTA 3ZYQA 2XB1A 3O47A 3RPGB 4LJNA 2B0OE 2K17A 3FANA 5C13A 3C6WA 5SVYA 2F6NA 2ECNA 2FD4A 3FM8C 1Z2QA 3M7KA 2K16A 3LVRE 5AIUA 5D1LB 4H9DA 2YVRA 2LGKA 4UI9B 5G0FA 2ECJA 4WZ3B 3NG2A 3MHHA 2MA5A 4FO9A 5SVXA 2EGMA 2KIZA 1DCQA 2K1JA 4N3WA 1WEEA 2CRWA 2F6JA 5D1MB 3U5NA 4O62A 3ASLA 4YC9A 2ECIA 3O36A 4BHWA 4GNGA 1Z60A 2FFWA 2FSAA 3HCTA 5FB1A 2RSDA 3O70A 4YBMA 4F1PA 5H1UA 5C11A 5LKZA 2DSMA 2YHNA 2L7PA 1WEUA 2I50A 4R7EA 2QJ0A 1WEQA 3ZNIA 2ZETC 1WEPA 2LN0A 3KQIA 3H7HA 5LCWB 1BORA 4ZUXU 4XI1A 4Z0RA 2HYED 3U5OA 2CSZA 2ECWA 2VJFA 2YU4A 4WZ2A 2LGVA 2M3HA 1WENA 5TDRA 2KR4A 2JUNA 2VJEA 2OWAA 4UP0A 4AVXA 4F52B 2K4DA 5H9MA 2G43A 3GL6A 2OXQC 3FEHA 4WZ0A 5LKUA 2LV9A 3KDEC 3ZPV1 2LXPC 2KREA 1VD4A 3O37A 2QIZA 4GNFA 2KKYA 3LDYA 2CKLB 3U5PA 3LRQA 5H1VA 2MD8C 2KE1A 2RI7A 1F62A 5I3LA 4I7CA 2EA6A 3KV5A 2QICA 3SHBA 2VNFA 2LGLA 4B7YC 3SOUA 4GNDA 4I7BA 3V43A 2FUUA 4AP4A 3HCUA 4TKPB 2YSJA 4IC3A 1WFKA 2XOZA 4W4UA 1FBVA 2MKEA 1G25A 2VPEA 1VYXA 1DVPA 1X4JA 3HTKC 2KYUA 4L7XA 2XP0A 2LAUA 2IDAA 4MVTA 4P5OB 1WE9A 4O64A 3I2DA 1JM7A 3QZVA 4YBSA 4A0CD 2ECGA 3O35A 3PUQA 2VPDA 4LLBA 5B76A 2DJAA 2D8SA 3HCSA 2E6RA 2LQ6A 1HYJA 1WILA 4A49A 2LDRA 4AUQB 3MDBC 5KH3A 2L75A 2G45A 4A4CA 2PNXA 3RTRB 3LVQE 4Q6FA 5SVIA 2H0DB
chains in the Genus database with same CATH topology
1LDKC 3N9PA 5TDWA 2JMJA 2PUYA 3E2DA 5B78A 2YQLA 2NAAA 4FIPA 2VPGA 1MM3A 5D1KB 3SOWA 4QQ4A 2Y1MA 1JOCA 2JMIA 2L5UA 1XWHA 3N9LA 2MNZA 4S3OC 1WEVA 3LQJA 2VPBA 3U5MA 4A4BA 2C2LA 1ZBDB 5B75A 2Y43A 1VFYA 4X3GA 1WGMA 5G04B 3SUBA 3N9NA 4CA1A 5KH9A 2JMDA 4YAXA 1WEMA 5K3QA 2KGGA 5B79A 3O34A 3FJUB 4FK5A 2YUCA 1X4IA 3T6RA 4OGCA 2P57A 2XOCA 2KGIA 3O7AA 2MD7B 4LK9A 3LQIA 4N4FA 1IYMA 3M99A 4YBTA 2C2VS 4YABA 1HYIA 2KWNA 3MHSA 3C5KA 3LQHA 5LKXA 4PPEA 2YURA 2LGGA 2L43A 2FUIA 2IQJA 3FL2A 4ZQLA 4AYCB 3L1XA 2UZGA 2BAYA 4CCGX 5AITA 2KKXA 3ZPVE 2YSMA 3L1ZB 1WIMA 2KU3A 1CHCA 2MNYA 2ECVA 2CKLA 3N9OA 3N9QA 2KWJA 2MA6A 3M62A 2G6QA 3M63A 2MUMA 4LADB 2AN6A 4MSXA 4WA6A 5DKAA 2E6SA 3T7LA 2L0BA 2EODA 4GB0A 3EB6A 3O33A 2JM3A 1U6GB 2VJFB 2CSVA 5J3XA 2F42A 2VJEB 2YQMA 2ECTA 5FB0A 2YT5A 2E61A 4Z0OA 3L11A 2JRJA 2EXUA 1LDJB 1FP0A 2YREA 2LRIC 3IHPA 2L80A 3PLWA 4V3LC 3DDTA 1WEOA 2KWKA 1Z6UA 1T1HA 4AYCA 4C9ZA 3GV4A 4LKAA 3DQVR 3KV6A 2M13A 2RR4A 3N9MA 3EB5A 4I7DA 4L58A 2YYRA 5FEYA 2M1RA 2YW8A 4UP5A 4QF2A 4S3OB 2DX8A 4GNEA 4R2YA 3ZTGA 1K2FA 1MM2A 2YHOA 5TRBA 3ZVZB 4PTBA 4V3KC 3JUEA 5G05B 4ZDTA 2CRRA 2CSYA 4BBQA 2CONA 1V87A 2XEUA 4YATA 1E4UA 2H0DA 2KWOA 3DPLR 4B86C 1JM7B 2XOYA 2Y1NA 3ZVYA 2CT2A 5EYAF 2LXHC 2HDPA 4FJCA 2MT5A 4YADA 3KNVA 5B8DA 5H1TA 3SOXA 4R8PK 3PHDA 3VK6A 2VP7A 2EGPA 4NN2A 5LKTA 1RMDA 3Q1DA 1WEWA 5JG6A 1X4UA 2D8UA 5DINA 3LJUX 4IC2A 5TABA 5FERA 5KH7A 4OGEA 5B77A 3PURA 2M85A 5SVIB 5TBNA 3RPGC 1N87A 1WESA 3T9KA 3DWDA 2MIQA 2M6MA 4QF3A 2KFTA 3ZYQA 2XB1A 3O47A 3RPGB 4LJNA 2B0OE 2K17A 5C13A 3C6WA 5SVYA 2F6NA 2ECNA 2FD4A 3FM8C 1Z2QA 3M7KA 2K16A 3LVRE 5AIUA 5D1LB 4H9DA 2YVRA 2LGKA 4UI9B 5G0FA 2ECJA 4WZ3B 3NG2A 3MHHA 2MA5A 4FO9A 5SVXA 2EGMA 2KIZA 2K1JA 1DCQA 4N3WA 1WEEA 5D1MB 2F6JA 3U5NA 2CRWA 4O62A 3ASLA 4YC9A 2ECIA 3O36A 4BHWA 4GNGA 1Z60A 2FFWA 2FSAA 3HCTA 5FB1A 2RSDA 3O70A 4YBMA 4F1PA 5H1UA 5C11A 5LKZA 2YHNA 2L7PA 1WEUA 2I50A 4R7EA 2QJ0A 1WEQA 3ZNIA 2ZETC 1WEPA 2LN0A 3KQIA 3H7HA 5LCWB 1BORA 4ZUXU 4XI1A 4Z0RA 2HYED 3U5OA 2CSZA 2ECWA 2VJFA 2YU4A 4WZ2A 2LGVA 2M3HA 1WENA 5TDRA 2KR4A 2JUNA 2VJEA 2OWAA 4UP0A 4AVXA 4F52B 2K4DA 5H9MA 2G43A 3GL6A 2OXQC 3FEHA 4WZ0A 5LKUA 2LV9A 3KDEC 3ZPV1 2LXPC 2KREA 1VD4A 3O37A 2QIZA 4GNFA 2KKYA 3LDYA 2CKLB 3U5PA 3LRQA 5H1VA 2MD8C 2KE1A 2RI7A 1F62A 5I3LA 4I7CA 2EA6A 3KV5A 2QICA 3SHBA 2VNFA 2LGLA 4B7YC 3SOUA 4GNDA 4I7BA 3V43A 2FUUA 4AP4A 3HCUA 4TKPB 2YSJA 4IC3A 1WFKA 4W4UA 2XOZA 1FBVA 2MKEA 1G25A 2VPEA 1VYXA 1DVPA 1X4JA 3HTKC 2KYUA 4L7XA 2XP0A 2LAUA 2IDAA 4MVTA 4P5OB 1WE9A 4O64A 3I2DA 1JM7A 3QZVA 4YBSA 4A0CD 2ECGA 3O35A 3PUQA 2VPDA 4LLBA 5B76A 2DJAA 2D8SA 3HCSA 2E6RA 2LQ6A 1HYJA 1WILA 4A49A 2LDRA 4AUQB 3MDBC 5KH3A 2L75A 2G45A 4A4CA 2PNXA 3RTRB 3LVQE 4Q6FA 5SVIA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDK C;  3N9P A;  5TDW A;  2JMJ A;  2PUY A;  5B78 A;  2YQL A;  2NAA A;  4FIP A;  2VPG A;  1MM3 A;  5D1K B;  3SOW A;  2Y1M A;  1JOC A;  2JMI A;  2L5U A;  1XWH A;  3N9L A;  2MNZ A;  4S3O C;  1WEV A;  3LQJ A;  2VPB A;  3U5M A;  4A4B A;  2C2L A;  1ZBD B;  5B75 A;  2Y43 A;  1VFY A;  4X3G A;  1WGM A;  5G04 B;  3N9N A;  4CA1 A;  5KH9 A;  2JMD A;  4YAX A;  1WEM A;  2KGG A;  5B79 A;  3O34 A;  4FK5 A;  2YUC A;  1X4I A;  3T6R A;  2KGI A;  3O7A A;  2MD7 B;  4LK9 A;  3LQI A;  4N4F A;  1IYM A;  3M99 A;  4YBT A;  2C2V S;  4YAB A;  1HYI A;  2KWN A;  3MHS A;  3C5K A;  3LQH A;  5LKX A;  4PPE A;  2YUR A;  2LGG A;  2L43 A;  2FUI A;  3FL2 A;  4ZQL A;  4AYC B;  3L1X A;  2UZG A;  2BAY A;  4CCG X;  5AIT A;  3ZPV E;  2YSM A;  3L1Z B;  1WIM A;  2KU3 A;  1CHC A;  2MNY A;  2ECV A;  2CKL A;  3N9O A;  3N9Q A;  2KWJ A;  2MA6 A;  3M62 A;  2G6Q A;  3M63 A;  2MUM A;  4LAD B;  2AN6 A;  4MSX A;  4WA6 A;  5DKA A;  2E6S A;  3T7L A;  2L0B A;  2EOD A;  4GB0 A;  3EB6 A;  3O33 A;  1U6G B;  2VJF B;  5J3X A;  2F42 A;  2VJE B;  2YQM A;  2ECT A;  5FB0 A;  2YT5 A;  3L11 A;  2JRJ A;  1LDJ B;  1FP0 A;  2YRE A;  2LRI C;  3IHP A;  2L80 A;  4V3L C;  1WEO A;  2KWK A;  1Z6U A;  1T1H A;  4AYC A;  4C9Z A;  3GV4 A;  4LKA A;  3DQV R;  3KV6 A;  3N9M A;  3EB5 A;  4I7D A;  4L58 A;  2YYR A;  5FEY A;  2M1R A;  2YW8 A;  4UP5 A;  4QF2 A;  4S3O B;  2DX8 A;  4GNE A;  4R2Y A;  3ZTG A;  1K2F A;  1MM2 A;  2YHO A;  5TRB A;  3ZVZ B;  4PTB A;  4V3K C;  5G05 B;  4ZDT A;  2CSY A;  4BBQ A;  1V87 A;  2XEU A;  4YAT A;  1E4U A;  2H0D A;  2KWO A;  3DPL R;  4B86 C;  1JM7 B;  2Y1N A;  3ZVY A;  2CT2 A;  5EYA F;  2LXH C;  2HDP A;  4FJC A;  2MT5 A;  4YAD A;  3KNV A;  5B8D A;  5H1T A;  3SOX A;  4R8P K;  3PHD A;  3VK6 A;  2VP7 A;  2EGP A;  4NN2 A;  5LKT A;  1RMD A;  1WEW A;  5JG6 A;  1X4U A;  5DIN A;  4IC2 A;  5TAB A;  5FER A;  5KH7 A;  5B77 A;  3PUR A;  2M85 A;  5TBN A;  3RPG C;  1N87 A;  1WES A;  2MIQ A;  2M6M A;  4QF3 A;  2KFT A;  3ZYQ A;  2XB1 A;  3RPG B;  4LJN A;  2K17 A;  5C13 A;  3C6W A;  2F6N A;  2ECN A;  1Z2Q A;  2K16 A;  5AIU A;  5D1L B;  2LGK A;  4UI9 B;  5G0F A;  2ECJ A;  4WZ3 B;  3NG2 A;  3MHH A;  2MA5 A;  4FO9 A;  2KIZ A;  2K1J A;  4N3W A;  1WEE A;  5D1M B;  2F6J A;  3U5N A;  3ASL A;  4YC9 A;  2ECI A;  3O36 A;  4BHW A;  4GNG A;  1Z60 A;  2FSA A;  3HCT A;  5FB1 A;  2RSD A;  3O70 A;  4YBM A;  5H1U A;  5C11 A;  5LKZ A;  2YHN A;  1WEU A;  2I50 A;  4R7E A;  2QJ0 A;  1WEQ A;  3ZNI A;  2ZET C;  1WEP A;  2LN0 A;  3KQI A;  5LCW B;  1BOR A;  4ZUX U;  4XI1 A;  2HYE D;  3U5O A;  2CSZ A;  2ECW A;  2VJF A;  2YU4 A;  4WZ2 A;  2LGV A;  2M3H A;  1WEN A;  5TDR A;  2KR4 A;  2VJE A;  4UP0 A;  4AVX A;  4F52 B;  2K4D A;  5H9M A;  2G43 A;  3GL6 A;  2OXQ C;  4WZ0 A;  5LKU A;  2LV9 A;  3ZPV 1;  2LXP C;  2KRE A;  1VD4 A;  3O37 A;  2QIZ A;  4GNF A;  2CKL B;  3U5P A;  3LRQ A;  5H1V A;  2MD8 C;  2KE1 A;  2RI7 A;  1F62 A;  5I3L A;  4I7C A;  2EA6 A;  3KV5 A;  2QIC A;  3SHB A;  2VNF A;  2LGL A;  4B7Y C;  3SOU A;  4GND A;  4I7B A;  3V43 A;  2FUU A;  4AP4 A;  3HCU A;  4TKP B;  2YSJ A;  4IC3 A;  1WFK A;  4W4U A;  1FBV A;  1G25 A;  2VPE A;  1VYX A;  1DVP A;  1X4J A;  3HTK C;  2KYU A;  4L7X A;  2IDA A;  4MVT A;  4P5O B;  1WE9 A;  4O64 A;  3I2D A;  1JM7 A;  3QZV A;  4YBS A;  4A0C D;  2ECG A;  3O35 A;  3PUQ A;  2VPD A;  4LLB A;  5B76 A;  2D8S A;  3HCS A;  2E6R A;  2LQ6 A;  1HYJ A;  1WIL A;  4A49 A;  2LDR A;  4AUQ B;  5KH3 A;  2L75 A;  2G45 A;  4A4C A;  2PNX A;  3RTR B;  4Q6F A;  2H0D B; 
#chains in the Genus database with same CATH topology
 1LDK C;  3N9P A;  5TDW A;  2JMJ A;  2PUY A;  3E2D A;  5B78 A;  2YQL A;  2NAA A;  4FIP A;  2VPG A;  1MM3 A;  5D1K B;  3SOW A;  4QQ4 A;  2Y1M A;  1JOC A;  2JMI A;  2L5U A;  1XWH A;  3N9L A;  2MNZ A;  4S3O C;  1WEV A;  3LQJ A;  2VPB A;  3U5M A;  4A4B A;  2C2L A;  1ZBD B;  5B75 A;  2Y43 A;  1VFY A;  4X3G A;  1WGM A;  5G04 B;  3SUB A;  3N9N A;  4CA1 A;  5KH9 A;  2JMD A;  4YAX A;  1WEM A;  5K3Q A;  2KGG A;  5B79 A;  3O34 A;  3FJU B;  4FK5 A;  2YUC A;  1X4I A;  3T6R A;  4OGC A;  2P57 A;  2XOC A;  2KGI A;  3O7A A;  2MD7 B;  3FAO A;  4LK9 A;  3LQI A;  4N4F A;  1IYM A;  3M99 A;  4YBT A;  2C2V S;  4YAB A;  1HYI A;  2KWN A;  3MHS A;  3C5K A;  3LQH A;  5LKX A;  4PPE A;  2YUR A;  2LGG A;  2L43 A;  2FUI A;  2IQJ A;  3FL2 A;  4ZQL A;  4AYC B;  3L1X A;  2UZG A;  2BAY A;  1MBM A;  2KKX A;  5AIT A;  3ZPV E;  4CCG X;  2YSM A;  3L1Z B;  1WIM A;  2KU3 A;  1CHC A;  2MNY A;  2ECV A;  2CKL A;  3N9O A;  3N9Q A;  2KWJ A;  2MA6 A;  3M62 A;  2G6Q A;  3M63 A;  2MUM A;  4LAD B;  2AN6 A;  4MSX A;  4WA6 A;  5DKA A;  2E6S A;  3T7L A;  2L0B A;  2EOD A;  4GB0 A;  3EB6 A;  3O33 A;  2JM3 A;  1U6G B;  2VJF B;  2CSV A;  5J3X A;  2F42 A;  2VJE B;  2YQM A;  2ECT A;  5FB0 A;  2YT5 A;  2E61 A;  4Z0O A;  3L11 A;  2JRJ A;  2EXU A;  1LDJ B;  1FP0 A;  2YRE A;  2LRI C;  3IHP A;  2L80 A;  3PLW A;  3DDT A;  4V3L C;  1WEO A;  2KWK A;  1Z6U A;  1T1H A;  4AYC A;  4C9Z A;  3GV4 A;  4LKA A;  3DQV R;  3KV6 A;  2M13 A;  2RR4 A;  3N9M A;  3EB5 A;  4I7D A;  4L58 A;  2YYR A;  5FEY A;  2M1R A;  2YW8 A;  4UP5 A;  4QF2 A;  4S3O B;  2DX8 A;  4GNE A;  4R2Y A;  3ZTG A;  1K2F A;  1MM2 A;  2YHO A;  5TRB A;  3ZVZ B;  4PTB A;  3JUE A;  4V3K C;  5G05 B;  2CRR A;  4ZDT A;  2CSY A;  4BBQ A;  2CON A;  1V87 A;  2XEU A;  4YAT A;  1E4U A;  2H0D A;  2KWO A;  3DPL R;  4B86 C;  1JM7 B;  2XOY A;  2Y1N A;  3ZVY A;  2CT2 A;  5EYA F;  2LXH C;  2HDP A;  4FJC A;  2MT5 A;  4YAD A;  3KNV A;  5B8D A;  5H1T A;  3SOX A;  4R8P K;  3PHD A;  3VK6 A;  2VP7 A;  2EGP A;  4NN2 A;  5LKT A;  1RMD A;  3Q1D A;  1WEW A;  5JG6 A;  1X4U A;  2D8U A;  5DIN A;  3LJU X;  4IC2 A;  5TAB A;  5FER A;  5KH7 A;  4OGE A;  5B77 A;  3PUR A;  2M85 A;  5SVI B;  5TBN A;  3RPG C;  1N87 A;  1WES A;  3T9K A;  3DWD A;  2MIQ A;  2M6M A;  4QF3 A;  2KFT A;  3ZYQ A;  2XB1 A;  3O47 A;  3RPG B;  4LJN A;  2B0O E;  2K17 A;  3FAN A;  5C13 A;  3C6W A;  5SVY A;  2F6N A;  2ECN A;  2FD4 A;  3FM8 C;  1Z2Q A;  3M7K A;  2K16 A;  3LVR E;  5AIU A;  5D1L B;  4H9D A;  2YVR A;  2LGK A;  4UI9 B;  5G0F A;  2ECJ A;  4WZ3 B;  3NG2 A;  3MHH A;  2MA5 A;  4FO9 A;  5SVX A;  2EGM A;  2KIZ A;  1DCQ A;  2K1J A;  4N3W A;  1WEE A;  2CRW A;  2F6J A;  5D1M B;  3U5N A;  4O62 A;  3ASL A;  4YC9 A;  2ECI A;  3O36 A;  4BHW A;  4GNG A;  1Z60 A;  2FFW A;  2FSA A;  3HCT A;  5FB1 A;  2RSD A;  3O70 A;  4YBM A;  4F1P A;  5H1U A;  5C11 A;  5LKZ A;  2DSM A;  2YHN A;  2L7P A;  1WEU A;  2I50 A;  4R7E A;  2QJ0 A;  1WEQ A;  3ZNI A;  2ZET C;  1WEP A;  2LN0 A;  3KQI A;  3H7H A;  5LCW B;  1BOR A;  4ZUX U;  4XI1 A;  4Z0R A;  2HYE D;  3U5O A;  2CSZ A;  2ECW A;  2VJF A;  2YU4 A;  4WZ2 A;  2LGV A;  2M3H A;  1WEN A;  5TDR A;  2KR4 A;  2JUN A;  2VJE A;  2OWA A;  4UP0 A;  4AVX A;  4F52 B;  2K4D A;  5H9M A;  2G43 A;  3GL6 A;  2OXQ C;  3FEH A;  4WZ0 A;  5LKU A;  2LV9 A;  3KDE C;  3ZPV 1;  2LXP C;  2KRE A;  1VD4 A;  3O37 A;  2QIZ A;  4GNF A;  2KKY A;  3LDY A;  2CKL B;  3U5P A;  3LRQ A;  5H1V A;  2MD8 C;  2KE1 A;  2RI7 A;  1F62 A;  5I3L A;  4I7C A;  2EA6 A;  3KV5 A;  2QIC A;  3SHB A;  2VNF A;  2LGL A;  4B7Y C;  3SOU A;  4GND A;  4I7B A;  3V43 A;  2FUU A;  4AP4 A;  3HCU A;  4TKP B;  2YSJ A;  4IC3 A;  1WFK A;  2XOZ A;  4W4U A;  1FBV A;  2MKE A;  1G25 A;  2VPE A;  1VYX A;  1DVP A;  1X4J A;  3HTK C;  2KYU A;  4L7X A;  2XP0 A;  2LAU A;  2IDA A;  4MVT A;  4P5O B;  1WE9 A;  4O64 A;  3I2D A;  1JM7 A;  3QZV A;  4YBS A;  4A0C D;  2ECG A;  3O35 A;  3PUQ A;  2VPD A;  4LLB A;  5B76 A;  2DJA A;  2D8S A;  3HCS A;  2E6R A;  2LQ6 A;  1HYJ A;  1WIL A;  4A49 A;  2LDR A;  4AUQ B;  3MDB C;  5KH3 A;  2L75 A;  2G45 A;  4A4C A;  2PNX A;  3RTR B;  3LVQ E;  4Q6F A;  5SVI A;  2H0D B; 
#chains in the Genus database with same CATH homology
 1LDK C;  3N9P A;  5TDW A;  2JMJ A;  2PUY A;  3E2D A;  5B78 A;  2YQL A;  2NAA A;  4FIP A;  2VPG A;  1MM3 A;  5D1K B;  3SOW A;  4QQ4 A;  2Y1M A;  1JOC A;  2JMI A;  2L5U A;  1XWH A;  3N9L A;  2MNZ A;  4S3O C;  1WEV A;  3LQJ A;  2VPB A;  3U5M A;  4A4B A;  2C2L A;  1ZBD B;  5B75 A;  2Y43 A;  1VFY A;  4X3G A;  1WGM A;  5G04 B;  3SUB A;  3N9N A;  4CA1 A;  5KH9 A;  2JMD A;  4YAX A;  1WEM A;  5K3Q A;  2KGG A;  5B79 A;  3O34 A;  3FJU B;  4FK5 A;  2YUC A;  1X4I A;  3T6R A;  4OGC A;  2P57 A;  2XOC A;  2KGI A;  3O7A A;  2MD7 B;  4LK9 A;  3LQI A;  4N4F A;  1IYM A;  3M99 A;  4YBT A;  2C2V S;  4YAB A;  1HYI A;  2KWN A;  3MHS A;  3C5K A;  3LQH A;  5LKX A;  4PPE A;  2YUR A;  2LGG A;  2L43 A;  2FUI A;  2IQJ A;  3FL2 A;  4ZQL A;  4AYC B;  3L1X A;  2UZG A;  2BAY A;  4CCG X;  5AIT A;  2KKX A;  3ZPV E;  2YSM A;  3L1Z B;  1WIM A;  2KU3 A;  1CHC A;  2MNY A;  2ECV A;  2CKL A;  3N9O A;  3N9Q A;  2KWJ A;  2MA6 A;  3M62 A;  2G6Q A;  3M63 A;  2MUM A;  4LAD B;  2AN6 A;  4MSX A;  4WA6 A;  5DKA A;  2E6S A;  3T7L A;  2L0B A;  2EOD A;  4GB0 A;  3EB6 A;  3O33 A;  2JM3 A;  1U6G B;  2VJF B;  2CSV A;  5J3X A;  2F42 A;  2VJE B;  2YQM A;  2ECT A;  5FB0 A;  2YT5 A;  2E61 A;  4Z0O A;  3L11 A;  2JRJ A;  2EXU A;  1LDJ B;  1FP0 A;  2YRE A;  2LRI C;  3IHP A;  2L80 A;  3PLW A;  4V3L C;  3DDT A;  1WEO A;  2KWK A;  1Z6U A;  1T1H A;  4AYC A;  4C9Z A;  3GV4 A;  4LKA A;  3DQV R;  3KV6 A;  2M13 A;  2RR4 A;  3N9M A;  3EB5 A;  4I7D A;  4L58 A;  2YYR A;  5FEY A;  2M1R A;  2YW8 A;  4UP5 A;  4QF2 A;  4S3O B;  2DX8 A;  4GNE A;  4R2Y A;  3ZTG A;  1K2F A;  1MM2 A;  2YHO A;  5TRB A;  3ZVZ B;  4PTB A;  4V3K C;  3JUE A;  5G05 B;  4ZDT A;  2CRR A;  2CSY A;  4BBQ A;  2CON A;  1V87 A;  2XEU A;  4YAT A;  1E4U A;  2H0D A;  2KWO A;  3DPL R;  4B86 C;  1JM7 B;  2XOY A;  2Y1N A;  3ZVY A;  2CT2 A;  5EYA F;  2LXH C;  2HDP A;  4FJC A;  2MT5 A;  4YAD A;  3KNV A;  5B8D A;  5H1T A;  3SOX A;  4R8P K;  3PHD A;  3VK6 A;  2VP7 A;  2EGP A;  4NN2 A;  5LKT A;  1RMD A;  3Q1D A;  1WEW A;  5JG6 A;  1X4U A;  2D8U A;  5DIN A;  3LJU X;  4IC2 A;  5TAB A;  5FER A;  5KH7 A;  4OGE A;  5B77 A;  3PUR A;  2M85 A;  5SVI B;  5TBN A;  3RPG C;  1N87 A;  1WES A;  3T9K A;  3DWD A;  2MIQ A;  2M6M A;  4QF3 A;  2KFT A;  3ZYQ A;  2XB1 A;  3O47 A;  3RPG B;  4LJN A;  2B0O E;  2K17 A;  5C13 A;  3C6W A;  5SVY A;  2F6N A;  2ECN A;  2FD4 A;  3FM8 C;  1Z2Q A;  3M7K A;  2K16 A;  3LVR E;  5AIU A;  5D1L B;  4H9D A;  2YVR A;  2LGK A;  4UI9 B;  5G0F A;  2ECJ A;  4WZ3 B;  3NG2 A;  3MHH A;  2MA5 A;  4FO9 A;  5SVX A;  2EGM A;  2KIZ A;  2K1J A;  1DCQ A;  4N3W A;  1WEE A;  5D1M B;  2F6J A;  3U5N A;  2CRW A;  4O62 A;  3ASL A;  4YC9 A;  2ECI A;  3O36 A;  4BHW A;  4GNG A;  1Z60 A;  2FFW A;  2FSA A;  3HCT A;  5FB1 A;  2RSD A;  3O70 A;  4YBM A;  4F1P A;  5H1U A;  5C11 A;  5LKZ A;  2YHN A;  2L7P A;  1WEU A;  2I50 A;  4R7E A;  2QJ0 A;  1WEQ A;  3ZNI A;  2ZET C;  1WEP A;  2LN0 A;  3KQI A;  3H7H A;  5LCW B;  1BOR A;  4ZUX U;  4XI1 A;  4Z0R A;  2HYE D;  3U5O A;  2CSZ A;  2ECW A;  2VJF A;  2YU4 A;  4WZ2 A;  2LGV A;  2M3H A;  1WEN A;  5TDR A;  2KR4 A;  2JUN A;  2VJE A;  2OWA A;  4UP0 A;  4AVX A;  4F52 B;  2K4D A;  5H9M A;  2G43 A;  3GL6 A;  2OXQ C;  3FEH A;  4WZ0 A;  5LKU A;  2LV9 A;  3KDE C;  3ZPV 1;  2LXP C;  2KRE A;  1VD4 A;  3O37 A;  2QIZ A;  4GNF A;  2KKY A;  3LDY A;  2CKL B;  3U5P A;  3LRQ A;  5H1V A;  2MD8 C;  2KE1 A;  2RI7 A;  1F62 A;  5I3L A;  4I7C A;  2EA6 A;  3KV5 A;  2QIC A;  3SHB A;  2VNF A;  2LGL A;  4B7Y C;  3SOU A;  4GND A;  4I7B A;  3V43 A;  2FUU A;  4AP4 A;  3HCU A;  4TKP B;  2YSJ A;  4IC3 A;  1WFK A;  4W4U A;  2XOZ A;  1FBV A;  2MKE A;  1G25 A;  2VPE A;  1VYX A;  1DVP A;  1X4J A;  3HTK C;  2KYU A;  4L7X A;  2XP0 A;  2LAU A;  2IDA A;  4MVT A;  4P5O B;  1WE9 A;  4O64 A;  3I2D A;  1JM7 A;  3QZV A;  4YBS A;  4A0C D;  2ECG A;  3O35 A;  3PUQ A;  2VPD A;  4LLB A;  5B76 A;  2DJA A;  2D8S A;  3HCS A;  2E6R A;  2LQ6 A;  1HYJ A;  1WIL A;  4A49 A;  2LDR A;  4AUQ B;  3MDB C;  5KH3 A;  2L75 A;  2G45 A;  4A4C A;  2PNX A;  3RTR B;  3LVQ E;  4Q6F A;  5SVI A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...