2YSMA

Solution structure of the second and third phd domain from histone-lysine n-methyltransferase 2c (kmt2c/mll3)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
111
structure length
111
Chain Sequence
GSSGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
publication title Solution structure of the first and second PHD domain from Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog
rcsb
source organism Homo sapiens
total genus 7
structure length 111
sequence length 111
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ysmA00
1WIMA 3EB6A 3M62A 2YQMA 2H0DB 4R8PK 4IC2A 1IYMA 2QIZA 2XEUA 3SOWA 1Z6UA 1WESA 2LGVA 3U5MA 5TRBA 2D8SA 4ZUXU 5H1TA 3O36A 1Z60A 4FIPA 3KV5A 4NN2A 2C2LA 1WEUA 2ECTA 3RPGC 2YHNA 4R2YA 1MM2A 2NAAA 4S3OC 2K4DA 3FL2A 3ZPV1 2LRIC 2LGLA 2L75A 2UZGA 1T1HA 3LRQA 4L58A 2K1JA 4A4BA 4YBSA 2QJ0A 3SOUA 3DQVR 5H1UA 5D1LB 2F42A 2L80A 3KQIA 1G25A 3C6WA 4QF2A 2G6QA 4ZQLA 5LCWB 3T7LA 2CSZA 5JG6A 1ZBDB 2YSJA 2Y1MA 5I3LA 2C2VS 4Q6FA 2I50A 4WZ3B 2M6MA 2MD7B 2K16A 2FUUA 2PUYA 4XI1A 2ECNA 5AIUA 2VPGA 5FB0A 2CSYA 3O35A 3ZVYA 5B79A 4QF3A 2OXQC 4LJNA 3V43A 3MHSA 5FEYA 2L43A 4B7YC 2F6JA 3SHBA 5D1KB 4LADB 4A4CA 4FJCA 3O34A 2LGGA 3N9OA 5LKZA 4LKAA 2MA5A 4AVXA 2G43A 1VYXA 1FP0A 4WZ2A 5DKAA 3C5KA 2LN0A 5DINA 2FUIA 2KWNA 2CT2A 2VPBA 3ZNIA 2JRJA 1X4IA 4V3KC 3N9MA 2KU3A 4I7DA 5H9MA 3VK6A 2VJFA 1WEOA 1Z2QA 3RTRB 4W4UA 4IC3A 2YREA 2HYED 5KH7A 2RI7A 5LKXA 4X3GA 1WE9A 3O33A 2MT5A 4UP0A 5KH3A 3M63A 2LV9A 5B76A 1XWHA 2RSDA 1JOCA 2G45A 4A49A 5B78A 3O70A 2KR4A 3L1XA 1VD4A 5G0FA 5B8DA 2MNZA 2YYRA 5C11A 2VPEA 5B77A 3N9PA 4UI9B 3T6RA 2MUMA 4FO9A 5KH9A 1DVPA 1K2FA 2LQ6A 3PHDA 2VP7A 3HCUA 2LDRA 3GL6A 2ECGA 1JM7A 3LQHA 4CCGX 1WILA 3KNVA 4L7XA 4MSXA 2LGKA 2FSAA 4YBTA 2ECVA 2M85A 4YC9A 2MD8C 1WEPA 4YABA 3RPGB 2KWOA 2ECIA 4O64A 4GNFA 4S3OB 2YURA 5TDRA 2VJFB 3ZPVE 2ECJA 3U5PA 4PTBA 2YSMA 4FK5A 1RMDA 4LLBA 2YU4A 2ECWA 2EGPA 3O7AA 4I7BA 1F62A 4A0CD 2YT5A 2MNYA 5TDWA 1HYJA 3NG2A 3KV6A 3SOXA 2VPDA 4AUQB 2KWJA 3LQIA 4LK9A 2KE1A 4GNEA 2ZETC 4BHWA 1FBVA 3N9QA 2CKLA 2QICA 3HCSA 4YBMA 3U5NA 1WFKA 2KWKA 3LQJA 3PUQA 1LDJB 2KYUA 3MHHA 2MIQA 1CHCA 5G05B 2YW8A 1HYIA 2KGGA 3L1ZB 5B75A 2VNFA 2YQLA 1JM7B 2KIZA 2JMDA 2AN6A 1VFYA 5FERA 4GB0A 2L5UA 5J3XA 2HDPA 5D1MB 2BAYA 2K17A 2JMIA 1WEQA 4F52B 1WGMA 3I2DA 2DX8A 4UP5A 4PPEA 5LKUA 2VJEA 3ZYQA 3ZTGA 3L11A 2LXHC 4YATA 3N9NA 3IHPA 1X4UA 3O37A 4GNDA 5H1VA 4AYCA 2IDAA 3EB5A 4P5OB 5TBNA 1X4JA 2F6NA 4WA6A 3PURA 1N87A 4C9ZA 4WZ0A 2Y43A 2H0DA 5AITA 2CKLB 2E6SA 4AP4A 5FB1A 3ZVZB 2Y1NA 4YADA 2M3HA 3M99A 4MVTA 1E4UA 4N3WA 2YUCA 1WEMA 1U6GB 2KGIA 5EYAF 4ZDTA 3HCTA 2KFTA 4GNGA 2E6RA 2EODA 2JMJA 2L0BA 3GV4A 4I7CA 4V3LC 1BORA 4R7EA 2KREA 4BBQA 5TABA 1WEWA 1MM3A 2XB1A 2YHOA 1WEEA 1V87A 5LKTA 2LXPC 3DPLR 2MA6A 3ASLA 1WEVA 5C13A 2VJEB 2M1RA 1LDKC 3U5OA 1WENA 4N4FA 2PNXA 4B86C 2EA6A 4CA1A 4YAXA 3QZVA 3N9LA 5G04B 4TKPB 4AYCB 3HTKC
chains in the Genus database with same CATH superfamily
1WIMA 3EB6A 3M62A 2YQMA 2H0DB 4R8PK 4IC2A 1IYMA 2QIZA 2XEUA 3JUEA 3SOWA 1Z6UA 1WESA 2LGVA 3U5MA 2RR4A 5TRBA 2D8SA 4ZUXU 5H1TA 3O36A 1Z60A 4FIPA 3KV5A 4NN2A 2C2LA 1WEUA 2ECTA 3RPGC 2P57A 2YHNA 4R2YA 1MM2A 3FM8C 2NAAA 4S3OC 2K4DA 3FL2A 3ZPV1 3T9KA 2LRIC 2LGLA 2L75A 2UZGA 1T1HA 2CONA 3LRQA 4L58A 2K1JA 4A4BA 3E2DA 4YBSA 2QJ0A 3SOUA 3DQVR 5H1UA 5D1LB 2F42A 2L80A 3KQIA 1G25A 3C6WA 3FJUB 4O62A 4QF2A 2G6QA 4ZQLA 5LCWB 3T7LA 2CSZA 5JG6A 1ZBDB 2YSJA 2Y1MA 5I3LA 2C2VS 4Q6FA 2I50A 3Q1DA 4WZ3B 2M6MA 2MD7B 2K16A 2FUUA 2PUYA 4XI1A 2ECNA 4OGEA 5AIUA 2VPGA 2XOZA 5FB0A 2CSYA 3O35A 5SVYA 3ZVYA 5B79A 4QF3A 2OXQC 3LVRE 4LJNA 3V43A 3MHSA 1DCQA 5FEYA 3FAOA 2L43A 4B7YC 2F6JA 2CRRA 3SHBA 5D1KB 4LADB 4A4CA 4FJCA 3O34A 2LGGA 3N9OA 5LKZA 4LKAA 2MA5A 4AVXA 2G43A 3LDYA 1VYXA 1FP0A 4WZ2A 5DKAA 3C5KA 3SUBA 2LN0A 2JM3A 3KDEC 3O47A 5DINA 2FUIA 2KWNA 2CT2A 2VPBA 3ZNIA 2JRJA 1X4IA 4V3KC 3N9MA 2KU3A 4I7DA 5H9MA 3VK6A 3PLWA 2VJFA 1WEOA 1Z2QA 2JUNA 3RTRB 4W4UA 4IC3A 2YREA 2CRWA 2HYED 2FFWA 5KH7A 2RI7A 5LKXA 4X3GA 1WE9A 3O33A 2MT5A 4UP0A 5KH3A 3M63A 2LV9A 5B76A 1XWHA 2RSDA 1JOCA 2G45A 4A49A 5B78A 3O70A 2KR4A 3L1XA 1VD4A 5G0FA 5B8DA 2MNZA 2YYRA 2FD4A 5C11A 2VPEA 5B77A 3N9PA 4UI9B 4F1PA 2KKXA 3T6RA 2IQJA 2OWAA 2MUMA 4FO9A 5KH9A 1DVPA 1K2FA 2LQ6A 3PHDA 2VP7A 3HCUA 2LDRA 3GL6A 2KKYA 2ECGA 1JM7A 3LQHA 4CCGX 1WILA 3KNVA 4L7XA 4MSXA 4OGCA 2LGKA 2FSAA 3LJUX 4YBTA 2ECVA 2M85A 3H7HA 4YC9A 2EXUA 2MD8C 1WEPA 4YABA 3RPGB 2KWOA 2ECIA 4O64A 4GNFA 4S3OB 2YURA 5TDRA 2VJFB 3ZPVE 2ECJA 3U5PA 4PTBA 2YSMA 4FK5A 1RMDA 4LLBA 2YU4A 2ECWA 2EGPA 3O7AA 4I7BA 1F62A 4A0CD 2EGMA 2YT5A 3FANA 2MNYA 5TDWA 1HYJA 3NG2A 2DJAA 3KV6A 3SOXA 2VPDA 4AUQB 2KWJA 3LQIA 2M13A 4LK9A 2KE1A 4GNEA 2ZETC 3LVQE 5SVIB 4BHWA 1FBVA 3N9QA 2D8UA 2CKLA 2QICA 3HCSA 4YBMA 3U5NA 1WFKA 2KWKA 3LQJA 3PUQA 4Z0RA 1LDJB 2KYUA 3MHHA 4QQ4A 2MIQA 1CHCA 2MKEA 5G05B 2YW8A 1HYIA 2KGGA 3L1ZB 2DSMA 5B75A 2VNFA 2YQLA 1JM7B 2KIZA 2JMDA 2AN6A 1VFYA 5FERA 4GB0A 2L5UA 5J3XA 2HDPA 1MBMA 5D1MB 2BAYA 2K17A 2JMIA 2YVRA 1WEQA 5SVIA 4F52B 1WGMA 3I2DA 2DX8A 4UP5A 4PPEA 5LKUA 4Z0OA 2VJEA 3ZYQA 3ZTGA 3L11A 2LXHC 4YATA 3N9NA 3IHPA 1X4UA 3DWDA 3O37A 4GNDA 2XOYA 5K3QA 5H1VA 4AYCA 2IDAA 3EB5A 4P5OB 4H9DA 5TBNA 1X4JA 2F6NA 4WA6A 3PURA 1N87A 2E61A 4C9ZA 4WZ0A 2Y43A 2H0DA 5AITA 2CKLB 2E6SA 4AP4A 5FB1A 3ZVZB 2Y1NA 4YADA 2M3HA 3M99A 4MVTA 1E4UA 2L7PA 5SVXA 4N3WA 2YUCA 3M7KA 1WEMA 1U6GB 2KGIA 5EYAF 3HCTA 4ZDTA 2KFTA 4GNGA 2E6RA 2EODA 2JMJA 2L0BA 3GV4A 4I7CA 4V3LC 1BORA 4R7EA 3DDTA 2KREA 4BBQA 5TABA 1WEWA 1MM3A 2XB1A 2YHOA 1WEEA 1V87A 2LAUA 5LKTA 2LXPC 2XOCA 3DPLR 2MA6A 3ASLA 3FEHA 1WEVA 5C13A 2VJEB 2M1RA 1LDKC 3U5OA 3MDBC 1WENA 4N4FA 2B0OE 2XP0A 2PNXA 4B86C 2EA6A 4CA1A 4YAXA 3QZVA 3N9LA 5G04B 4TKPB 2CSVA 4AYCB 3HTKC
chains in the Genus database with same CATH topology
1WIMA 3EB6A 3M62A 2YQMA 2H0DB 4R8PK 4IC2A 1IYMA 2QIZA 2XEUA 3SOWA 1Z6UA 1WESA 2LGVA 3U5MA 5TRBA 2D8SA 4ZUXU 5H1TA 3O36A 1Z60A 4FIPA 3KV5A 4NN2A 2C2LA 1WEUA 2ECTA 3RPGC 2YHNA 4R2YA 1MM2A 2NAAA 4S3OC 2K4DA 3FL2A 3ZPV1 2LRIC 2LGLA 2L75A 2UZGA 1T1HA 3LRQA 4L58A 2K1JA 4A4BA 4YBSA 2QJ0A 3SOUA 3DQVR 5H1UA 5D1LB 2F42A 2L80A 3KQIA 1G25A 3C6WA 4QF2A 2G6QA 4ZQLA 5LCWB 3T7LA 2CSZA 5JG6A 1ZBDB 2YSJA 2Y1MA 5I3LA 2C2VS 4Q6FA 2I50A 4WZ3B 2M6MA 2MD7B 2K16A 2FUUA 2PUYA 4XI1A 2ECNA 5AIUA 2VPGA 5FB0A 2CSYA 3O35A 3ZVYA 5B79A 4QF3A 2OXQC 4LJNA 3V43A 3MHSA 5FEYA 2L43A 4B7YC 2F6JA 3SHBA 5D1KB 4LADB 4A4CA 4FJCA 3O34A 2LGGA 3N9OA 5LKZA 4LKAA 2MA5A 4AVXA 2G43A 1VYXA 1FP0A 4WZ2A 5DKAA 3C5KA 2LN0A 5DINA 2FUIA 2KWNA 2CT2A 2VPBA 3ZNIA 2JRJA 1X4IA 4V3KC 3N9MA 2KU3A 4I7DA 5H9MA 3VK6A 2VJFA 1WEOA 1Z2QA 3RTRB 4W4UA 4IC3A 2YREA 2HYED 5KH7A 2RI7A 5LKXA 4X3GA 1WE9A 3O33A 2MT5A 4UP0A 5KH3A 3M63A 2LV9A 5B76A 1XWHA 2RSDA 1JOCA 2G45A 4A49A 5B78A 3O70A 2KR4A 3L1XA 1VD4A 5G0FA 5B8DA 2MNZA 2YYRA 5C11A 2VPEA 5B77A 3N9PA 4UI9B 3T6RA 2MUMA 4FO9A 5KH9A 1DVPA 1K2FA 2LQ6A 3PHDA 2VP7A 3HCUA 2LDRA 3GL6A 2ECGA 1JM7A 3LQHA 4CCGX 1WILA 3KNVA 4L7XA 4MSXA 2LGKA 2FSAA 4YBTA 2ECVA 2M85A 4YC9A 2MD8C 1WEPA 4YABA 3RPGB 2KWOA 2ECIA 4O64A 4GNFA 4S3OB 2YURA 5TDRA 2VJFB 3ZPVE 2ECJA 3U5PA 4PTBA 2YSMA 4FK5A 1RMDA 4LLBA 2YU4A 2ECWA 2EGPA 3O7AA 4I7BA 1F62A 4A0CD 2YT5A 2MNYA 5TDWA 1HYJA 3NG2A 3KV6A 3SOXA 2VPDA 4AUQB 2KWJA 3LQIA 4LK9A 2KE1A 4GNEA 2ZETC 4BHWA 1FBVA 3N9QA 2CKLA 2QICA 3HCSA 4YBMA 3U5NA 1WFKA 2KWKA 3LQJA 3PUQA 1LDJB 2KYUA 3MHHA 2MIQA 1CHCA 5G05B 2YW8A 1HYIA 2KGGA 3L1ZB 5B75A 2VNFA 2YQLA 1JM7B 2KIZA 2JMDA 2AN6A 1VFYA 5FERA 4GB0A 2L5UA 5J3XA 2HDPA 5D1MB 2BAYA 2K17A 2JMIA 1WEQA 4F52B 1WGMA 3I2DA 2DX8A 4UP5A 4PPEA 5LKUA 2VJEA 3ZYQA 3ZTGA 3L11A 2LXHC 4YATA 3N9NA 3IHPA 1X4UA 3O37A 4GNDA 5H1VA 4AYCA 2IDAA 3EB5A 4P5OB 5TBNA 1X4JA 2F6NA 4WA6A 3PURA 1N87A 4C9ZA 4WZ0A 2Y43A 2H0DA 5AITA 2CKLB 2E6SA 4AP4A 5FB1A 3ZVZB 2Y1NA 4YADA 2M3HA 3M99A 4MVTA 1E4UA 4N3WA 2YUCA 1WEMA 1U6GB 2KGIA 5EYAF 4ZDTA 3HCTA 2KFTA 4GNGA 2E6RA 2EODA 2JMJA 2L0BA 3GV4A 4I7CA 4V3LC 1BORA 4R7EA 2KREA 4BBQA 5TABA 1WEWA 1MM3A 2XB1A 2YHOA 1WEEA 1V87A 5LKTA 2LXPC 3DPLR 2MA6A 3ASLA 1WEVA 5C13A 2VJEB 2M1RA 1LDKC 3U5OA 1WENA 4N4FA 2PNXA 4B86C 2EA6A 4CA1A 4YAXA 3QZVA 3N9LA 5G04B 4TKPB 4AYCB 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIM A;  3EB6 A;  3M62 A;  2YQM A;  2H0D B;  4R8P K;  4IC2 A;  1IYM A;  2QIZ A;  2XEU A;  3SOW A;  1Z6U A;  1WES A;  2LGV A;  3U5M A;  5TRB A;  2D8S A;  4ZUX U;  5H1T A;  3O36 A;  1Z60 A;  4FIP A;  3KV5 A;  4NN2 A;  2C2L A;  1WEU A;  2ECT A;  3RPG C;  2YHN A;  4R2Y A;  1MM2 A;  2NAA A;  4S3O C;  2K4D A;  3FL2 A;  3ZPV 1;  2LRI C;  2LGL A;  2L75 A;  2UZG A;  1T1H A;  3LRQ A;  4L58 A;  2K1J A;  4A4B A;  4YBS A;  2QJ0 A;  3SOU A;  3DQV R;  5H1U A;  5D1L B;  2F42 A;  2L80 A;  3KQI A;  1G25 A;  3C6W A;  4QF2 A;  2G6Q A;  4ZQL A;  5LCW B;  3T7L A;  2CSZ A;  5JG6 A;  1ZBD B;  2YSJ A;  2Y1M A;  5I3L A;  2C2V S;  4Q6F A;  2I50 A;  4WZ3 B;  2M6M A;  2MD7 B;  2K16 A;  2FUU A;  2PUY A;  4XI1 A;  2ECN A;  5AIU A;  2VPG A;  5FB0 A;  2CSY A;  3O35 A;  3ZVY A;  5B79 A;  4QF3 A;  2OXQ C;  4LJN A;  3V43 A;  3MHS A;  5FEY A;  2L43 A;  4B7Y C;  2F6J A;  3SHB A;  5D1K B;  4LAD B;  4A4C A;  4FJC A;  3O34 A;  2LGG A;  3N9O A;  5LKZ A;  4LKA A;  2MA5 A;  4AVX A;  2G43 A;  1VYX A;  1FP0 A;  4WZ2 A;  5DKA A;  3C5K A;  2LN0 A;  5DIN A;  2FUI A;  2KWN A;  2CT2 A;  2VPB A;  3ZNI A;  2JRJ A;  1X4I A;  4V3K C;  3N9M A;  2KU3 A;  4I7D A;  5H9M A;  3VK6 A;  2VJF A;  1WEO A;  1Z2Q A;  3RTR B;  4W4U A;  4IC3 A;  2YRE A;  2HYE D;  5KH7 A;  2RI7 A;  5LKX A;  4X3G A;  1WE9 A;  3O33 A;  2MT5 A;  4UP0 A;  5KH3 A;  3M63 A;  2LV9 A;  5B76 A;  1XWH A;  2RSD A;  1JOC A;  2G45 A;  4A49 A;  5B78 A;  3O70 A;  2KR4 A;  3L1X A;  1VD4 A;  5G0F A;  5B8D A;  2MNZ A;  2YYR A;  5C11 A;  2VPE A;  5B77 A;  3N9P A;  4UI9 B;  3T6R A;  2MUM A;  4FO9 A;  5KH9 A;  1DVP A;  1K2F A;  2LQ6 A;  3PHD A;  2VP7 A;  3HCU A;  2LDR A;  3GL6 A;  2ECG A;  1JM7 A;  3LQH A;  4CCG X;  1WIL A;  3KNV A;  4L7X A;  4MSX A;  2LGK A;  2FSA A;  4YBT A;  2ECV A;  2M85 A;  4YC9 A;  2MD8 C;  1WEP A;  4YAB A;  3RPG B;  2KWO A;  2ECI A;  4O64 A;  4GNF A;  4S3O B;  2YUR A;  5TDR A;  2VJF B;  3ZPV E;  2ECJ A;  3U5P A;  4PTB A;  2YSM A;  4FK5 A;  1RMD A;  4LLB A;  2YU4 A;  2ECW A;  2EGP A;  3O7A A;  4I7B A;  1F62 A;  4A0C D;  2YT5 A;  2MNY A;  5TDW A;  1HYJ A;  3NG2 A;  3KV6 A;  3SOX A;  2VPD A;  4AUQ B;  2KWJ A;  3LQI A;  4LK9 A;  2KE1 A;  4GNE A;  2ZET C;  4BHW A;  1FBV A;  3N9Q A;  2CKL A;  2QIC A;  3HCS A;  4YBM A;  3U5N A;  1WFK A;  2KWK A;  3LQJ A;  3PUQ A;  1LDJ B;  2KYU A;  3MHH A;  2MIQ A;  1CHC A;  5G05 B;  2YW8 A;  1HYI A;  2KGG A;  3L1Z B;  5B75 A;  2VNF A;  2YQL A;  1JM7 B;  2KIZ A;  2JMD A;  2AN6 A;  1VFY A;  5FER A;  4GB0 A;  2L5U A;  5J3X A;  2HDP A;  5D1M B;  2BAY A;  2K17 A;  2JMI A;  1WEQ A;  4F52 B;  1WGM A;  3I2D A;  2DX8 A;  4UP5 A;  4PPE A;  5LKU A;  2VJE A;  3ZYQ A;  3ZTG A;  3L11 A;  2LXH C;  4YAT A;  3N9N A;  3IHP A;  1X4U A;  3O37 A;  4GND A;  5H1V A;  4AYC A;  2IDA A;  3EB5 A;  4P5O B;  5TBN A;  1X4J A;  2F6N A;  4WA6 A;  3PUR A;  1N87 A;  4C9Z A;  4WZ0 A;  2Y43 A;  2H0D A;  5AIT A;  2CKL B;  2E6S A;  4AP4 A;  5FB1 A;  3ZVZ B;  2Y1N A;  4YAD A;  2M3H A;  3M99 A;  4MVT A;  1E4U A;  4N3W A;  2YUC A;  1WEM A;  1U6G B;  2KGI A;  5EYA F;  4ZDT A;  3HCT A;  2KFT A;  4GNG A;  2E6R A;  2EOD A;  2JMJ A;  2L0B A;  3GV4 A;  4I7C A;  4V3L C;  1BOR A;  4R7E A;  2KRE A;  4BBQ A;  5TAB A;  1WEW A;  1MM3 A;  2XB1 A;  2YHO A;  1WEE A;  1V87 A;  5LKT A;  2LXP C;  3DPL R;  2MA6 A;  3ASL A;  1WEV A;  5C13 A;  2VJE B;  2M1R A;  1LDK C;  3U5O A;  1WEN A;  4N4F A;  2PNX A;  4B86 C;  2EA6 A;  4CA1 A;  4YAX A;  3QZV A;  3N9L A;  5G04 B;  4TKP B;  4AYC B;  3HTK C; 
#chains in the Genus database with same CATH topology
 1WIM A;  3EB6 A;  3M62 A;  2YQM A;  2H0D B;  4R8P K;  4IC2 A;  1IYM A;  2QIZ A;  2XEU A;  3JUE A;  3SOW A;  1Z6U A;  1WES A;  2LGV A;  3U5M A;  2RR4 A;  5TRB A;  2D8S A;  4ZUX U;  5H1T A;  3O36 A;  1Z60 A;  4FIP A;  3KV5 A;  4NN2 A;  2C2L A;  1WEU A;  2ECT A;  3RPG C;  2P57 A;  2YHN A;  4R2Y A;  1MM2 A;  3FM8 C;  2NAA A;  4S3O C;  2K4D A;  3FL2 A;  3ZPV 1;  3T9K A;  2LRI C;  2LGL A;  2L75 A;  2UZG A;  1T1H A;  2CON A;  3LRQ A;  4L58 A;  2K1J A;  4A4B A;  3E2D A;  4YBS A;  2QJ0 A;  3SOU A;  3DQV R;  5H1U A;  5D1L B;  2F42 A;  2L80 A;  3KQI A;  1G25 A;  3C6W A;  3FJU B;  4O62 A;  4QF2 A;  2G6Q A;  4ZQL A;  5LCW B;  3T7L A;  2CSZ A;  5JG6 A;  1ZBD B;  2YSJ A;  2Y1M A;  5I3L A;  2C2V S;  4Q6F A;  2I50 A;  3Q1D A;  4WZ3 B;  2M6M A;  2MD7 B;  2K16 A;  2FUU A;  2PUY A;  4XI1 A;  2ECN A;  4OGE A;  5AIU A;  2VPG A;  2XOZ A;  5FB0 A;  2CSY A;  3O35 A;  5SVY A;  3ZVY A;  5B79 A;  4QF3 A;  2OXQ C;  3LVR E;  4LJN A;  3V43 A;  3MHS A;  1DCQ A;  5FEY A;  3FAO A;  2L43 A;  4B7Y C;  2F6J A;  2CRR A;  3SHB A;  5D1K B;  4LAD B;  4A4C A;  4FJC A;  3O34 A;  2LGG A;  3N9O A;  5LKZ A;  4LKA A;  2MA5 A;  4AVX A;  2G43 A;  3LDY A;  1VYX A;  1FP0 A;  4WZ2 A;  5DKA A;  3C5K A;  3SUB A;  2LN0 A;  2JM3 A;  3KDE C;  3O47 A;  5DIN A;  2FUI A;  2KWN A;  2CT2 A;  2VPB A;  3ZNI A;  2JRJ A;  1X4I A;  4V3K C;  3N9M A;  2KU3 A;  4I7D A;  5H9M A;  3VK6 A;  3PLW A;  2VJF A;  1WEO A;  1Z2Q A;  2JUN A;  3RTR B;  4W4U A;  4IC3 A;  2YRE A;  2CRW A;  2HYE D;  2FFW A;  5KH7 A;  2RI7 A;  5LKX A;  4X3G A;  1WE9 A;  3O33 A;  2MT5 A;  4UP0 A;  5KH3 A;  3M63 A;  2LV9 A;  5B76 A;  1XWH A;  2RSD A;  1JOC A;  2G45 A;  4A49 A;  5B78 A;  3O70 A;  2KR4 A;  3L1X A;  1VD4 A;  5G0F A;  5B8D A;  2MNZ A;  2YYR A;  2FD4 A;  5C11 A;  2VPE A;  5B77 A;  3N9P A;  4UI9 B;  4F1P A;  2KKX A;  3T6R A;  2IQJ A;  2OWA A;  2MUM A;  4FO9 A;  5KH9 A;  1DVP A;  1K2F A;  2LQ6 A;  3PHD A;  2VP7 A;  3HCU A;  2LDR A;  3GL6 A;  2KKY A;  2ECG A;  1JM7 A;  3LQH A;  4CCG X;  1WIL A;  3KNV A;  4L7X A;  4MSX A;  4OGC A;  2LGK A;  2FSA A;  3LJU X;  4YBT A;  2ECV A;  2M85 A;  3H7H A;  4YC9 A;  2EXU A;  2MD8 C;  1WEP A;  4YAB A;  3RPG B;  2KWO A;  2ECI A;  4O64 A;  4GNF A;  4S3O B;  2YUR A;  5TDR A;  2VJF B;  3ZPV E;  2ECJ A;  3U5P A;  4PTB A;  2YSM A;  4FK5 A;  1RMD A;  4LLB A;  2YU4 A;  2ECW A;  2EGP A;  3O7A A;  4I7B A;  1F62 A;  4A0C D;  2EGM A;  2YT5 A;  3FAN A;  2MNY A;  5TDW A;  1HYJ A;  3NG2 A;  2DJA A;  3KV6 A;  3SOX A;  2VPD A;  4AUQ B;  2KWJ A;  3LQI A;  2M13 A;  4LK9 A;  2KE1 A;  4GNE A;  2ZET C;  3LVQ E;  5SVI B;  4BHW A;  1FBV A;  3N9Q A;  2D8U A;  2CKL A;  2QIC A;  3HCS A;  4YBM A;  3U5N A;  1WFK A;  2KWK A;  3LQJ A;  3PUQ A;  4Z0R A;  1LDJ B;  2KYU A;  3MHH A;  4QQ4 A;  2MIQ A;  1CHC A;  2MKE A;  5G05 B;  2YW8 A;  1HYI A;  2KGG A;  3L1Z B;  2DSM A;  5B75 A;  2VNF A;  2YQL A;  1JM7 B;  2KIZ A;  2JMD A;  2AN6 A;  1VFY A;  5FER A;  4GB0 A;  2L5U A;  5J3X A;  2HDP A;  1MBM A;  5D1M B;  2BAY A;  2K17 A;  2JMI A;  2YVR A;  1WEQ A;  5SVI A;  4F52 B;  1WGM A;  3I2D A;  2DX8 A;  4UP5 A;  4PPE A;  5LKU A;  4Z0O A;  2VJE A;  3ZYQ A;  3ZTG A;  3L11 A;  2LXH C;  4YAT A;  3N9N A;  3IHP A;  1X4U A;  3DWD A;  3O37 A;  4GND A;  2XOY A;  5K3Q A;  5H1V A;  4AYC A;  2IDA A;  3EB5 A;  4P5O B;  4H9D A;  5TBN A;  1X4J A;  2F6N A;  4WA6 A;  3PUR A;  1N87 A;  2E61 A;  4C9Z A;  4WZ0 A;  2Y43 A;  2H0D A;  5AIT A;  2CKL B;  2E6S A;  4AP4 A;  5FB1 A;  3ZVZ B;  2Y1N A;  4YAD A;  2M3H A;  3M99 A;  4MVT A;  1E4U A;  2L7P A;  5SVX A;  4N3W A;  2YUC A;  3M7K A;  1WEM A;  1U6G B;  2KGI A;  5EYA F;  3HCT A;  4ZDT A;  2KFT A;  4GNG A;  2E6R A;  2EOD A;  2JMJ A;  2L0B A;  3GV4 A;  4I7C A;  4V3L C;  1BOR A;  4R7E A;  3DDT A;  2KRE A;  4BBQ A;  5TAB A;  1WEW A;  1MM3 A;  2XB1 A;  2YHO A;  1WEE A;  1V87 A;  2LAU A;  5LKT A;  2LXP C;  2XOC A;  3DPL R;  2MA6 A;  3ASL A;  3FEH A;  1WEV A;  5C13 A;  2VJE B;  2M1R A;  1LDK C;  3U5O A;  3MDB C;  1WEN A;  4N4F A;  2B0O E;  2XP0 A;  2PNX A;  4B86 C;  2EA6 A;  4CA1 A;  4YAX A;  3QZV A;  3N9L A;  5G04 B;  4TKP B;  2CSV A;  4AYC B;  3HTK C; 
#chains in the Genus database with same CATH homology
 1WIM A;  3EB6 A;  3M62 A;  2YQM A;  2H0D B;  4R8P K;  4IC2 A;  1IYM A;  2QIZ A;  2XEU A;  3SOW A;  1Z6U A;  1WES A;  2LGV A;  3U5M A;  5TRB A;  2D8S A;  4ZUX U;  5H1T A;  3O36 A;  1Z60 A;  4FIP A;  3KV5 A;  4NN2 A;  2C2L A;  1WEU A;  2ECT A;  3RPG C;  2YHN A;  4R2Y A;  1MM2 A;  2NAA A;  4S3O C;  2K4D A;  3FL2 A;  3ZPV 1;  2LRI C;  2LGL A;  2L75 A;  2UZG A;  1T1H A;  3LRQ A;  4L58 A;  2K1J A;  4A4B A;  4YBS A;  2QJ0 A;  3SOU A;  3DQV R;  5H1U A;  5D1L B;  2F42 A;  2L80 A;  3KQI A;  1G25 A;  3C6W A;  4QF2 A;  2G6Q A;  4ZQL A;  5LCW B;  3T7L A;  2CSZ A;  5JG6 A;  1ZBD B;  2YSJ A;  2Y1M A;  5I3L A;  2C2V S;  4Q6F A;  2I50 A;  4WZ3 B;  2M6M A;  2MD7 B;  2K16 A;  2FUU A;  2PUY A;  4XI1 A;  2ECN A;  5AIU A;  2VPG A;  5FB0 A;  2CSY A;  3O35 A;  3ZVY A;  5B79 A;  4QF3 A;  2OXQ C;  4LJN A;  3V43 A;  3MHS A;  5FEY A;  2L43 A;  4B7Y C;  2F6J A;  3SHB A;  5D1K B;  4LAD B;  4A4C A;  4FJC A;  3O34 A;  2LGG A;  3N9O A;  5LKZ A;  4LKA A;  2MA5 A;  4AVX A;  2G43 A;  1VYX A;  1FP0 A;  4WZ2 A;  5DKA A;  3C5K A;  2LN0 A;  5DIN A;  2FUI A;  2KWN A;  2CT2 A;  2VPB A;  3ZNI A;  2JRJ A;  1X4I A;  4V3K C;  3N9M A;  2KU3 A;  4I7D A;  5H9M A;  3VK6 A;  2VJF A;  1WEO A;  1Z2Q A;  3RTR B;  4W4U A;  4IC3 A;  2YRE A;  2HYE D;  5KH7 A;  2RI7 A;  5LKX A;  4X3G A;  1WE9 A;  3O33 A;  2MT5 A;  4UP0 A;  5KH3 A;  3M63 A;  2LV9 A;  5B76 A;  1XWH A;  2RSD A;  1JOC A;  2G45 A;  4A49 A;  5B78 A;  3O70 A;  2KR4 A;  3L1X A;  1VD4 A;  5G0F A;  5B8D A;  2MNZ A;  2YYR A;  5C11 A;  2VPE A;  5B77 A;  3N9P A;  4UI9 B;  3T6R A;  2MUM A;  4FO9 A;  5KH9 A;  1DVP A;  1K2F A;  2LQ6 A;  3PHD A;  2VP7 A;  3HCU A;  2LDR A;  3GL6 A;  2ECG A;  1JM7 A;  3LQH A;  4CCG X;  1WIL A;  3KNV A;  4L7X A;  4MSX A;  2LGK A;  2FSA A;  4YBT A;  2ECV A;  2M85 A;  4YC9 A;  2MD8 C;  1WEP A;  4YAB A;  3RPG B;  2KWO A;  2ECI A;  4O64 A;  4GNF A;  4S3O B;  2YUR A;  5TDR A;  2VJF B;  3ZPV E;  2ECJ A;  3U5P A;  4PTB A;  2YSM A;  4FK5 A;  1RMD A;  4LLB A;  2YU4 A;  2ECW A;  2EGP A;  3O7A A;  4I7B A;  1F62 A;  4A0C D;  2YT5 A;  2MNY A;  5TDW A;  1HYJ A;  3NG2 A;  3KV6 A;  3SOX A;  2VPD A;  4AUQ B;  2KWJ A;  3LQI A;  4LK9 A;  2KE1 A;  4GNE A;  2ZET C;  4BHW A;  1FBV A;  3N9Q A;  2CKL A;  2QIC A;  3HCS A;  4YBM A;  3U5N A;  1WFK A;  2KWK A;  3LQJ A;  3PUQ A;  1LDJ B;  2KYU A;  3MHH A;  2MIQ A;  1CHC A;  5G05 B;  2YW8 A;  1HYI A;  2KGG A;  3L1Z B;  5B75 A;  2VNF A;  2YQL A;  1JM7 B;  2KIZ A;  2JMD A;  2AN6 A;  1VFY A;  5FER A;  4GB0 A;  2L5U A;  5J3X A;  2HDP A;  5D1M B;  2BAY A;  2K17 A;  2JMI A;  1WEQ A;  4F52 B;  1WGM A;  3I2D A;  2DX8 A;  4UP5 A;  4PPE A;  5LKU A;  2VJE A;  3ZYQ A;  3ZTG A;  3L11 A;  2LXH C;  4YAT A;  3N9N A;  3IHP A;  1X4U A;  3O37 A;  4GND A;  5H1V A;  4AYC A;  2IDA A;  3EB5 A;  4P5O B;  5TBN A;  1X4J A;  2F6N A;  4WA6 A;  3PUR A;  1N87 A;  4C9Z A;  4WZ0 A;  2Y43 A;  2H0D A;  5AIT A;  2CKL B;  2E6S A;  4AP4 A;  5FB1 A;  3ZVZ B;  2Y1N A;  4YAD A;  2M3H A;  3M99 A;  4MVT A;  1E4U A;  4N3W A;  2YUC A;  1WEM A;  1U6G B;  2KGI A;  5EYA F;  4ZDT A;  3HCT A;  2KFT A;  4GNG A;  2E6R A;  2EOD A;  2JMJ A;  2L0B A;  3GV4 A;  4I7C A;  4V3L C;  1BOR A;  4R7E A;  2KRE A;  4BBQ A;  5TAB A;  1WEW A;  1MM3 A;  2XB1 A;  2YHO A;  1WEE A;  1V87 A;  5LKT A;  2LXP C;  3DPL R;  2MA6 A;  3ASL A;  1WEV A;  5C13 A;  2VJE B;  2M1R A;  1LDK C;  3U5O A;  1WEN A;  4N4F A;  2PNX A;  4B86 C;  2EA6 A;  4CA1 A;  4YAX A;  3QZV A;  3N9L A;  5G04 B;  4TKP B;  4AYC B;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...