2YSMA

Solution structure of the second and third phd domain from histone-lysine n-methyltransferase 2c (kmt2c/mll3)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
111
structure length
111
Chain Sequence
b'GSSGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
publication title Solution structure of the first and second PHD domain from Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 111
sequence length 111
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ysmA00
1K2FA 2YYRA 2L80A 4R2YA 3ZVYA 2XEUA 2IDAA 4IC3A 3LQJA 2VNFA 2H0DB 4GNGA 5LKXA 3MHHA 1VD4A 2KWJA 2CKLB 3KQIA 2LRIC 3U5MA 1V87A 2YREA 4UP0A 4N3WA 1CHCA 4MVTA 4L58A 4W4UA 1FP0A 1JOCA 3PURA 2LXPC 3T7LA 2KR4A 2UZGA 3FL2A 4WZ2A 2EA6A 4WZ3B 4TKPB 2KGIA 3V43A 2MNYA 2YHOA 3L1XA 3ZVZB 2L43A 2ECIA 3ZNIA 5LCWB 2AN6A 4A0CD 4R7EA 2DX8A 3KV6A 2MNZA 5H1TA 2QICA 4FO9A 3HCUA 2F6JA 5JG6A 2G43A 1IYMA 2LXHC 2YSMA 2ECGA 4A49A 2CSZA 1WEQA 1WEEA 3GL6A 3U5OA 2G6QA 2E6SA 2LN0A 2L5UA 4YBTA 2C2LA 1WEMA 2M85A 2MT5A 4AUQB 5EYAF 1WIMA 2VPEA 5H9MA 3SOWA 2M6MA 2ECWA 3O36A 1ZBDB 4NN2A 2YQMA 3ZTGA 2FUUA 3ZYQA 5TDWA 2VJFB 5H1UA 4LKAA 4O64A 3KV5A 4YAXA 2K16A 2PUYA 1VYXA 2RSDA 4S3OC 5AITA 3M63A 1LDJB 2YU4A 2M1RA 4V3LC 5H1VA 4LJNA 3QZVA 3KNVA 4LLBA 3U5NA 3VK6A 2VPGA 3M62A 2JMIA 2ECVA 3L11A 2VJEA 4N4FA 1VFYA 2HYED 2MIQA 3N9PA 1BORA 2BAYA 2KWKA 2F6NA 2YT5A 3O70A 5DKAA 2ECJA 3N9MA 5LKTA 2MA5A 2VJFA 5TBNA 4I7BA 1JM7A 4C9ZA 5G05B 3EB6A 1HYJA 2YURA 5TRBA 4FJCA 2MD8C 3U5PA 2YW8A 2YHNA 4ZDTA 2HDPA 2JMDA 3ASLA 2KWNA 4B7YC 2Y1MA 2NAAA 4XI1A 5D1KB 5B78A 3L1ZB 2VPDA 4QF2A 1HYIA 4AYCA 1WGMA 2YQLA 4QF3A 2LV9A 3C6WA 2LGLA 5B76A 5D1MB 1FBVA 2F42A 4GNFA 3MHSA 1U6GB 4PTBA 2CSYA 2EGPA 4V3KC 5LKUA 4CA1A 5B8DA 1MM2A 2VJEB 1N87A 2LGGA 4AVXA 5B79A 4F52B 4GNEA 2L0BA 1WENA 2E6RA 5I3LA 2EODA 1JM7B 3ZPVE 3N9LA 4UI9B 3PUQA 4IC2A 4A4BA 2VP7A 2ECTA 3LRQA 5J3XA 2OXQC 5FERA 2YUCA 3N9QA 1Z60A 2KGGA 3RTRB 2MD7B 1WFKA 4R8PK 5B77A 1DVPA 3LQIA 2YSJA 2VPBA 5KH3A 5KH9A 2XB1A 2KWOA 2FUIA 1WILA 4AYCB 5C11A 3M99A 1T1HA 4MSXA 3IHPA 5G04B 2M3HA 1LDKC 4I7DA 2KYUA 4UP5A 3SOUA 4P5OB 2KE1A 4B86C 4X3GA 2Y1NA 4GNDA 4BBQA 3DPLR 2FSAA 1WEOA 2ZETC 2LQ6A 2KU3A 3SOXA 3RPGB 3O33A 3N9NA 3O34A 2LDRA 4BHWA 1WESA 3T6RA 5FB0A 5TABA 2KIZA 2K17A 5FB1A 4LK9A 2JRJA 1X4JA 1Z6UA 2K1JA 3HCSA 4L7XA 3N9OA 1WE9A 2LGVA 3DQVR 3O37A 2LGKA 2C2VS 2G45A 3PHDA 2CT2A 4ZUXU 2I50A 1WEUA 4FK5A 4GB0A 3HCTA 1WEPA 5D1LB 2Y43A 3C5KA 4I7CA 3EB5A 5G0FA 4YATA 2H0DA 3HTKC 5FEYA 4LADB 3GV4A 4A4CA 4S3OB 2CKLA 5AIUA 5B75A 2JMJA 2QJ0A 1X4UA 2D8SA 1E4UA 2PNXA 2KFTA 4CCGX 1G25A 2ECNA 2KREA 3O7AA 3RPGC 2L75A 4YC9A 3O35A 4YABA 4AP4A 4WZ0A 1RMDA 1X4IA 3SHBA 2RI7A 1MM3A 4WA6A 4ZQLA 4YBSA 3I2DA 1F62A 5TDRA 2QIZA 1WEVA 3LQHA 5KH7A 3ZPV1 4YBMA 5LKZA 1XWHA 4FIPA 4PPEA 1Z2QA 5C13A 2K4DA 1WEWA 5DINA 4YADA 3NG2A 4Q6FA 2MA6A 2MUMA
chains in the Genus database with same CATH superfamily
1K2FA 2YYRA 2L80A 4R2YA 4Z0RA 3ZVYA 2XEUA 2IDAA 4IC3A 2LAUA 3LQJA 2VNFA 2H0DB 4GNGA 5LKXA 3MHHA 1VD4A 2KWJA 2CKLB 3KQIA 2LRIC 3U5MA 3LJUX 1V87A 5SVIB 2YREA 4UP0A 4N3WA 1CHCA 4MVTA 4L58A 4W4UA 1FP0A 1JOCA 3PURA 2LXPC 3T7LA 2KR4A 2UZGA 3FL2A 2P57A 4WZ2A 2EA6A 4WZ3B 4TKPB 2KGIA 3V43A 2MNYA 2YHOA 3L1XA 3ZVZB 2L43A 2ECIA 3ZNIA 5LCWB 2AN6A 4A0CD 4R7EA 3FJUB 2DX8A 3KV6A 2MNZA 5H1TA 2M13A 2QICA 2XOZA 4FO9A 2KKXA 3HCUA 2F6JA 5JG6A 2G43A 1IYMA 5SVIA 2LXHC 2YSMA 2ECGA 4A49A 2CSZA 1WEQA 1WEEA 3GL6A 3U5OA 2CRRA 2FD4A 2KKYA 2G6QA 2XP0A 2E6SA 2LN0A 2L5UA 4YBTA 4Z0OA 2C2LA 5K3QA 1WEMA 2M85A 2MT5A 4AUQB 5EYAF 1WIMA 2VPEA 5H9MA 3SOWA 2M6MA 2ECWA 3O36A 1ZBDB 2JM3A 4NN2A 2YQMA 2CONA 3ZTGA 2FUUA 3DDTA 3Q1DA 3ZYQA 5TDWA 2VJFB 5H1UA 2B0OE 4LKAA 4O64A 3KV5A 4YAXA 2K16A 2PUYA 1VYXA 2RSDA 4S3OC 5AITA 3M63A 1LDJB 5SVYA 2YU4A 2M1RA 4V3LC 5H1VA 4LJNA 3QZVA 3KNVA 3DWDA 4LLBA 3U5NA 3FM8C 3VK6A 2VPGA 3M62A 2JMIA 2ECVA 2RR4A 3L11A 2VJEA 4N4FA 1VFYA 2HYED 2MIQA 3N9PA 1BORA 2BAYA 2KWKA 2JUNA 2OWAA 3LVQE 2F6NA 2YT5A 3O70A 5DKAA 2ECJA 3N9MA 2DJAA 2MA5A 2VJFA 4OGCA 5TBNA 4I7BA 5LKTA 1JM7A 4C9ZA 5G05B 3EB6A 3E2DA 1HYJA 2YURA 5TRBA 4FJCA 2MD8C 3U5PA 2YW8A 2YHNA 4ZDTA 2HDPA 2FFWA 2JMDA 3ASLA 2KWNA 4B7YC 2Y1MA 2NAAA 4XI1A 5D1KB 5B78A 3L1ZB 2VPDA 4QF2A 1HYIA 4AYCA 1WGMA 3M7KA 3O47A 2YQLA 4QF3A 2LV9A 3C6WA 2LGLA 5B76A 5D1MB 5SVXA 1FBVA 2F42A 4GNFA 3MHSA 1U6GB 3MDBC 2CRWA 4PTBA 2CSYA 2EGPA 2YVRA 4V3KC 5LKUA 4CA1A 5B8DA 1MM2A 2VJEB 1N87A 2LGGA 4AVXA 1MBMA 3KDEC 5B79A 4F52B 2EXUA 4GNEA 2L0BA 4OGEA 1WENA 2E6RA 2E61A 5I3LA 2EODA 1JM7B 3ZPVE 3N9LA 4UI9B 3PUQA 4IC2A 4A4BA 2VP7A 2ECTA 3LRQA 4O62A 5J3XA 2OXQC 5FERA 2YUCA 3N9QA 1Z60A 2KGGA 3RTRB 2MD7B 1WFKA 4R8PK 5B77A 1DVPA 3LQIA 2YSJA 2VPBA 5KH3A 5KH9A 2XOCA 2XB1A 2KWOA 2FUIA 1WILA 4AYCB 5C11A 3M99A 1T1HA 4MSXA 3IHPA 5G04B 2M3HA 1LDKC 4I7DA 2KYUA 4UP5A 3SOUA 4P5OB 2KE1A 4B86C 2D8UA 4X3GA 2Y1NA 3H7HA 4GNDA 4BBQA 3DPLR 3LVRE 2FSAA 1WEOA 3T9KA 2ZETC 2LQ6A 2KU3A 3SOXA 3O33A 3N9NA 3O34A 3RPGB 2LDRA 4BHWA 1WESA 3T6RA 5FB0A 3JUEA 5TABA 2KIZA 2K17A 5FB1A 2XOYA 4LK9A 2JRJA 1X4JA 1Z6UA 2K1JA 4H9DA 3HCSA 4L7XA 3N9OA 2EGMA 1WE9A 2L7PA 3FEHA 2LGVA 3DQVR 3O37A 2LGKA 2C2VS 2G45A 3PHDA 2CT2A 4ZUXU 2I50A 1WEUA 4FK5A 4GB0A 3HCTA 1WEPA 5D1LB 2Y43A 3C5KA 4I7CA 3EB5A 5G0FA 4YATA 2H0DA 3HTKC 4F1PA 5FEYA 4LADB 3GV4A 4A4CA 4S3OB 2CKLA 5AIUA 5B75A 2JMJA 2QJ0A 1X4UA 2D8SA 1E4UA 2PNXA 2KFTA 1DCQA 4CCGX 1G25A 2ECNA 2KREA 3O7AA 3RPGC 2IQJA 2L75A 3FAOA 4YC9A 3O35A 4YABA 4AP4A 4WZ0A 1RMDA 1X4IA 3SHBA 2RI7A 1MM3A 3LDYA 4WA6A 4QQ4A 4ZQLA 4YBSA 3I2DA 1F62A 3SUBA 5TDRA 3FANA 3PLWA 2QIZA 1WEVA 3LQHA 5KH7A 3ZPV1 4YBMA 5LKZA 1XWHA 4FIPA 4PPEA 1Z2QA 5C13A 2K4DA 1WEWA 5DINA 4YADA 3NG2A 4Q6FA 2CSVA 2DSMA 2MA6A 2MUMA 2MKEA
chains in the Genus database with same CATH topology
1K2FA 2YYRA 2L80A 4R2YA 3ZVYA 2XEUA 2IDAA 4IC3A 3LQJA 2VNFA 2H0DB 4GNGA 5LKXA 3MHHA 1VD4A 2KWJA 2CKLB 3KQIA 2LRIC 3U5MA 1V87A 2YREA 4UP0A 4N3WA 1CHCA 4MVTA 4L58A 4W4UA 1FP0A 1JOCA 3PURA 2LXPC 3T7LA 2KR4A 2UZGA 3FL2A 4WZ2A 2EA6A 4WZ3B 4TKPB 2KGIA 3V43A 2MNYA 2YHOA 3L1XA 3ZVZB 2L43A 2ECIA 3ZNIA 5LCWB 2AN6A 4A0CD 4R7EA 2DX8A 3KV6A 2MNZA 5H1TA 2QICA 4FO9A 3HCUA 2F6JA 5JG6A 2G43A 1IYMA 2LXHC 2YSMA 2ECGA 4A49A 2CSZA 1WEQA 1WEEA 3GL6A 3U5OA 2G6QA 2E6SA 2LN0A 2L5UA 4YBTA 2C2LA 1WEMA 2M85A 2MT5A 4AUQB 5EYAF 1WIMA 2VPEA 5H9MA 3SOWA 2M6MA 2ECWA 3O36A 1ZBDB 4NN2A 2YQMA 3ZTGA 2FUUA 3ZYQA 5TDWA 2VJFB 5H1UA 4LKAA 4O64A 3KV5A 4YAXA 2K16A 2PUYA 1VYXA 2RSDA 4S3OC 5AITA 3M63A 1LDJB 2YU4A 2M1RA 4V3LC 5H1VA 4LJNA 3QZVA 3KNVA 4LLBA 3U5NA 3VK6A 2VPGA 3M62A 2JMIA 2ECVA 3L11A 2VJEA 4N4FA 1VFYA 2HYED 2MIQA 3N9PA 1BORA 2BAYA 2KWKA 2F6NA 2YT5A 3O70A 5DKAA 2ECJA 3N9MA 5LKTA 2MA5A 2VJFA 5TBNA 4I7BA 1JM7A 4C9ZA 5G05B 3EB6A 1HYJA 2YURA 5TRBA 4FJCA 2MD8C 3U5PA 2YW8A 2YHNA 4ZDTA 2HDPA 2JMDA 3ASLA 2KWNA 4B7YC 2Y1MA 2NAAA 4XI1A 5D1KB 5B78A 3L1ZB 2VPDA 4QF2A 1HYIA 4AYCA 1WGMA 2YQLA 4QF3A 2LV9A 3C6WA 2LGLA 5B76A 5D1MB 1FBVA 2F42A 4GNFA 3MHSA 1U6GB 4PTBA 2CSYA 2EGPA 4V3KC 5LKUA 4CA1A 5B8DA 1MM2A 2VJEB 1N87A 2LGGA 4AVXA 5B79A 4F52B 4GNEA 2L0BA 1WENA 2E6RA 5I3LA 2EODA 1JM7B 3ZPVE 3N9LA 4UI9B 3PUQA 4IC2A 4A4BA 2VP7A 2ECTA 3LRQA 5J3XA 2OXQC 5FERA 2YUCA 3N9QA 1Z60A 2KGGA 3RTRB 2MD7B 1WFKA 4R8PK 5B77A 1DVPA 3LQIA 2YSJA 2VPBA 5KH3A 5KH9A 2XB1A 2KWOA 2FUIA 1WILA 4AYCB 5C11A 3M99A 1T1HA 4MSXA 3IHPA 5G04B 2M3HA 1LDKC 4I7DA 2KYUA 4UP5A 3SOUA 4P5OB 2KE1A 4B86C 4X3GA 2Y1NA 4GNDA 4BBQA 3DPLR 2FSAA 1WEOA 2ZETC 2LQ6A 2KU3A 3SOXA 3RPGB 3O33A 3N9NA 3O34A 2LDRA 4BHWA 1WESA 3T6RA 5FB0A 5TABA 2KIZA 2K17A 5FB1A 4LK9A 2JRJA 1X4JA 1Z6UA 2K1JA 3HCSA 4L7XA 3N9OA 1WE9A 2LGVA 3DQVR 3O37A 2LGKA 2C2VS 2G45A 3PHDA 2CT2A 4ZUXU 2I50A 1WEUA 4FK5A 4GB0A 3HCTA 1WEPA 5D1LB 2Y43A 3C5KA 4I7CA 3EB5A 5G0FA 4YATA 2H0DA 3HTKC 5FEYA 4LADB 3GV4A 4A4CA 4S3OB 2CKLA 5AIUA 5B75A 2JMJA 2QJ0A 1X4UA 2D8SA 1E4UA 2PNXA 2KFTA 4CCGX 1G25A 2ECNA 2KREA 3O7AA 3RPGC 2L75A 4YC9A 3O35A 4YABA 4AP4A 4WZ0A 1RMDA 1X4IA 3SHBA 2RI7A 1MM3A 4WA6A 4ZQLA 4YBSA 3I2DA 1F62A 5TDRA 2QIZA 1WEVA 3LQHA 5KH7A 3ZPV1 4YBMA 5LKZA 1XWHA 4FIPA 4PPEA 1Z2QA 5C13A 2K4DA 1WEWA 5DINA 4YADA 3NG2A 4Q6FA 2MA6A 2MUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2F A;  2YYR A;  2L80 A;  4R2Y A;  3ZVY A;  2XEU A;  2IDA A;  4IC3 A;  3LQJ A;  2VNF A;  2H0D B;  4GNG A;  5LKX A;  3MHH A;  1VD4 A;  2KWJ A;  2CKL B;  3KQI A;  2LRI C;  3U5M A;  1V87 A;  2YRE A;  4UP0 A;  4N3W A;  1CHC A;  4MVT A;  4L58 A;  4W4U A;  1FP0 A;  1JOC A;  3PUR A;  2LXP C;  3T7L A;  2KR4 A;  2UZG A;  3FL2 A;  4WZ2 A;  2EA6 A;  4WZ3 B;  4TKP B;  2KGI A;  3V43 A;  2MNY A;  2YHO A;  3L1X A;  3ZVZ B;  2L43 A;  2ECI A;  3ZNI A;  5LCW B;  2AN6 A;  4A0C D;  4R7E A;  2DX8 A;  3KV6 A;  2MNZ A;  5H1T A;  2QIC A;  4FO9 A;  3HCU A;  2F6J A;  5JG6 A;  2G43 A;  1IYM A;  2LXH C;  2YSM A;  2ECG A;  4A49 A;  2CSZ A;  1WEQ A;  1WEE A;  3GL6 A;  3U5O A;  2G6Q A;  2E6S A;  2LN0 A;  2L5U A;  4YBT A;  2C2L A;  1WEM A;  2M85 A;  2MT5 A;  4AUQ B;  5EYA F;  1WIM A;  2VPE A;  5H9M A;  3SOW A;  2M6M A;  2ECW A;  3O36 A;  1ZBD B;  4NN2 A;  2YQM A;  3ZTG A;  2FUU A;  3ZYQ A;  5TDW A;  2VJF B;  5H1U A;  4LKA A;  4O64 A;  3KV5 A;  4YAX A;  2K16 A;  2PUY A;  1VYX A;  2RSD A;  4S3O C;  5AIT A;  3M63 A;  1LDJ B;  2YU4 A;  2M1R A;  4V3L C;  5H1V A;  4LJN A;  3QZV A;  3KNV A;  4LLB A;  3U5N A;  3VK6 A;  2VPG A;  3M62 A;  2JMI A;  2ECV A;  3L11 A;  2VJE A;  4N4F A;  1VFY A;  2HYE D;  2MIQ A;  3N9P A;  1BOR A;  2BAY A;  2KWK A;  2F6N A;  2YT5 A;  3O70 A;  5DKA A;  2ECJ A;  3N9M A;  5LKT A;  2MA5 A;  2VJF A;  5TBN A;  4I7B A;  1JM7 A;  4C9Z A;  5G05 B;  3EB6 A;  1HYJ A;  2YUR A;  5TRB A;  4FJC A;  2MD8 C;  3U5P A;  2YW8 A;  2YHN A;  4ZDT A;  2HDP A;  2JMD A;  3ASL A;  2KWN A;  4B7Y C;  2Y1M A;  2NAA A;  4XI1 A;  5D1K B;  5B78 A;  3L1Z B;  2VPD A;  4QF2 A;  1HYI A;  4AYC A;  1WGM A;  2YQL A;  4QF3 A;  2LV9 A;  3C6W A;  2LGL A;  5B76 A;  5D1M B;  1FBV A;  2F42 A;  4GNF A;  3MHS A;  1U6G B;  4PTB A;  2CSY A;  2EGP A;  4V3K C;  5LKU A;  4CA1 A;  5B8D A;  1MM2 A;  2VJE B;  1N87 A;  2LGG A;  4AVX A;  5B79 A;  4F52 B;  4GNE A;  2L0B A;  1WEN A;  2E6R A;  5I3L A;  2EOD A;  1JM7 B;  3ZPV E;  3N9L A;  4UI9 B;  3PUQ A;  4IC2 A;  4A4B A;  2VP7 A;  2ECT A;  3LRQ A;  5J3X A;  2OXQ C;  5FER A;  2YUC A;  3N9Q A;  1Z60 A;  2KGG A;  3RTR B;  2MD7 B;  1WFK A;  4R8P K;  5B77 A;  1DVP A;  3LQI A;  2YSJ A;  2VPB A;  5KH3 A;  5KH9 A;  2XB1 A;  2KWO A;  2FUI A;  1WIL A;  4AYC B;  5C11 A;  3M99 A;  1T1H A;  4MSX A;  3IHP A;  5G04 B;  2M3H A;  1LDK C;  4I7D A;  2KYU A;  4UP5 A;  3SOU A;  4P5O B;  2KE1 A;  4B86 C;  4X3G A;  2Y1N A;  4GND A;  4BBQ A;  3DPL R;  2FSA A;  1WEO A;  2ZET C;  2LQ6 A;  2KU3 A;  3SOX A;  3RPG B;  3O33 A;  3N9N A;  3O34 A;  2LDR A;  4BHW A;  1WES A;  3T6R A;  5FB0 A;  5TAB A;  2KIZ A;  2K17 A;  5FB1 A;  4LK9 A;  2JRJ A;  1X4J A;  1Z6U A;  2K1J A;  3HCS A;  4L7X A;  3N9O A;  1WE9 A;  2LGV A;  3DQV R;  3O37 A;  2LGK A;  2C2V S;  2G45 A;  3PHD A;  2CT2 A;  4ZUX U;  2I50 A;  1WEU A;  4FK5 A;  4GB0 A;  3HCT A;  1WEP A;  5D1L B;  2Y43 A;  3C5K A;  4I7C A;  3EB5 A;  5G0F A;  4YAT A;  2H0D A;  3HTK C;  5FEY A;  4LAD B;  3GV4 A;  4A4C A;  4S3O B;  2CKL A;  5AIU A;  5B75 A;  2JMJ A;  2QJ0 A;  1X4U A;  2D8S A;  1E4U A;  2PNX A;  2KFT A;  4CCG X;  1G25 A;  2ECN A;  2KRE A;  3O7A A;  3RPG C;  2L75 A;  4YC9 A;  3O35 A;  4YAB A;  4AP4 A;  4WZ0 A;  1RMD A;  1X4I A;  3SHB A;  2RI7 A;  1MM3 A;  4WA6 A;  4ZQL A;  4YBS A;  3I2D A;  1F62 A;  5TDR A;  2QIZ A;  1WEV A;  3LQH A;  5KH7 A;  3ZPV 1;  4YBM A;  5LKZ A;  1XWH A;  4FIP A;  4PPE A;  1Z2Q A;  5C13 A;  2K4D A;  1WEW A;  5DIN A;  4YAD A;  3NG2 A;  4Q6F A;  2MA6 A;  2MUM A; 
#chains in the Genus database with same CATH topology
 1K2F A;  2YYR A;  2L80 A;  4R2Y A;  4Z0R A;  3ZVY A;  2XEU A;  2IDA A;  4IC3 A;  2LAU A;  3LQJ A;  2VNF A;  2H0D B;  4GNG A;  5LKX A;  3MHH A;  1VD4 A;  2KWJ A;  2CKL B;  3KQI A;  2LRI C;  3U5M A;  3LJU X;  1V87 A;  5SVI B;  2YRE A;  4UP0 A;  4N3W A;  1CHC A;  4MVT A;  4L58 A;  4W4U A;  1FP0 A;  1JOC A;  3PUR A;  2LXP C;  3T7L A;  2KR4 A;  2UZG A;  3FL2 A;  2P57 A;  4WZ2 A;  2EA6 A;  4WZ3 B;  4TKP B;  2KGI A;  3V43 A;  2MNY A;  2YHO A;  3L1X A;  3ZVZ B;  2L43 A;  2ECI A;  3ZNI A;  5LCW B;  2AN6 A;  4A0C D;  4R7E A;  3FJU B;  2DX8 A;  3KV6 A;  2MNZ A;  5H1T A;  2M13 A;  2QIC A;  2XOZ A;  4FO9 A;  2KKX A;  3HCU A;  2F6J A;  5JG6 A;  2G43 A;  1IYM A;  5SVI A;  2LXH C;  2YSM A;  2ECG A;  4A49 A;  2CSZ A;  1WEQ A;  1WEE A;  3GL6 A;  3U5O A;  2CRR A;  2FD4 A;  2KKY A;  2G6Q A;  2XP0 A;  2E6S A;  2LN0 A;  2L5U A;  4YBT A;  4Z0O A;  2C2L A;  5K3Q A;  1WEM A;  2M85 A;  2MT5 A;  4AUQ B;  5EYA F;  1WIM A;  2VPE A;  5H9M A;  3SOW A;  2M6M A;  2ECW A;  3O36 A;  1ZBD B;  2JM3 A;  4NN2 A;  2YQM A;  2CON A;  3ZTG A;  2FUU A;  3DDT A;  3Q1D A;  3ZYQ A;  5TDW A;  2VJF B;  5H1U A;  2B0O E;  4LKA A;  4O64 A;  3KV5 A;  4YAX A;  2K16 A;  2PUY A;  1VYX A;  2RSD A;  4S3O C;  5AIT A;  3M63 A;  1LDJ B;  5SVY A;  2YU4 A;  2M1R A;  4V3L C;  5H1V A;  4LJN A;  3QZV A;  3KNV A;  3DWD A;  4LLB A;  3U5N A;  3FM8 C;  3VK6 A;  2VPG A;  3M62 A;  2JMI A;  2ECV A;  2RR4 A;  3L11 A;  2VJE A;  4N4F A;  1VFY A;  2HYE D;  2MIQ A;  3N9P A;  1BOR A;  2BAY A;  2KWK A;  2JUN A;  2OWA A;  3LVQ E;  2F6N A;  2YT5 A;  3O70 A;  5DKA A;  2ECJ A;  3N9M A;  2DJA A;  2MA5 A;  2VJF A;  4OGC A;  5TBN A;  4I7B A;  5LKT A;  1JM7 A;  4C9Z A;  5G05 B;  3EB6 A;  3E2D A;  1HYJ A;  2YUR A;  5TRB A;  4FJC A;  2MD8 C;  3U5P A;  2YW8 A;  2YHN A;  4ZDT A;  2HDP A;  2FFW A;  2JMD A;  3ASL A;  2KWN A;  4B7Y C;  2Y1M A;  2NAA A;  4XI1 A;  5D1K B;  5B78 A;  3L1Z B;  2VPD A;  4QF2 A;  1HYI A;  4AYC A;  1WGM A;  3M7K A;  3O47 A;  2YQL A;  4QF3 A;  2LV9 A;  3C6W A;  2LGL A;  5B76 A;  5D1M B;  5SVX A;  1FBV A;  2F42 A;  4GNF A;  3MHS A;  1U6G B;  3MDB C;  2CRW A;  4PTB A;  2CSY A;  2EGP A;  2YVR A;  4V3K C;  5LKU A;  4CA1 A;  5B8D A;  1MM2 A;  2VJE B;  1N87 A;  2LGG A;  4AVX A;  1MBM A;  3KDE C;  5B79 A;  4F52 B;  2EXU A;  4GNE A;  2L0B A;  4OGE A;  1WEN A;  2E6R A;  2E61 A;  5I3L A;  2EOD A;  1JM7 B;  3ZPV E;  3N9L A;  4UI9 B;  3PUQ A;  4IC2 A;  4A4B A;  2VP7 A;  2ECT A;  3LRQ A;  4O62 A;  5J3X A;  2OXQ C;  5FER A;  2YUC A;  3N9Q A;  1Z60 A;  2KGG A;  3RTR B;  2MD7 B;  1WFK A;  4R8P K;  5B77 A;  1DVP A;  3LQI A;  2YSJ A;  2VPB A;  5KH3 A;  5KH9 A;  2XOC A;  2XB1 A;  2KWO A;  2FUI A;  1WIL A;  4AYC B;  5C11 A;  3M99 A;  1T1H A;  4MSX A;  3IHP A;  5G04 B;  2M3H A;  1LDK C;  4I7D A;  2KYU A;  4UP5 A;  3SOU A;  4P5O B;  2KE1 A;  4B86 C;  2D8U A;  4X3G A;  2Y1N A;  3H7H A;  4GND A;  4BBQ A;  3DPL R;  3LVR E;  2FSA A;  1WEO A;  3T9K A;  2ZET C;  2LQ6 A;  2KU3 A;  3SOX A;  3O33 A;  3N9N A;  3O34 A;  3RPG B;  2LDR A;  4BHW A;  1WES A;  3T6R A;  5FB0 A;  3JUE A;  5TAB A;  2KIZ A;  2K17 A;  5FB1 A;  2XOY A;  4LK9 A;  2JRJ A;  1X4J A;  1Z6U A;  2K1J A;  4H9D A;  3HCS A;  4L7X A;  3N9O A;  2EGM A;  1WE9 A;  2L7P A;  3FEH A;  2LGV A;  3DQV R;  3O37 A;  2LGK A;  2C2V S;  2G45 A;  3PHD A;  2CT2 A;  4ZUX U;  2I50 A;  1WEU A;  4FK5 A;  4GB0 A;  3HCT A;  1WEP A;  5D1L B;  2Y43 A;  3C5K A;  4I7C A;  3EB5 A;  5G0F A;  4YAT A;  2H0D A;  3HTK C;  4F1P A;  5FEY A;  4LAD B;  3GV4 A;  4A4C A;  4S3O B;  2CKL A;  5AIU A;  5B75 A;  2JMJ A;  2QJ0 A;  1X4U A;  2D8S A;  1E4U A;  2PNX A;  2KFT A;  1DCQ A;  4CCG X;  1G25 A;  2ECN A;  2KRE A;  3O7A A;  3RPG C;  2IQJ A;  2L75 A;  3FAO A;  4YC9 A;  3O35 A;  4YAB A;  4AP4 A;  4WZ0 A;  1RMD A;  1X4I A;  3SHB A;  2RI7 A;  1MM3 A;  3LDY A;  4WA6 A;  4QQ4 A;  4ZQL A;  4YBS A;  3I2D A;  1F62 A;  3SUB A;  5TDR A;  3FAN A;  3PLW A;  2QIZ A;  1WEV A;  3LQH A;  5KH7 A;  3ZPV 1;  4YBM A;  5LKZ A;  1XWH A;  4FIP A;  4PPE A;  1Z2Q A;  5C13 A;  2K4D A;  1WEW A;  5DIN A;  4YAD A;  3NG2 A;  4Q6F A;  2CSV A;  2DSM A;  2MA6 A;  2MUM A;  2MKE A; 
#chains in the Genus database with same CATH homology
 1K2F A;  2YYR A;  2L80 A;  4R2Y A;  3ZVY A;  2XEU A;  2IDA A;  4IC3 A;  3LQJ A;  2VNF A;  2H0D B;  4GNG A;  5LKX A;  3MHH A;  1VD4 A;  2KWJ A;  2CKL B;  3KQI A;  2LRI C;  3U5M A;  1V87 A;  2YRE A;  4UP0 A;  4N3W A;  1CHC A;  4MVT A;  4L58 A;  4W4U A;  1FP0 A;  1JOC A;  3PUR A;  2LXP C;  3T7L A;  2KR4 A;  2UZG A;  3FL2 A;  4WZ2 A;  2EA6 A;  4WZ3 B;  4TKP B;  2KGI A;  3V43 A;  2MNY A;  2YHO A;  3L1X A;  3ZVZ B;  2L43 A;  2ECI A;  3ZNI A;  5LCW B;  2AN6 A;  4A0C D;  4R7E A;  2DX8 A;  3KV6 A;  2MNZ A;  5H1T A;  2QIC A;  4FO9 A;  3HCU A;  2F6J A;  5JG6 A;  2G43 A;  1IYM A;  2LXH C;  2YSM A;  2ECG A;  4A49 A;  2CSZ A;  1WEQ A;  1WEE A;  3GL6 A;  3U5O A;  2G6Q A;  2E6S A;  2LN0 A;  2L5U A;  4YBT A;  2C2L A;  1WEM A;  2M85 A;  2MT5 A;  4AUQ B;  5EYA F;  1WIM A;  2VPE A;  5H9M A;  3SOW A;  2M6M A;  2ECW A;  3O36 A;  1ZBD B;  4NN2 A;  2YQM A;  3ZTG A;  2FUU A;  3ZYQ A;  5TDW A;  2VJF B;  5H1U A;  4LKA A;  4O64 A;  3KV5 A;  4YAX A;  2K16 A;  2PUY A;  1VYX A;  2RSD A;  4S3O C;  5AIT A;  3M63 A;  1LDJ B;  2YU4 A;  2M1R A;  4V3L C;  5H1V A;  4LJN A;  3QZV A;  3KNV A;  4LLB A;  3U5N A;  3VK6 A;  2VPG A;  3M62 A;  2JMI A;  2ECV A;  3L11 A;  2VJE A;  4N4F A;  1VFY A;  2HYE D;  2MIQ A;  3N9P A;  1BOR A;  2BAY A;  2KWK A;  2F6N A;  2YT5 A;  3O70 A;  5DKA A;  2ECJ A;  3N9M A;  5LKT A;  2MA5 A;  2VJF A;  5TBN A;  4I7B A;  1JM7 A;  4C9Z A;  5G05 B;  3EB6 A;  1HYJ A;  2YUR A;  5TRB A;  4FJC A;  2MD8 C;  3U5P A;  2YW8 A;  2YHN A;  4ZDT A;  2HDP A;  2JMD A;  3ASL A;  2KWN A;  4B7Y C;  2Y1M A;  2NAA A;  4XI1 A;  5D1K B;  5B78 A;  3L1Z B;  2VPD A;  4QF2 A;  1HYI A;  4AYC A;  1WGM A;  2YQL A;  4QF3 A;  2LV9 A;  3C6W A;  2LGL A;  5B76 A;  5D1M B;  1FBV A;  2F42 A;  4GNF A;  3MHS A;  1U6G B;  4PTB A;  2CSY A;  2EGP A;  4V3K C;  5LKU A;  4CA1 A;  5B8D A;  1MM2 A;  2VJE B;  1N87 A;  2LGG A;  4AVX A;  5B79 A;  4F52 B;  4GNE A;  2L0B A;  1WEN A;  2E6R A;  5I3L A;  2EOD A;  1JM7 B;  3ZPV E;  3N9L A;  4UI9 B;  3PUQ A;  4IC2 A;  4A4B A;  2VP7 A;  2ECT A;  3LRQ A;  5J3X A;  2OXQ C;  5FER A;  2YUC A;  3N9Q A;  1Z60 A;  2KGG A;  3RTR B;  2MD7 B;  1WFK A;  4R8P K;  5B77 A;  1DVP A;  3LQI A;  2YSJ A;  2VPB A;  5KH3 A;  5KH9 A;  2XB1 A;  2KWO A;  2FUI A;  1WIL A;  4AYC B;  5C11 A;  3M99 A;  1T1H A;  4MSX A;  3IHP A;  5G04 B;  2M3H A;  1LDK C;  4I7D A;  2KYU A;  4UP5 A;  3SOU A;  4P5O B;  2KE1 A;  4B86 C;  4X3G A;  2Y1N A;  4GND A;  4BBQ A;  3DPL R;  2FSA A;  1WEO A;  2ZET C;  2LQ6 A;  2KU3 A;  3SOX A;  3RPG B;  3O33 A;  3N9N A;  3O34 A;  2LDR A;  4BHW A;  1WES A;  3T6R A;  5FB0 A;  5TAB A;  2KIZ A;  2K17 A;  5FB1 A;  4LK9 A;  2JRJ A;  1X4J A;  1Z6U A;  2K1J A;  3HCS A;  4L7X A;  3N9O A;  1WE9 A;  2LGV A;  3DQV R;  3O37 A;  2LGK A;  2C2V S;  2G45 A;  3PHD A;  2CT2 A;  4ZUX U;  2I50 A;  1WEU A;  4FK5 A;  4GB0 A;  3HCT A;  1WEP A;  5D1L B;  2Y43 A;  3C5K A;  4I7C A;  3EB5 A;  5G0F A;  4YAT A;  2H0D A;  3HTK C;  5FEY A;  4LAD B;  3GV4 A;  4A4C A;  4S3O B;  2CKL A;  5AIU A;  5B75 A;  2JMJ A;  2QJ0 A;  1X4U A;  2D8S A;  1E4U A;  2PNX A;  2KFT A;  4CCG X;  1G25 A;  2ECN A;  2KRE A;  3O7A A;  3RPG C;  2L75 A;  4YC9 A;  3O35 A;  4YAB A;  4AP4 A;  4WZ0 A;  1RMD A;  1X4I A;  3SHB A;  2RI7 A;  1MM3 A;  4WA6 A;  4ZQL A;  4YBS A;  3I2D A;  1F62 A;  5TDR A;  2QIZ A;  1WEV A;  3LQH A;  5KH7 A;  3ZPV 1;  4YBM A;  5LKZ A;  1XWH A;  4FIP A;  4PPE A;  1Z2Q A;  5C13 A;  2K4D A;  1WEW A;  5DIN A;  4YAD A;  3NG2 A;  4Q6F A;  2MA6 A;  2MUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...