2YSMA

Solution structure of the second and third phd domain from histone-lysine n-methyltransferase 2c (kmt2c/mll3)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
111
structure length
111
Chain Sequence
GSSGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
publication title Solution structure of the first and second PHD domain from Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 111
sequence length 111
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ysmA00
3KV6A 2KGGA 3VK6A 2L80A 4S3OC 4R2YA 2LGKA 5EYAF 1WEPA 2ECJA 5G0FA 4LKAA 4X3GA 2Y43A 4MVTA 2LXHC 4GNFA 2K16A 4FIPA 4FJCA 4CCGX 2YQMA 1WGMA 2KWOA 2ECGA 3N9LA 2VJEA 3ZNIA 1WEVA 2ECNA 3ZTGA 2I50A 3U5NA 2M85A 4UP0A 2G43A 2VPGA 2VPDA 3PHDA 2PNXA 1JM7A 4LJNA 1Z60A 5G04B 5TDRA 2G6QA 2LXPC 1MM3A 5TDWA 5FERA 3RPGB 1FBVA 1VD4A 2C2VS 3U5OA 2YREA 2FSAA 4BBQA 4YC9A 3ASLA 4BHWA 2JMJA 3EB6A 3O34A 1VFYA 4Q6FA 3N9OA 2CT2A 3SOUA 3ZVYA 1X4IA 3M99A 5TBNA 3MHHA 1WE9A 4GNDA 2LDRA 4YAXA 3M63A 5AITA 2MA6A 4LK9A 3O7AA 3N9NA 5KH9A 2RSDA 2KE1A 1U6GB 1JOCA 1N87A 3LQJA 1T1HA 5KH3A 1MM2A 5AIUA 2G45A 1ZBDB 3KNVA 2LN0A 2VPEA 2KR4A 4YADA 4UI9B 3ZVZB 3HTKC 2HDPA 3O36A 1F62A 2YU4A 2L75A 3RPGC 2KGIA 3C6WA 3HCSA 2H0DA 4GB0A 3U5PA 1VYXA 2LGVA 5LKUA 3V43A 1X4JA 4WZ3B 3L1XA 2F42A 2H0DB 2Y1MA 4QF2A 2BAYA 1BORA 2LGLA 2QICA 2JMDA 3M62A 4YATA 3T7LA 5H1VA 1X4UA 2VP7A 2F6NA 2OXQC 4AP4A 4YBSA 2M3HA 2AN6A 2KFTA 2KWJA 4TKPB 5B8DA 2CKLA 1DVPA 3NG2A 5KH7A 1WEWA 2VJEB 2ECWA 2KWNA 2K17A 4O64A 4GNEA 3LRQA 5D1KB 3O35A 2YQLA 2M6MA 4A0CD 5FB1A 2YSMA 1WILA 1HYIA 2MT5A 1JM7B 3ZYQA 3L11A 1Z6UA 3ZPVE 2EA6A 3GL6A 3ZPV1 4A4CA 4PTBA 1WEOA 2MIQA 2EGPA 4QF3A 1WENA 4WA6A 5B79A 1WEUA 4WZ0A 2KYUA 3SOXA 2LRIC 2M1RA 2JRJA 4A49A 2MD7B 1V87A 2JMIA 3FL2A 5LKXA 4FK5A 3N9MA 2NAAA 2MD8C 5H1UA 3RTRB 4MSXA 3GV4A 4I7DA 4ZUXU 4FO9A 1IYMA 2LQ6A 2RI7A 4V3LC 5FB0A 1WFKA 1Z2QA 4I7CA 1WIMA 3LQHA 3I2DA 1WEMA 3IHPA 4R8PK 2YW8A 3KV5A 2PUYA 4YABA 2E6RA 5B75A 4I7BA 5DKAA 2MA5A 2YHNA 2LV9A 2YT5A 2MNZA 1LDJB 1K2FA 2E6SA 4WZ2A 2XEUA 2MUMA 2VPBA 3MHSA 2CSYA 3U5MA 5B78A 4A4BA 2ZETC 5D1LB 3N9QA 5C13A 2KWKA 2C2LA 4ZQLA 4YBMA 4N4FA 5B77A 2K1JA 2LGGA 2K4DA 5JG6A 2L5UA 2QIZA 5LCWB 3HCTA 2FUIA 5LKTA 5D1MB 2Y1NA 2YSJA 4LLBA 2YYRA 4YBTA 2ECVA 3HCUA 2CKLB 2VNFA 3DPLR 3QZVA 4XI1A 2HYED 2XB1A 5TRBA 4L7XA 4UP5A 4N3WA 1XWHA 2KIZA 3O33A 4NN2A 4LADB 4CA1A 2IDAA 1WEEA 5FEYA 4P5OB 3SOWA 1LDKC 2QJ0A 3O37A 3LQIA 4V3KC 2YUCA 5I3LA 2VJFA 4PPEA 3SHBA 4ZDTA 2UZGA 4F52B 3O70A 2VJFB 2D8SA 2ECIA 3PUQA 5H1TA 2CSZA 1FP0A 4S3OB 2YURA 5DINA 3EB5A 4IC3A 3L1ZB 4AUQB 4B86C 4AVXA 5J3XA 2L0BA 1RMDA 5TABA 5LKZA 2FUUA 4W4UA 2ECTA 1WEQA 2KREA 1CHCA 1E4UA 3KQIA 3T6RA 1G25A 4GNGA 5G05B 1WESA 4B7YC 3DQVR 2L43A 3N9PA 1HYJA 4R7EA 2DX8A 3PURA 5H9MA 4L58A 4IC2A 4C9ZA 5C11A 2EODA 2KU3A 2YHOA 4AYCA 3C5KA 5B76A 2MNYA 2F6JA 4AYCB
chains in the Genus database with same CATH superfamily
3KV6A 2KGGA 3VK6A 2L80A 4S3OC 4R2YA 2LGKA 5EYAF 1WEPA 2ECJA 5G0FA 2EGMA 4LKAA 4X3GA 2Y43A 3O47A 4MVTA 2LXHC 4GNFA 2K16A 4FIPA 4FJCA 3FJUB 4CCGX 2XOZA 2YQMA 1WGMA 2KWOA 2ECGA 3FANA 3N9LA 2VJEA 3ZNIA 1WEVA 2ECNA 3ZTGA 3SUBA 2I50A 3U5NA 2M85A 4UP0A 2G43A 2VPGA 2VPDA 3PHDA 2PNXA 4QQ4A 1JM7A 4Z0RA 4LJNA 1Z60A 5G04B 2FFWA 5TDRA 2G6QA 2LXPC 1MM3A 5TDWA 5FERA 3RPGB 1FBVA 1VD4A 2C2VS 3U5OA 2YREA 2FSAA 4BBQA 4YC9A 3ASLA 4BHWA 2JMJA 3EB6A 3O34A 1VFYA 4Q6FA 3N9OA 3E2DA 2CT2A 3SOUA 3ZVYA 1X4IA 3M99A 2E61A 3FEHA 5TBNA 3MHHA 1WE9A 4GNDA 2LDRA 4YAXA 3M63A 5AITA 2MA6A 4LK9A 3O7AA 3N9NA 5KH9A 2RSDA 2KE1A 1U6GB 1JOCA 1N87A 3LQJA 1T1HA 5KH3A 2XOCA 1MM2A 5AIUA 2G45A 1ZBDB 3KNVA 2LN0A 2VPEA 2KR4A 4YADA 4UI9B 2RR4A 3ZVZB 3HTKC 2HDPA 4H9DA 3O36A 1F62A 2YU4A 1DCQA 2L75A 2M13A 3RPGC 2KGIA 3C6WA 3HCSA 2H0DA 4GB0A 3U5PA 1VYXA 2LGVA 5LKUA 3V43A 2LAUA 1X4JA 4WZ3B 3L1XA 2F42A 2H0DB 2Y1MA 4QF2A 2BAYA 1BORA 2LGLA 2QICA 2JMDA 3M62A 4YATA 3T7LA 5H1VA 2KKXA 1X4UA 2VP7A 2F6NA 2OXQC 4AP4A 4YBSA 2M3HA 3M7KA 2AN6A 2KFTA 2KWJA 5SVYA 4TKPB 5B8DA 2CKLA 1DVPA 3NG2A 5KH7A 1WEWA 2VJEB 4OGEA 2ECWA 2KWNA 2P57A 3H7HA 2K17A 4O64A 4GNEA 4OGCA 3LRQA 5D1KB 3O35A 2YQLA 2M6MA 4A0CD 5FB1A 2YSMA 1WILA 1HYIA 2MT5A 1JM7B 3ZYQA 3L11A 1Z6UA 3ZPVE 2EA6A 3GL6A 3ZPV1 4A4CA 4PTBA 1WEOA 2MIQA 2EGPA 4QF3A 2OWAA 1WENA 3LVRE 4WA6A 5B79A 1WEUA 4WZ0A 2KYUA 2JM3A 3SOXA 2LRIC 2M1RA 3DDTA 2JRJA 4A49A 2MD7B 1V87A 2JMIA 3FL2A 5LKXA 4FK5A 3N9MA 2NAAA 2MD8C 5H1UA 3RTRB 4MSXA 2DJAA 3GV4A 4I7DA 4ZUXU 4FO9A 3T9KA 1IYMA 2CRWA 2LQ6A 2RI7A 4V3LC 4F1PA 5K3QA 5FB0A 5SVXA 1WFKA 1Z2QA 4I7CA 1WIMA 3LQHA 3I2DA 1WEMA 3IHPA 4R8PK 2YW8A 3KV5A 2PUYA 4YABA 2E6RA 5B75A 4I7BA 5DKAA 2MA5A 2YHNA 2LV9A 2YT5A 2MNZA 2KKYA 1LDJB 2MKEA 1K2FA 2E6SA 4WZ2A 2XOYA 2FD4A 2XEUA 2MUMA 2VPBA 3MHSA 5SVIA 2CSYA 3U5MA 5B78A 3FM8C 4A4BA 2ZETC 5D1LB 3N9QA 3MDBC 5SVIB 5C13A 2KWKA 2C2LA 4ZQLA 3LDYA 4YBMA 4N4FA 5B77A 2K1JA 2LGGA 2CONA 2K4DA 2D8UA 5JG6A 2L5UA 2QIZA 5LCWB 3HCTA 2FUIA 5LKTA 5D1MB 3JUEA 2Y1NA 2YSJA 4LLBA 2YYRA 4YBTA 2ECVA 3HCUA 2CKLB 2VNFA 3DWDA 2JUNA 3DPLR 3QZVA 3LVQE 4XI1A 2HYED 2XB1A 5TRBA 4L7XA 3FAOA 4UP5A 4N3WA 1XWHA 2KIZA 3LJUX 3O33A 4NN2A 4LADB 4CA1A 2IDAA 1WEEA 5FEYA 4P5OB 3SOWA 1LDKC 2QJ0A 3O37A 3LQIA 4V3KC 2YUCA 5I3LA 2VJFA 2CRRA 4PPEA 3SHBA 4O62A 4ZDTA 2UZGA 4F52B 3O70A 2B0OE 2VJFB 2D8SA 2EXUA 2ECIA 3PUQA 5H1TA 2CSZA 3PLWA 1FP0A 4S3OB 2YURA 5DINA 3EB5A 4IC3A 3L1ZB 4AUQB 4B86C 4Z0OA 4AVXA 2YVRA 2XP0A 5J3XA 2L0BA 1MBMA 1RMDA 5TABA 5LKZA 2FUUA 4W4UA 2ECTA 1WEQA 2KREA 1CHCA 1E4UA 3KQIA 3T6RA 1G25A 4GNGA 2DSMA 1WESA 2IQJA 5G05B 3DQVR 4B7YC 2L43A 3N9PA 1HYJA 4R7EA 2DX8A 3PURA 5H9MA 4L58A 4IC2A 4C9ZA 5C11A 2CSVA 2EODA 2KU3A 2L7PA 2YHOA 3KDEC 4AYCA 3Q1DA 3C5KA 5B76A 2MNYA 2F6JA 4AYCB
chains in the Genus database with same CATH topology
3KV6A 2KGGA 3VK6A 2L80A 4S3OC 4R2YA 2LGKA 5EYAF 1WEPA 2ECJA 5G0FA 4LKAA 4X3GA 2Y43A 4MVTA 2LXHC 4GNFA 2K16A 4FIPA 4FJCA 4CCGX 2YQMA 1WGMA 2KWOA 2ECGA 3N9LA 2VJEA 3ZNIA 1WEVA 2ECNA 3ZTGA 2I50A 3U5NA 2M85A 4UP0A 2G43A 2VPGA 2VPDA 3PHDA 2PNXA 1JM7A 4LJNA 1Z60A 5G04B 5TDRA 2G6QA 2LXPC 1MM3A 5TDWA 5FERA 3RPGB 1FBVA 1VD4A 2C2VS 3U5OA 2YREA 2FSAA 4BBQA 4YC9A 3ASLA 4BHWA 2JMJA 3EB6A 3O34A 1VFYA 4Q6FA 3N9OA 2CT2A 3SOUA 3ZVYA 1X4IA 3M99A 5TBNA 3MHHA 1WE9A 4GNDA 2LDRA 4YAXA 3M63A 5AITA 2MA6A 4LK9A 3O7AA 3N9NA 5KH9A 2RSDA 2KE1A 1U6GB 1JOCA 1N87A 3LQJA 1T1HA 5KH3A 1MM2A 5AIUA 2G45A 1ZBDB 3KNVA 2LN0A 2VPEA 2KR4A 4YADA 4UI9B 3ZVZB 3HTKC 2HDPA 3O36A 1F62A 2YU4A 2L75A 3RPGC 2KGIA 3C6WA 3HCSA 2H0DA 4GB0A 3U5PA 1VYXA 2LGVA 5LKUA 3V43A 1X4JA 4WZ3B 3L1XA 2F42A 2H0DB 2Y1MA 4QF2A 2BAYA 1BORA 2LGLA 2QICA 2JMDA 3M62A 4YATA 3T7LA 5H1VA 1X4UA 2VP7A 2F6NA 2OXQC 4AP4A 4YBSA 2M3HA 2AN6A 2KFTA 2KWJA 4TKPB 5B8DA 2CKLA 1DVPA 3NG2A 5KH7A 1WEWA 2VJEB 2ECWA 2KWNA 2K17A 4O64A 4GNEA 3LRQA 5D1KB 3O35A 2YQLA 2M6MA 4A0CD 5FB1A 2YSMA 1WILA 1HYIA 2MT5A 1JM7B 3ZYQA 3L11A 1Z6UA 3ZPVE 2EA6A 3GL6A 3ZPV1 4A4CA 4PTBA 1WEOA 2MIQA 2EGPA 4QF3A 1WENA 4WA6A 5B79A 1WEUA 4WZ0A 2KYUA 3SOXA 2LRIC 2M1RA 2JRJA 4A49A 2MD7B 1V87A 2JMIA 3FL2A 5LKXA 4FK5A 3N9MA 2NAAA 2MD8C 5H1UA 3RTRB 4MSXA 3GV4A 4I7DA 4ZUXU 4FO9A 1IYMA 2LQ6A 2RI7A 4V3LC 5FB0A 1WFKA 1Z2QA 4I7CA 1WIMA 3LQHA 3I2DA 1WEMA 3IHPA 4R8PK 2YW8A 3KV5A 2PUYA 4YABA 2E6RA 5B75A 4I7BA 5DKAA 2MA5A 2YHNA 2LV9A 2YT5A 2MNZA 1LDJB 1K2FA 2E6SA 4WZ2A 2XEUA 2MUMA 2VPBA 3MHSA 2CSYA 3U5MA 5B78A 4A4BA 2ZETC 5D1LB 3N9QA 5C13A 2KWKA 2C2LA 4ZQLA 4YBMA 4N4FA 5B77A 2K1JA 2LGGA 2K4DA 5JG6A 2L5UA 2QIZA 5LCWB 3HCTA 2FUIA 5LKTA 5D1MB 2Y1NA 2YSJA 4LLBA 2YYRA 4YBTA 2ECVA 3HCUA 2CKLB 2VNFA 3DPLR 3QZVA 4XI1A 2HYED 2XB1A 5TRBA 4L7XA 4UP5A 4N3WA 1XWHA 2KIZA 3O33A 4NN2A 4LADB 4CA1A 2IDAA 1WEEA 5FEYA 4P5OB 3SOWA 1LDKC 2QJ0A 3O37A 3LQIA 4V3KC 2YUCA 5I3LA 2VJFA 4PPEA 3SHBA 4ZDTA 2UZGA 4F52B 3O70A 2VJFB 2D8SA 2ECIA 3PUQA 5H1TA 2CSZA 1FP0A 4S3OB 2YURA 5DINA 3EB5A 4IC3A 3L1ZB 4AUQB 4B86C 4AVXA 5J3XA 2L0BA 1RMDA 5TABA 5LKZA 2FUUA 4W4UA 2ECTA 1WEQA 2KREA 1CHCA 1E4UA 3KQIA 3T6RA 1G25A 4GNGA 5G05B 1WESA 4B7YC 3DQVR 2L43A 3N9PA 1HYJA 4R7EA 2DX8A 3PURA 5H9MA 4L58A 4IC2A 4C9ZA 5C11A 2EODA 2KU3A 2YHOA 4AYCA 3C5KA 5B76A 2MNYA 2F6JA 4AYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV6 A;  2KGG A;  3VK6 A;  2L80 A;  4S3O C;  4R2Y A;  2LGK A;  5EYA F;  1WEP A;  2ECJ A;  5G0F A;  4LKA A;  4X3G A;  2Y43 A;  4MVT A;  2LXH C;  4GNF A;  2K16 A;  4FIP A;  4FJC A;  4CCG X;  2YQM A;  1WGM A;  2KWO A;  2ECG A;  3N9L A;  2VJE A;  3ZNI A;  1WEV A;  2ECN A;  3ZTG A;  2I50 A;  3U5N A;  2M85 A;  4UP0 A;  2G43 A;  2VPG A;  2VPD A;  3PHD A;  2PNX A;  1JM7 A;  4LJN A;  1Z60 A;  5G04 B;  5TDR A;  2G6Q A;  2LXP C;  1MM3 A;  5TDW A;  5FER A;  3RPG B;  1FBV A;  1VD4 A;  2C2V S;  3U5O A;  2YRE A;  2FSA A;  4BBQ A;  4YC9 A;  3ASL A;  4BHW A;  2JMJ A;  3EB6 A;  3O34 A;  1VFY A;  4Q6F A;  3N9O A;  2CT2 A;  3SOU A;  3ZVY A;  1X4I A;  3M99 A;  5TBN A;  3MHH A;  1WE9 A;  4GND A;  2LDR A;  4YAX A;  3M63 A;  5AIT A;  2MA6 A;  4LK9 A;  3O7A A;  3N9N A;  5KH9 A;  2RSD A;  2KE1 A;  1U6G B;  1JOC A;  1N87 A;  3LQJ A;  1T1H A;  5KH3 A;  1MM2 A;  5AIU A;  2G45 A;  1ZBD B;  3KNV A;  2LN0 A;  2VPE A;  2KR4 A;  4YAD A;  4UI9 B;  3ZVZ B;  3HTK C;  2HDP A;  3O36 A;  1F62 A;  2YU4 A;  2L75 A;  3RPG C;  2KGI A;  3C6W A;  3HCS A;  2H0D A;  4GB0 A;  3U5P A;  1VYX A;  2LGV A;  5LKU A;  3V43 A;  1X4J A;  4WZ3 B;  3L1X A;  2F42 A;  2H0D B;  2Y1M A;  4QF2 A;  2BAY A;  1BOR A;  2LGL A;  2QIC A;  2JMD A;  3M62 A;  4YAT A;  3T7L A;  5H1V A;  1X4U A;  2VP7 A;  2F6N A;  2OXQ C;  4AP4 A;  4YBS A;  2M3H A;  2AN6 A;  2KFT A;  2KWJ A;  4TKP B;  5B8D A;  2CKL A;  1DVP A;  3NG2 A;  5KH7 A;  1WEW A;  2VJE B;  2ECW A;  2KWN A;  2K17 A;  4O64 A;  4GNE A;  3LRQ A;  5D1K B;  3O35 A;  2YQL A;  2M6M A;  4A0C D;  5FB1 A;  2YSM A;  1WIL A;  1HYI A;  2MT5 A;  1JM7 B;  3ZYQ A;  3L11 A;  1Z6U A;  3ZPV E;  2EA6 A;  3GL6 A;  3ZPV 1;  4A4C A;  4PTB A;  1WEO A;  2MIQ A;  2EGP A;  4QF3 A;  1WEN A;  4WA6 A;  5B79 A;  1WEU A;  4WZ0 A;  2KYU A;  3SOX A;  2LRI C;  2M1R A;  2JRJ A;  4A49 A;  2MD7 B;  1V87 A;  2JMI A;  3FL2 A;  5LKX A;  4FK5 A;  3N9M A;  2NAA A;  2MD8 C;  5H1U A;  3RTR B;  4MSX A;  3GV4 A;  4I7D A;  4ZUX U;  4FO9 A;  1IYM A;  2LQ6 A;  2RI7 A;  4V3L C;  5FB0 A;  1WFK A;  1Z2Q A;  4I7C A;  1WIM A;  3LQH A;  3I2D A;  1WEM A;  3IHP A;  4R8P K;  2YW8 A;  3KV5 A;  2PUY A;  4YAB A;  2E6R A;  5B75 A;  4I7B A;  5DKA A;  2MA5 A;  2YHN A;  2LV9 A;  2YT5 A;  2MNZ A;  1LDJ B;  1K2F A;  2E6S A;  4WZ2 A;  2XEU A;  2MUM A;  2VPB A;  3MHS A;  2CSY A;  3U5M A;  5B78 A;  4A4B A;  2ZET C;  5D1L B;  3N9Q A;  5C13 A;  2KWK A;  2C2L A;  4ZQL A;  4YBM A;  4N4F A;  5B77 A;  2K1J A;  2LGG A;  2K4D A;  5JG6 A;  2L5U A;  2QIZ A;  5LCW B;  3HCT A;  2FUI A;  5LKT A;  5D1M B;  2Y1N A;  2YSJ A;  4LLB A;  2YYR A;  4YBT A;  2ECV A;  3HCU A;  2CKL B;  2VNF A;  3DPL R;  3QZV A;  4XI1 A;  2HYE D;  2XB1 A;  5TRB A;  4L7X A;  4UP5 A;  4N3W A;  1XWH A;  2KIZ A;  3O33 A;  4NN2 A;  4LAD B;  4CA1 A;  2IDA A;  1WEE A;  5FEY A;  4P5O B;  3SOW A;  1LDK C;  2QJ0 A;  3O37 A;  3LQI A;  4V3K C;  2YUC A;  5I3L A;  2VJF A;  4PPE A;  3SHB A;  4ZDT A;  2UZG A;  4F52 B;  3O70 A;  2VJF B;  2D8S A;  2ECI A;  3PUQ A;  5H1T A;  2CSZ A;  1FP0 A;  4S3O B;  2YUR A;  5DIN A;  3EB5 A;  4IC3 A;  3L1Z B;  4AUQ B;  4B86 C;  4AVX A;  5J3X A;  2L0B A;  1RMD A;  5TAB A;  5LKZ A;  2FUU A;  4W4U A;  2ECT A;  1WEQ A;  2KRE A;  1CHC A;  1E4U A;  3KQI A;  3T6R A;  1G25 A;  4GNG A;  5G05 B;  1WES A;  4B7Y C;  3DQV R;  2L43 A;  3N9P A;  1HYJ A;  4R7E A;  2DX8 A;  3PUR A;  5H9M A;  4L58 A;  4IC2 A;  4C9Z A;  5C11 A;  2EOD A;  2KU3 A;  2YHO A;  4AYC A;  3C5K A;  5B76 A;  2MNY A;  2F6J A;  4AYC B; 
#chains in the Genus database with same CATH topology
 3KV6 A;  2KGG A;  3VK6 A;  2L80 A;  4S3O C;  4R2Y A;  2LGK A;  5EYA F;  1WEP A;  2ECJ A;  5G0F A;  2EGM A;  4LKA A;  4X3G A;  2Y43 A;  3O47 A;  4MVT A;  2LXH C;  4GNF A;  2K16 A;  4FIP A;  4FJC A;  3FJU B;  4CCG X;  2XOZ A;  2YQM A;  1WGM A;  2KWO A;  2ECG A;  3FAN A;  3N9L A;  2VJE A;  3ZNI A;  1WEV A;  2ECN A;  3ZTG A;  3SUB A;  2I50 A;  3U5N A;  2M85 A;  4UP0 A;  2G43 A;  2VPG A;  2VPD A;  3PHD A;  2PNX A;  4QQ4 A;  1JM7 A;  4Z0R A;  4LJN A;  1Z60 A;  5G04 B;  2FFW A;  5TDR A;  2G6Q A;  2LXP C;  1MM3 A;  5TDW A;  5FER A;  3RPG B;  1FBV A;  1VD4 A;  2C2V S;  3U5O A;  2YRE A;  2FSA A;  4BBQ A;  4YC9 A;  3ASL A;  4BHW A;  2JMJ A;  3EB6 A;  3O34 A;  1VFY A;  4Q6F A;  3N9O A;  3E2D A;  2CT2 A;  3SOU A;  3ZVY A;  1X4I A;  3M99 A;  2E61 A;  3FEH A;  5TBN A;  3MHH A;  1WE9 A;  4GND A;  2LDR A;  4YAX A;  3M63 A;  5AIT A;  2MA6 A;  4LK9 A;  3O7A A;  3N9N A;  5KH9 A;  2RSD A;  2KE1 A;  1U6G B;  1JOC A;  1N87 A;  3LQJ A;  1T1H A;  5KH3 A;  2XOC A;  1MM2 A;  5AIU A;  2G45 A;  1ZBD B;  3KNV A;  2LN0 A;  2VPE A;  2KR4 A;  4YAD A;  4UI9 B;  2RR4 A;  3ZVZ B;  3HTK C;  2HDP A;  4H9D A;  3O36 A;  1F62 A;  2YU4 A;  1DCQ A;  2L75 A;  2M13 A;  3RPG C;  2KGI A;  3C6W A;  3HCS A;  2H0D A;  4GB0 A;  3U5P A;  1VYX A;  2LGV A;  5LKU A;  3V43 A;  2LAU A;  1X4J A;  4WZ3 B;  3L1X A;  2F42 A;  2H0D B;  2Y1M A;  4QF2 A;  2BAY A;  1BOR A;  2LGL A;  2QIC A;  2JMD A;  3M62 A;  4YAT A;  3T7L A;  5H1V A;  2KKX A;  1X4U A;  2VP7 A;  2F6N A;  2OXQ C;  4AP4 A;  4YBS A;  2M3H A;  3M7K A;  2AN6 A;  2KFT A;  2KWJ A;  5SVY A;  4TKP B;  5B8D A;  2CKL A;  1DVP A;  3NG2 A;  5KH7 A;  1WEW A;  2VJE B;  4OGE A;  2ECW A;  2KWN A;  2P57 A;  3H7H A;  2K17 A;  4O64 A;  4GNE A;  4OGC A;  3LRQ A;  5D1K B;  3O35 A;  2YQL A;  2M6M A;  4A0C D;  5FB1 A;  2YSM A;  1WIL A;  1HYI A;  2MT5 A;  1JM7 B;  3ZYQ A;  3L11 A;  1Z6U A;  3ZPV E;  2EA6 A;  3GL6 A;  3ZPV 1;  4A4C A;  4PTB A;  1WEO A;  2MIQ A;  2EGP A;  4QF3 A;  2OWA A;  1WEN A;  3LVR E;  4WA6 A;  5B79 A;  1WEU A;  4WZ0 A;  2KYU A;  2JM3 A;  3SOX A;  2LRI C;  2M1R A;  3DDT A;  2JRJ A;  4A49 A;  2MD7 B;  1V87 A;  2JMI A;  3FL2 A;  5LKX A;  4FK5 A;  3N9M A;  2NAA A;  2MD8 C;  5H1U A;  3RTR B;  4MSX A;  2DJA A;  3GV4 A;  4I7D A;  4ZUX U;  4FO9 A;  3T9K A;  1IYM A;  2CRW A;  2LQ6 A;  2RI7 A;  4V3L C;  4F1P A;  5K3Q A;  5FB0 A;  5SVX A;  1WFK A;  1Z2Q A;  4I7C A;  1WIM A;  3LQH A;  3I2D A;  1WEM A;  3IHP A;  4R8P K;  2YW8 A;  3KV5 A;  2PUY A;  4YAB A;  2E6R A;  5B75 A;  4I7B A;  5DKA A;  2MA5 A;  2YHN A;  2LV9 A;  2YT5 A;  2MNZ A;  2KKY A;  1LDJ B;  2MKE A;  1K2F A;  2E6S A;  4WZ2 A;  2XOY A;  2FD4 A;  2XEU A;  2MUM A;  2VPB A;  3MHS A;  5SVI A;  2CSY A;  3U5M A;  5B78 A;  3FM8 C;  4A4B A;  2ZET C;  5D1L B;  3N9Q A;  3MDB C;  5SVI B;  5C13 A;  2KWK A;  2C2L A;  4ZQL A;  3LDY A;  4YBM A;  4N4F A;  5B77 A;  2K1J A;  2LGG A;  2CON A;  2K4D A;  2D8U A;  5JG6 A;  2L5U A;  2QIZ A;  5LCW B;  3HCT A;  2FUI A;  5LKT A;  5D1M B;  3JUE A;  2Y1N A;  2YSJ A;  4LLB A;  2YYR A;  4YBT A;  2ECV A;  3HCU A;  2CKL B;  2VNF A;  3DWD A;  2JUN A;  3DPL R;  3QZV A;  3LVQ E;  4XI1 A;  2HYE D;  2XB1 A;  5TRB A;  4L7X A;  3FAO A;  4UP5 A;  4N3W A;  1XWH A;  2KIZ A;  3LJU X;  3O33 A;  4NN2 A;  4LAD B;  4CA1 A;  2IDA A;  1WEE A;  5FEY A;  4P5O B;  3SOW A;  1LDK C;  2QJ0 A;  3O37 A;  3LQI A;  4V3K C;  2YUC A;  5I3L A;  2VJF A;  2CRR A;  4PPE A;  3SHB A;  4O62 A;  4ZDT A;  2UZG A;  4F52 B;  3O70 A;  2B0O E;  2VJF B;  2D8S A;  2EXU A;  2ECI A;  3PUQ A;  5H1T A;  2CSZ A;  3PLW A;  1FP0 A;  4S3O B;  2YUR A;  5DIN A;  3EB5 A;  4IC3 A;  3L1Z B;  4AUQ B;  4B86 C;  4Z0O A;  4AVX A;  2YVR A;  2XP0 A;  5J3X A;  2L0B A;  1MBM A;  1RMD A;  5TAB A;  5LKZ A;  2FUU A;  4W4U A;  2ECT A;  1WEQ A;  2KRE A;  1CHC A;  1E4U A;  3KQI A;  3T6R A;  1G25 A;  4GNG A;  2DSM A;  1WES A;  2IQJ A;  5G05 B;  3DQV R;  4B7Y C;  2L43 A;  3N9P A;  1HYJ A;  4R7E A;  2DX8 A;  3PUR A;  5H9M A;  4L58 A;  4IC2 A;  4C9Z A;  5C11 A;  2CSV A;  2EOD A;  2KU3 A;  2L7P A;  2YHO A;  3KDE C;  4AYC A;  3Q1D A;  3C5K A;  5B76 A;  2MNY A;  2F6J A;  4AYC B; 
#chains in the Genus database with same CATH homology
 3KV6 A;  2KGG A;  3VK6 A;  2L80 A;  4S3O C;  4R2Y A;  2LGK A;  5EYA F;  1WEP A;  2ECJ A;  5G0F A;  4LKA A;  4X3G A;  2Y43 A;  4MVT A;  2LXH C;  4GNF A;  2K16 A;  4FIP A;  4FJC A;  4CCG X;  2YQM A;  1WGM A;  2KWO A;  2ECG A;  3N9L A;  2VJE A;  3ZNI A;  1WEV A;  2ECN A;  3ZTG A;  2I50 A;  3U5N A;  2M85 A;  4UP0 A;  2G43 A;  2VPG A;  2VPD A;  3PHD A;  2PNX A;  1JM7 A;  4LJN A;  1Z60 A;  5G04 B;  5TDR A;  2G6Q A;  2LXP C;  1MM3 A;  5TDW A;  5FER A;  3RPG B;  1FBV A;  1VD4 A;  2C2V S;  3U5O A;  2YRE A;  2FSA A;  4BBQ A;  4YC9 A;  3ASL A;  4BHW A;  2JMJ A;  3EB6 A;  3O34 A;  1VFY A;  4Q6F A;  3N9O A;  2CT2 A;  3SOU A;  3ZVY A;  1X4I A;  3M99 A;  5TBN A;  3MHH A;  1WE9 A;  4GND A;  2LDR A;  4YAX A;  3M63 A;  5AIT A;  2MA6 A;  4LK9 A;  3O7A A;  3N9N A;  5KH9 A;  2RSD A;  2KE1 A;  1U6G B;  1JOC A;  1N87 A;  3LQJ A;  1T1H A;  5KH3 A;  1MM2 A;  5AIU A;  2G45 A;  1ZBD B;  3KNV A;  2LN0 A;  2VPE A;  2KR4 A;  4YAD A;  4UI9 B;  3ZVZ B;  3HTK C;  2HDP A;  3O36 A;  1F62 A;  2YU4 A;  2L75 A;  3RPG C;  2KGI A;  3C6W A;  3HCS A;  2H0D A;  4GB0 A;  3U5P A;  1VYX A;  2LGV A;  5LKU A;  3V43 A;  1X4J A;  4WZ3 B;  3L1X A;  2F42 A;  2H0D B;  2Y1M A;  4QF2 A;  2BAY A;  1BOR A;  2LGL A;  2QIC A;  2JMD A;  3M62 A;  4YAT A;  3T7L A;  5H1V A;  1X4U A;  2VP7 A;  2F6N A;  2OXQ C;  4AP4 A;  4YBS A;  2M3H A;  2AN6 A;  2KFT A;  2KWJ A;  4TKP B;  5B8D A;  2CKL A;  1DVP A;  3NG2 A;  5KH7 A;  1WEW A;  2VJE B;  2ECW A;  2KWN A;  2K17 A;  4O64 A;  4GNE A;  3LRQ A;  5D1K B;  3O35 A;  2YQL A;  2M6M A;  4A0C D;  5FB1 A;  2YSM A;  1WIL A;  1HYI A;  2MT5 A;  1JM7 B;  3ZYQ A;  3L11 A;  1Z6U A;  3ZPV E;  2EA6 A;  3GL6 A;  3ZPV 1;  4A4C A;  4PTB A;  1WEO A;  2MIQ A;  2EGP A;  4QF3 A;  1WEN A;  4WA6 A;  5B79 A;  1WEU A;  4WZ0 A;  2KYU A;  3SOX A;  2LRI C;  2M1R A;  2JRJ A;  4A49 A;  2MD7 B;  1V87 A;  2JMI A;  3FL2 A;  5LKX A;  4FK5 A;  3N9M A;  2NAA A;  2MD8 C;  5H1U A;  3RTR B;  4MSX A;  3GV4 A;  4I7D A;  4ZUX U;  4FO9 A;  1IYM A;  2LQ6 A;  2RI7 A;  4V3L C;  5FB0 A;  1WFK A;  1Z2Q A;  4I7C A;  1WIM A;  3LQH A;  3I2D A;  1WEM A;  3IHP A;  4R8P K;  2YW8 A;  3KV5 A;  2PUY A;  4YAB A;  2E6R A;  5B75 A;  4I7B A;  5DKA A;  2MA5 A;  2YHN A;  2LV9 A;  2YT5 A;  2MNZ A;  1LDJ B;  1K2F A;  2E6S A;  4WZ2 A;  2XEU A;  2MUM A;  2VPB A;  3MHS A;  2CSY A;  3U5M A;  5B78 A;  4A4B A;  2ZET C;  5D1L B;  3N9Q A;  5C13 A;  2KWK A;  2C2L A;  4ZQL A;  4YBM A;  4N4F A;  5B77 A;  2K1J A;  2LGG A;  2K4D A;  5JG6 A;  2L5U A;  2QIZ A;  5LCW B;  3HCT A;  2FUI A;  5LKT A;  5D1M B;  2Y1N A;  2YSJ A;  4LLB A;  2YYR A;  4YBT A;  2ECV A;  3HCU A;  2CKL B;  2VNF A;  3DPL R;  3QZV A;  4XI1 A;  2HYE D;  2XB1 A;  5TRB A;  4L7X A;  4UP5 A;  4N3W A;  1XWH A;  2KIZ A;  3O33 A;  4NN2 A;  4LAD B;  4CA1 A;  2IDA A;  1WEE A;  5FEY A;  4P5O B;  3SOW A;  1LDK C;  2QJ0 A;  3O37 A;  3LQI A;  4V3K C;  2YUC A;  5I3L A;  2VJF A;  4PPE A;  3SHB A;  4ZDT A;  2UZG A;  4F52 B;  3O70 A;  2VJF B;  2D8S A;  2ECI A;  3PUQ A;  5H1T A;  2CSZ A;  1FP0 A;  4S3O B;  2YUR A;  5DIN A;  3EB5 A;  4IC3 A;  3L1Z B;  4AUQ B;  4B86 C;  4AVX A;  5J3X A;  2L0B A;  1RMD A;  5TAB A;  5LKZ A;  2FUU A;  4W4U A;  2ECT A;  1WEQ A;  2KRE A;  1CHC A;  1E4U A;  3KQI A;  3T6R A;  1G25 A;  4GNG A;  5G05 B;  1WES A;  4B7Y C;  3DQV R;  2L43 A;  3N9P A;  1HYJ A;  4R7E A;  2DX8 A;  3PUR A;  5H9M A;  4L58 A;  4IC2 A;  4C9Z A;  5C11 A;  2EOD A;  2KU3 A;  2YHO A;  4AYC A;  3C5K A;  5B76 A;  2MNY A;  2F6J A;  4AYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...