2YSJA

Solution structure of the ring domain (1-56) from tripartite motif-containing protein 31
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
GSSGSSGMASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RING domain (1-56) from tripartite motif-containing protein 31
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Tripartite motif-containing protein 31
total genus 7
structure length 63
sequence length 63
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ysjA00
1Z6UA 2MNYA 2L43A 2FSAA 2XB1A 4Q6FA 2ECWA 2KWJA 1WEMA 2CT2A 4L58A 3IHPA 4I7DA 1ZBDB 2KR4A 2KWKA 2VJEA 4FK5A 3HCUA 5B75A 1CHCA 4V3LC 4LKAA 2YQLA 1WILA 2LGLA 1WEWA 2KGGA 4A4BA 4YATA 4AUQB 2LXHC 2LQ6A 3L1XA 4S3OC 5LKTA 1K2FA 1JM7B 2M1RA 2LDRA 2F42A 2FUIA 3I2DA 5TBNA 3C5KA 2YYRA 3M99A 2LXPC 4PPEA 4A49A 2EGPA 4F52B 3ASLA 4LJNA 3EB5A 4AVXA 3RTRB 2C2VS 4V3KC 2ECJA 2KFTA 5D1MB 3PURA 2VP7A 2VJFB 2UZGA 4B86C 5EYAF 1WEOA 2Y1NA 2LGVA 2JRJA 4MVTA 3LQIA 1BORA 2D8SA 3KV6A 3ZPVE 2G43A 4YBMA 2K1JA 5JG6A 4MSXA 4BHWA 4TKPB 3LQJA 2ECVA 2EA6A 2QJ0A 3PUQA 2MUMA 4GNFA 2H0DB 5H1TA 2YQMA 4LADB 5FB0A 5H1UA 2VPGA 4X3GA 2VPEA 4AYCA 2JMJA 2YU4A 5TDRA 1MM3A 1VD4A 2M85A 1WEPA 3DPLR 2MA5A 5AIUA 1HYJA 2ECGA 2VPDA 3N9QA 4YC9A 4YBTA 4A4CA 3O36A 2MIQA 4GNDA 5KH9A 4R7EA 2PNXA 2H0DA 1DVPA 2Y1MA 5B79A 1X4UA 2VNFA 2YHOA 2LGGA 2L80A 4WA6A 4I7CA 2NAAA 2L75A 5B78A 3M62A 4PTBA 2MA6A 5G0FA 3T6RA 4P5OB 5TRBA 4YADA 2YSMA 2AN6A 3KQIA 1G25A 2OXQC 5J3XA 5B76A 5D1KB 5FERA 2KWOA 2C2LA 1Z2QA 2K4DA 2LGKA 5FEYA 2YHNA 2QIZA 1LDJB 2RSDA 5G05B 2YREA 1WENA 4R8PK 2G45A 5LKXA 5LCWB 4L7XA 4N4FA 4XI1A 5I3LA 5H9MA 2QICA 2JMIA 3O70A 2F6NA 4N3WA 3LRQA 1Z60A 3HTKC 2M6MA 1V87A 3RPGB 2KU3A 3GL6A 4B7YC 5H1VA 1WEUA 2FUUA 3KNVA 4UP0A 1WESA 1WE9A 2G6QA 4GNEA 3ZPV1 4O64A 1X4JA 4W4UA 4WZ3B 4FJCA 2VJEB 5AITA 2I50A 1E4UA 2VPBA 3KV5A 2XEUA 2YSJA 1WGMA 1WFKA 2MD8C 2ECTA 3GV4A 5B8DA 2LV9A 3ZVZB 4AYCB 2KYUA 4CA1A 3L1ZB 1WIMA 3U5OA 1VFYA 4YBSA 1XWHA 4LK9A 3PHDA 2HYED 1X4IA 4S3OB 4UP5A 1WEEA 3HCSA 1IYMA 1RMDA 4GNGA 3LQHA 2KWNA 2KREA 3HCTA 4CCGX 4ZDTA 3L11A 2JMDA 1VYXA 3N9PA 3O37A 2KGIA 5C13A 2YW8A 1T1HA 3QZVA 4AP4A 1HYIA 2VJFA 2KIZA 4LLBA 3DQVR 3RPGC 2PUYA 4R2YA 3EB6A 4ZUXU 2YURA 3O35A 3N9LA 1MM2A 4I7BA 3MHSA 4IC2A 2E6SA 3N9OA 4NN2A 3SOUA 5FB1A 5B77A 2ECNA 3ZYQA 2F6JA 2MT5A 5KH7A 3T7LA 3ZVYA 2M3HA 2RI7A 5G04B 4FO9A 2KE1A 3U5PA 2CSYA 2E6RA 4IC3A 2ECIA 2IDAA 1WEQA 5LKZA 3O7AA 4A0CD 3O33A 5D1LB 2CKLA 1N87A 2YT5A 3MHHA 5C11A 1F62A 3U5MA 2EODA 3O34A 2L5UA 4WZ2A 2LN0A 2YUCA 1JOCA 4ZQLA 2CSZA 3M63A 4C9ZA 2L0BA 5TABA 2Y43A 2CKLB 5DINA 2ZETC 3N9MA 3NG2A 2BAYA 3N9NA 1WEVA 4BBQA 2HDPA 2MD7B 2K16A 3SOWA 5LKUA 1JM7A 2MNZA 3ZNIA 5KH3A 1U6GB 3ZTGA 3FL2A 4UI9B 4WZ0A 3U5NA 2DX8A 5TDWA 1FBVA 4GB0A 3VK6A 4FIPA 2K17A 4QF2A 2LRIC 3V43A 4YAXA 1FP0A 4QF3A 3SHBA 3SOXA 4YABA 3C6WA 1LDKC 5DKAA
chains in the Genus database with same CATH superfamily
1Z6UA 2MNYA 2L43A 2EXUA 2FSAA 2XB1A 4Q6FA 2ECWA 2KWJA 1WEMA 2CT2A 4L58A 3IHPA 4I7DA 4Z0RA 3LVRE 1ZBDB 2KR4A 2KWKA 2VJEA 4FK5A 3HCUA 5B75A 2EGMA 1CHCA 4V3LC 4LKAA 2YQLA 1WILA 2LGLA 3FJUB 3O47A 1WEWA 2KGGA 4A4BA 4YATA 4AUQB 2LXHC 2LQ6A 3L1XA 4S3OC 5LKTA 1K2FA 1JM7B 2M1RA 2LDRA 2F42A 2FUIA 3I2DA 5TBNA 3C5KA 2YYRA 3M99A 2LXPC 4PPEA 4A49A 2EGPA 4F52B 2DSMA 5SVXA 2XOCA 3M7KA 3ASLA 4LJNA 4F1PA 3EB5A 2CONA 4AVXA 3RTRB 2C2VS 4V3KC 2ECJA 2KFTA 5D1MB 3PURA 2VP7A 5SVIA 2VJFB 2UZGA 3T9KA 4B86C 5EYAF 1WEOA 2Y1NA 2LGVA 2JRJA 3JUEA 4MVTA 3LQIA 1BORA 2D8SA 2XOZA 3KV6A 3ZPVE 2G43A 2CSVA 3LJUX 4YBMA 2K1JA 5JG6A 4OGCA 4MSXA 4BHWA 4TKPB 3LQJA 2ECVA 2EA6A 2QJ0A 3PUQA 2MUMA 4GNFA 2H0DB 5H1TA 2YQMA 2MKEA 4LADB 5FB0A 5H1UA 2FD4A 2VPGA 4X3GA 2VPEA 2DJAA 4AYCA 2JMJA 2YU4A 5TDRA 1MM3A 2P57A 1VD4A 2M85A 3H7HA 1WEPA 3DPLR 2MA5A 3PLWA 5AIUA 1HYJA 2ECGA 2VPDA 3N9QA 4YC9A 4YBTA 4A4CA 3O36A 2MIQA 5K3QA 4GNDA 5KH9A 4R7EA 2PNXA 2H0DA 1DVPA 2Y1MA 5B79A 1X4UA 2VNFA 2YHOA 2LGGA 2L80A 2B0OE 4WA6A 4I7CA 2NAAA 2L75A 5B78A 3M62A 4O62A 4PTBA 2MA6A 5G0FA 3DWDA 4P5OB 3T6RA 3LDYA 5TRBA 2M13A 4OGEA 2LAUA 4YADA 2YSMA 2AN6A 3KQIA 1G25A 2OXQC 5J3XA 5B76A 5D1KB 5FERA 2KWOA 2C2LA 1Z2QA 2K4DA 2LGKA 5FEYA 2YHNA 2QIZA 1LDJB 3FEHA 2RSDA 5G05B 5SVYA 2YREA 1WENA 2XOYA 4R8PK 2G45A 5LKXA 5LCWB 4L7XA 4N4FA 4XI1A 5I3LA 5H9MA 2QICA 2JMIA 3O70A 2F6NA 4N3WA 3LRQA 1Z60A 3HTKC 2M6MA 1V87A 3Q1DA 3RPGB 2KU3A 3GL6A 4B7YC 5H1VA 2XP0A 1WEUA 2FUUA 3KNVA 5SVIB 4UP0A 1WESA 1WE9A 2FFWA 2CRWA 2L7PA 2G6QA 4GNEA 4Z0OA 2JM3A 3ZPV1 4O64A 1X4JA 4W4UA 4WZ3B 4FJCA 2VJEB 5AITA 2I50A 1E4UA 2VPBA 4QQ4A 3KV5A 2XEUA 2YSJA 1WGMA 1WFKA 2MD8C 2ECTA 3GV4A 5B8DA 2LV9A 3ZVZB 4AYCB 2KYUA 4CA1A 3L1ZB 1WIMA 3U5OA 1VFYA 4YBSA 1XWHA 4LK9A 3KDEC 3PHDA 2HYED 1X4IA 4S3OB 4UP5A 1WEEA 3HCSA 3FM8C 2OWAA 1IYMA 2JUNA 1RMDA 4GNGA 3LQHA 2KWNA 2KREA 3HCTA 3FAOA 4CCGX 4ZDTA 3L11A 3DDTA 2JMDA 3MDBC 3E2DA 1VYXA 3N9PA 3O37A 2KGIA 5C13A 2YW8A 1T1HA 3QZVA 4AP4A 2RR4A 1HYIA 2VJFA 2KKXA 2KIZA 4LLBA 3DQVR 3RPGC 4H9DA 2PUYA 4R2YA 3EB6A 4ZUXU 2YURA 3O35A 3N9LA 1MM2A 2CRRA 4I7BA 3MHSA 4IC2A 2E6SA 3N9OA 4NN2A 3SOUA 5FB1A 5B77A 2ECNA 3ZYQA 2F6JA 2MT5A 5KH7A 3T7LA 3ZVYA 2YVRA 2M3HA 2RI7A 5G04B 4FO9A 2KE1A 3U5PA 2KKYA 2CSYA 2E6RA 4IC3A 2ECIA 1WEQA 2IDAA 3SUBA 5LKZA 3O7AA 4A0CD 3O33A 5D1LB 2CKLA 1N87A 2YT5A 3MHHA 5C11A 1F62A 3U5MA 2EODA 3O34A 2L5UA 4WZ2A 2LN0A 2YUCA 1JOCA 4ZQLA 2CSZA 3M63A 4C9ZA 2D8UA 2L0BA 5TABA 2Y43A 1MBMA 2CKLB 5DINA 2ZETC 3N9MA 3NG2A 2BAYA 3N9NA 1WEVA 4BBQA 2HDPA 2MD7B 2K16A 3SOWA 5LKUA 1JM7A 2MNZA 1DCQA 3ZNIA 3FANA 2IQJA 5KH3A 1U6GB 3ZTGA 3FL2A 4UI9B 4WZ0A 3U5NA 2DX8A 5TDWA 1FBVA 4GB0A 3VK6A 4FIPA 2K17A 4QF2A 2E61A 3LVQE 2LRIC 3V43A 4YAXA 1FP0A 4QF3A 3SHBA 3SOXA 4YABA 3C6WA 1LDKC 5DKAA
chains in the Genus database with same CATH topology
1Z6UA 2MNYA 2L43A 2FSAA 2XB1A 4Q6FA 2ECWA 2KWJA 1WEMA 2CT2A 4L58A 3IHPA 4I7DA 1ZBDB 2KR4A 2KWKA 2VJEA 4FK5A 3HCUA 5B75A 1CHCA 4V3LC 4LKAA 2YQLA 1WILA 2LGLA 1WEWA 2KGGA 4A4BA 4YATA 4AUQB 2LXHC 2LQ6A 3L1XA 4S3OC 5LKTA 1K2FA 1JM7B 2M1RA 2LDRA 2F42A 2FUIA 3I2DA 5TBNA 3C5KA 2YYRA 3M99A 2LXPC 4PPEA 4A49A 2EGPA 4F52B 3ASLA 4LJNA 3EB5A 4AVXA 3RTRB 2C2VS 4V3KC 2ECJA 2KFTA 5D1MB 3PURA 2VP7A 2VJFB 2UZGA 4B86C 5EYAF 1WEOA 2Y1NA 2LGVA 2JRJA 4MVTA 3LQIA 1BORA 2D8SA 3KV6A 3ZPVE 2G43A 4YBMA 2K1JA 5JG6A 4MSXA 4BHWA 4TKPB 3LQJA 2ECVA 2EA6A 2QJ0A 3PUQA 2MUMA 4GNFA 2H0DB 5H1TA 2YQMA 4LADB 5FB0A 5H1UA 2VPGA 4X3GA 2VPEA 4AYCA 2JMJA 2YU4A 5TDRA 1MM3A 1VD4A 2M85A 1WEPA 3DPLR 2MA5A 5AIUA 1HYJA 2ECGA 2VPDA 3N9QA 4YC9A 4YBTA 4A4CA 3O36A 2MIQA 4GNDA 5KH9A 4R7EA 2PNXA 2H0DA 1DVPA 2Y1MA 5B79A 1X4UA 2VNFA 2YHOA 2LGGA 2L80A 4WA6A 4I7CA 2NAAA 2L75A 5B78A 3M62A 4PTBA 2MA6A 5G0FA 3T6RA 4P5OB 5TRBA 4YADA 2YSMA 2AN6A 3KQIA 1G25A 2OXQC 5J3XA 5B76A 5D1KB 5FERA 2KWOA 2C2LA 1Z2QA 2K4DA 2LGKA 5FEYA 2YHNA 2QIZA 1LDJB 2RSDA 5G05B 2YREA 1WENA 4R8PK 2G45A 5LKXA 5LCWB 4L7XA 4N4FA 4XI1A 5I3LA 5H9MA 2QICA 2JMIA 3O70A 2F6NA 4N3WA 3LRQA 1Z60A 3HTKC 2M6MA 1V87A 3RPGB 2KU3A 3GL6A 4B7YC 5H1VA 1WEUA 2FUUA 3KNVA 4UP0A 1WESA 1WE9A 2G6QA 4GNEA 3ZPV1 4O64A 1X4JA 4W4UA 4WZ3B 4FJCA 2VJEB 5AITA 2I50A 1E4UA 2VPBA 3KV5A 2XEUA 2YSJA 1WGMA 1WFKA 2MD8C 2ECTA 3GV4A 5B8DA 2LV9A 3ZVZB 4AYCB 2KYUA 4CA1A 3L1ZB 1WIMA 3U5OA 1VFYA 4YBSA 1XWHA 4LK9A 3PHDA 2HYED 1X4IA 4S3OB 4UP5A 1WEEA 3HCSA 1IYMA 1RMDA 4GNGA 3LQHA 2KWNA 2KREA 3HCTA 4CCGX 4ZDTA 3L11A 2JMDA 1VYXA 3N9PA 3O37A 2KGIA 5C13A 2YW8A 1T1HA 3QZVA 4AP4A 1HYIA 2VJFA 2KIZA 4LLBA 3DQVR 3RPGC 2PUYA 4R2YA 3EB6A 4ZUXU 2YURA 3O35A 3N9LA 1MM2A 4I7BA 3MHSA 4IC2A 2E6SA 3N9OA 4NN2A 3SOUA 5FB1A 5B77A 2ECNA 3ZYQA 2F6JA 2MT5A 5KH7A 3T7LA 3ZVYA 2M3HA 2RI7A 5G04B 4FO9A 2KE1A 3U5PA 2CSYA 2E6RA 4IC3A 2ECIA 2IDAA 1WEQA 5LKZA 3O7AA 4A0CD 3O33A 5D1LB 2CKLA 1N87A 2YT5A 3MHHA 5C11A 1F62A 3U5MA 2EODA 3O34A 2L5UA 4WZ2A 2LN0A 2YUCA 1JOCA 4ZQLA 2CSZA 3M63A 4C9ZA 2L0BA 5TABA 2Y43A 2CKLB 5DINA 2ZETC 3N9MA 3NG2A 2BAYA 3N9NA 1WEVA 4BBQA 2HDPA 2MD7B 2K16A 3SOWA 5LKUA 1JM7A 2MNZA 3ZNIA 5KH3A 1U6GB 3ZTGA 3FL2A 4UI9B 4WZ0A 3U5NA 2DX8A 5TDWA 1FBVA 4GB0A 3VK6A 4FIPA 2K17A 4QF2A 2LRIC 3V43A 4YAXA 1FP0A 4QF3A 3SHBA 3SOXA 4YABA 3C6WA 1LDKC 5DKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6U A;  2MNY A;  2L43 A;  2FSA A;  2XB1 A;  4Q6F A;  2ECW A;  2KWJ A;  1WEM A;  2CT2 A;  4L58 A;  3IHP A;  4I7D A;  1ZBD B;  2KR4 A;  2KWK A;  2VJE A;  4FK5 A;  3HCU A;  5B75 A;  1CHC A;  4V3L C;  4LKA A;  2YQL A;  1WIL A;  2LGL A;  1WEW A;  2KGG A;  4A4B A;  4YAT A;  4AUQ B;  2LXH C;  2LQ6 A;  3L1X A;  4S3O C;  5LKT A;  1K2F A;  1JM7 B;  2M1R A;  2LDR A;  2F42 A;  2FUI A;  3I2D A;  5TBN A;  3C5K A;  2YYR A;  3M99 A;  2LXP C;  4PPE A;  4A49 A;  2EGP A;  4F52 B;  3ASL A;  4LJN A;  3EB5 A;  4AVX A;  3RTR B;  2C2V S;  4V3K C;  2ECJ A;  2KFT A;  5D1M B;  3PUR A;  2VP7 A;  2VJF B;  2UZG A;  4B86 C;  5EYA F;  1WEO A;  2Y1N A;  2LGV A;  2JRJ A;  4MVT A;  3LQI A;  1BOR A;  2D8S A;  3KV6 A;  3ZPV E;  2G43 A;  4YBM A;  2K1J A;  5JG6 A;  4MSX A;  4BHW A;  4TKP B;  3LQJ A;  2ECV A;  2EA6 A;  2QJ0 A;  3PUQ A;  2MUM A;  4GNF A;  2H0D B;  5H1T A;  2YQM A;  4LAD B;  5FB0 A;  5H1U A;  2VPG A;  4X3G A;  2VPE A;  4AYC A;  2JMJ A;  2YU4 A;  5TDR A;  1MM3 A;  1VD4 A;  2M85 A;  1WEP A;  3DPL R;  2MA5 A;  5AIU A;  1HYJ A;  2ECG A;  2VPD A;  3N9Q A;  4YC9 A;  4YBT A;  4A4C A;  3O36 A;  2MIQ A;  4GND A;  5KH9 A;  4R7E A;  2PNX A;  2H0D A;  1DVP A;  2Y1M A;  5B79 A;  1X4U A;  2VNF A;  2YHO A;  2LGG A;  2L80 A;  4WA6 A;  4I7C A;  2NAA A;  2L75 A;  5B78 A;  3M62 A;  4PTB A;  2MA6 A;  5G0F A;  3T6R A;  4P5O B;  5TRB A;  4YAD A;  2YSM A;  2AN6 A;  3KQI A;  1G25 A;  2OXQ C;  5J3X A;  5B76 A;  5D1K B;  5FER A;  2KWO A;  2C2L A;  1Z2Q A;  2K4D A;  2LGK A;  5FEY A;  2YHN A;  2QIZ A;  1LDJ B;  2RSD A;  5G05 B;  2YRE A;  1WEN A;  4R8P K;  2G45 A;  5LKX A;  5LCW B;  4L7X A;  4N4F A;  4XI1 A;  5I3L A;  5H9M A;  2QIC A;  2JMI A;  3O70 A;  2F6N A;  4N3W A;  3LRQ A;  1Z60 A;  3HTK C;  2M6M A;  1V87 A;  3RPG B;  2KU3 A;  3GL6 A;  4B7Y C;  5H1V A;  1WEU A;  2FUU A;  3KNV A;  4UP0 A;  1WES A;  1WE9 A;  2G6Q A;  4GNE A;  3ZPV 1;  4O64 A;  1X4J A;  4W4U A;  4WZ3 B;  4FJC A;  2VJE B;  5AIT A;  2I50 A;  1E4U A;  2VPB A;  3KV5 A;  2XEU A;  2YSJ A;  1WGM A;  1WFK A;  2MD8 C;  2ECT A;  3GV4 A;  5B8D A;  2LV9 A;  3ZVZ B;  4AYC B;  2KYU A;  4CA1 A;  3L1Z B;  1WIM A;  3U5O A;  1VFY A;  4YBS A;  1XWH A;  4LK9 A;  3PHD A;  2HYE D;  1X4I A;  4S3O B;  4UP5 A;  1WEE A;  3HCS A;  1IYM A;  1RMD A;  4GNG A;  3LQH A;  2KWN A;  2KRE A;  3HCT A;  4CCG X;  4ZDT A;  3L11 A;  2JMD A;  1VYX A;  3N9P A;  3O37 A;  2KGI A;  5C13 A;  2YW8 A;  1T1H A;  3QZV A;  4AP4 A;  1HYI A;  2VJF A;  2KIZ A;  4LLB A;  3DQV R;  3RPG C;  2PUY A;  4R2Y A;  3EB6 A;  4ZUX U;  2YUR A;  3O35 A;  3N9L A;  1MM2 A;  4I7B A;  3MHS A;  4IC2 A;  2E6S A;  3N9O A;  4NN2 A;  3SOU A;  5FB1 A;  5B77 A;  2ECN A;  3ZYQ A;  2F6J A;  2MT5 A;  5KH7 A;  3T7L A;  3ZVY A;  2M3H A;  2RI7 A;  5G04 B;  4FO9 A;  2KE1 A;  3U5P A;  2CSY A;  2E6R A;  4IC3 A;  2ECI A;  2IDA A;  1WEQ A;  5LKZ A;  3O7A A;  4A0C D;  3O33 A;  5D1L B;  2CKL A;  1N87 A;  2YT5 A;  3MHH A;  5C11 A;  1F62 A;  3U5M A;  2EOD A;  3O34 A;  2L5U A;  4WZ2 A;  2LN0 A;  2YUC A;  1JOC A;  4ZQL A;  2CSZ A;  3M63 A;  4C9Z A;  2L0B A;  5TAB A;  2Y43 A;  2CKL B;  5DIN A;  2ZET C;  3N9M A;  3NG2 A;  2BAY A;  3N9N A;  1WEV A;  4BBQ A;  2HDP A;  2MD7 B;  2K16 A;  3SOW A;  5LKU A;  1JM7 A;  2MNZ A;  3ZNI A;  5KH3 A;  1U6G B;  3ZTG A;  3FL2 A;  4UI9 B;  4WZ0 A;  3U5N A;  2DX8 A;  5TDW A;  1FBV A;  4GB0 A;  3VK6 A;  4FIP A;  2K17 A;  4QF2 A;  2LRI C;  3V43 A;  4YAX A;  1FP0 A;  4QF3 A;  3SHB A;  3SOX A;  4YAB A;  3C6W A;  1LDK C;  5DKA A; 
#chains in the Genus database with same CATH topology
 1Z6U A;  2MNY A;  2L43 A;  2EXU A;  2FSA A;  2XB1 A;  4Q6F A;  2ECW A;  2KWJ A;  1WEM A;  2CT2 A;  4L58 A;  3IHP A;  4I7D A;  4Z0R A;  3LVR E;  1ZBD B;  2KR4 A;  2KWK A;  2VJE A;  4FK5 A;  3HCU A;  5B75 A;  2EGM A;  1CHC A;  4V3L C;  4LKA A;  2YQL A;  1WIL A;  2LGL A;  3FJU B;  3O47 A;  1WEW A;  2KGG A;  4A4B A;  4YAT A;  4AUQ B;  2LXH C;  2LQ6 A;  3L1X A;  4S3O C;  5LKT A;  1K2F A;  1JM7 B;  2M1R A;  2LDR A;  2F42 A;  2FUI A;  3I2D A;  5TBN A;  3C5K A;  2YYR A;  3M99 A;  2LXP C;  4PPE A;  4A49 A;  2EGP A;  4F52 B;  2DSM A;  5SVX A;  2XOC A;  3M7K A;  3ASL A;  4LJN A;  4F1P A;  3EB5 A;  2CON A;  4AVX A;  3RTR B;  2C2V S;  4V3K C;  2ECJ A;  2KFT A;  5D1M B;  3PUR A;  2VP7 A;  5SVI A;  2VJF B;  2UZG A;  3T9K A;  4B86 C;  5EYA F;  1WEO A;  2Y1N A;  2LGV A;  2JRJ A;  3JUE A;  4MVT A;  3LQI A;  1BOR A;  2D8S A;  2XOZ A;  3KV6 A;  3ZPV E;  2G43 A;  2CSV A;  3LJU X;  4YBM A;  2K1J A;  5JG6 A;  4OGC A;  4MSX A;  4BHW A;  4TKP B;  3LQJ A;  2ECV A;  2EA6 A;  2QJ0 A;  3PUQ A;  2MUM A;  4GNF A;  2H0D B;  5H1T A;  2YQM A;  2MKE A;  4LAD B;  5FB0 A;  5H1U A;  2FD4 A;  2VPG A;  4X3G A;  2VPE A;  2DJA A;  4AYC A;  2JMJ A;  2YU4 A;  5TDR A;  1MM3 A;  2P57 A;  1VD4 A;  2M85 A;  3H7H A;  1WEP A;  3DPL R;  2MA5 A;  3PLW A;  5AIU A;  1HYJ A;  2ECG A;  2VPD A;  3N9Q A;  4YC9 A;  4YBT A;  4A4C A;  3O36 A;  2MIQ A;  5K3Q A;  4GND A;  5KH9 A;  4R7E A;  2PNX A;  2H0D A;  1DVP A;  2Y1M A;  5B79 A;  1X4U A;  2VNF A;  2YHO A;  2LGG A;  2L80 A;  2B0O E;  4WA6 A;  4I7C A;  2NAA A;  2L75 A;  5B78 A;  3M62 A;  4O62 A;  4PTB A;  2MA6 A;  5G0F A;  3DWD A;  4P5O B;  3T6R A;  3LDY A;  5TRB A;  2M13 A;  4OGE A;  2LAU A;  4YAD A;  2YSM A;  2AN6 A;  3KQI A;  1G25 A;  2OXQ C;  5J3X A;  5B76 A;  5D1K B;  5FER A;  2KWO A;  2C2L A;  1Z2Q A;  2K4D A;  2LGK A;  5FEY A;  2YHN A;  2QIZ A;  1LDJ B;  3FEH A;  2RSD A;  5G05 B;  5SVY A;  2YRE A;  1WEN A;  2XOY A;  4R8P K;  2G45 A;  5LKX A;  5LCW B;  4L7X A;  4N4F A;  4XI1 A;  5I3L A;  5H9M A;  2QIC A;  2JMI A;  3O70 A;  2F6N A;  4N3W A;  3LRQ A;  1Z60 A;  3HTK C;  2M6M A;  1V87 A;  3Q1D A;  3RPG B;  2KU3 A;  3GL6 A;  4B7Y C;  5H1V A;  2XP0 A;  1WEU A;  2FUU A;  3KNV A;  5SVI B;  4UP0 A;  1WES A;  1WE9 A;  2FFW A;  2CRW A;  2L7P A;  2G6Q A;  4GNE A;  4Z0O A;  2JM3 A;  3ZPV 1;  4O64 A;  1X4J A;  4W4U A;  4WZ3 B;  4FJC A;  2VJE B;  5AIT A;  2I50 A;  1E4U A;  2VPB A;  4QQ4 A;  3KV5 A;  2XEU A;  2YSJ A;  1WGM A;  1WFK A;  2MD8 C;  2ECT A;  3GV4 A;  5B8D A;  2LV9 A;  3ZVZ B;  4AYC B;  2KYU A;  4CA1 A;  3L1Z B;  1WIM A;  3U5O A;  1VFY A;  4YBS A;  1XWH A;  4LK9 A;  3KDE C;  3PHD A;  2HYE D;  1X4I A;  4S3O B;  4UP5 A;  1WEE A;  3HCS A;  3FM8 C;  2OWA A;  1IYM A;  2JUN A;  1RMD A;  4GNG A;  3LQH A;  2KWN A;  2KRE A;  3HCT A;  3FAO A;  4CCG X;  4ZDT A;  3L11 A;  3DDT A;  2JMD A;  3MDB C;  3E2D A;  1VYX A;  3N9P A;  3O37 A;  2KGI A;  5C13 A;  2YW8 A;  1T1H A;  3QZV A;  4AP4 A;  2RR4 A;  1HYI A;  2VJF A;  2KKX A;  2KIZ A;  4LLB A;  3DQV R;  3RPG C;  4H9D A;  2PUY A;  4R2Y A;  3EB6 A;  4ZUX U;  2YUR A;  3O35 A;  3N9L A;  1MM2 A;  2CRR A;  4I7B A;  3MHS A;  4IC2 A;  2E6S A;  3N9O A;  4NN2 A;  3SOU A;  5FB1 A;  5B77 A;  2ECN A;  3ZYQ A;  2F6J A;  2MT5 A;  5KH7 A;  3T7L A;  3ZVY A;  2YVR A;  2M3H A;  2RI7 A;  5G04 B;  4FO9 A;  2KE1 A;  3U5P A;  2KKY A;  2CSY A;  2E6R A;  4IC3 A;  2ECI A;  1WEQ A;  2IDA A;  3SUB A;  5LKZ A;  3O7A A;  4A0C D;  3O33 A;  5D1L B;  2CKL A;  1N87 A;  2YT5 A;  3MHH A;  5C11 A;  1F62 A;  3U5M A;  2EOD A;  3O34 A;  2L5U A;  4WZ2 A;  2LN0 A;  2YUC A;  1JOC A;  4ZQL A;  2CSZ A;  3M63 A;  4C9Z A;  2D8U A;  2L0B A;  5TAB A;  2Y43 A;  1MBM A;  2CKL B;  5DIN A;  2ZET C;  3N9M A;  3NG2 A;  2BAY A;  3N9N A;  1WEV A;  4BBQ A;  2HDP A;  2MD7 B;  2K16 A;  3SOW A;  5LKU A;  1JM7 A;  2MNZ A;  1DCQ A;  3ZNI A;  3FAN A;  2IQJ A;  5KH3 A;  1U6G B;  3ZTG A;  3FL2 A;  4UI9 B;  4WZ0 A;  3U5N A;  2DX8 A;  5TDW A;  1FBV A;  4GB0 A;  3VK6 A;  4FIP A;  2K17 A;  4QF2 A;  2E61 A;  3LVQ E;  2LRI C;  3V43 A;  4YAX A;  1FP0 A;  4QF3 A;  3SHB A;  3SOX A;  4YAB A;  3C6W A;  1LDK C;  5DKA A; 
#chains in the Genus database with same CATH homology
 1Z6U A;  2MNY A;  2L43 A;  2FSA A;  2XB1 A;  4Q6F A;  2ECW A;  2KWJ A;  1WEM A;  2CT2 A;  4L58 A;  3IHP A;  4I7D A;  1ZBD B;  2KR4 A;  2KWK A;  2VJE A;  4FK5 A;  3HCU A;  5B75 A;  1CHC A;  4V3L C;  4LKA A;  2YQL A;  1WIL A;  2LGL A;  1WEW A;  2KGG A;  4A4B A;  4YAT A;  4AUQ B;  2LXH C;  2LQ6 A;  3L1X A;  4S3O C;  5LKT A;  1K2F A;  1JM7 B;  2M1R A;  2LDR A;  2F42 A;  2FUI A;  3I2D A;  5TBN A;  3C5K A;  2YYR A;  3M99 A;  2LXP C;  4PPE A;  4A49 A;  2EGP A;  4F52 B;  3ASL A;  4LJN A;  3EB5 A;  4AVX A;  3RTR B;  2C2V S;  4V3K C;  2ECJ A;  2KFT A;  5D1M B;  3PUR A;  2VP7 A;  2VJF B;  2UZG A;  4B86 C;  5EYA F;  1WEO A;  2Y1N A;  2LGV A;  2JRJ A;  4MVT A;  3LQI A;  1BOR A;  2D8S A;  3KV6 A;  3ZPV E;  2G43 A;  4YBM A;  2K1J A;  5JG6 A;  4MSX A;  4BHW A;  4TKP B;  3LQJ A;  2ECV A;  2EA6 A;  2QJ0 A;  3PUQ A;  2MUM A;  4GNF A;  2H0D B;  5H1T A;  2YQM A;  4LAD B;  5FB0 A;  5H1U A;  2VPG A;  4X3G A;  2VPE A;  4AYC A;  2JMJ A;  2YU4 A;  5TDR A;  1MM3 A;  1VD4 A;  2M85 A;  1WEP A;  3DPL R;  2MA5 A;  5AIU A;  1HYJ A;  2ECG A;  2VPD A;  3N9Q A;  4YC9 A;  4YBT A;  4A4C A;  3O36 A;  2MIQ A;  4GND A;  5KH9 A;  4R7E A;  2PNX A;  2H0D A;  1DVP A;  2Y1M A;  5B79 A;  1X4U A;  2VNF A;  2YHO A;  2LGG A;  2L80 A;  4WA6 A;  4I7C A;  2NAA A;  2L75 A;  5B78 A;  3M62 A;  4PTB A;  2MA6 A;  5G0F A;  3T6R A;  4P5O B;  5TRB A;  4YAD A;  2YSM A;  2AN6 A;  3KQI A;  1G25 A;  2OXQ C;  5J3X A;  5B76 A;  5D1K B;  5FER A;  2KWO A;  2C2L A;  1Z2Q A;  2K4D A;  2LGK A;  5FEY A;  2YHN A;  2QIZ A;  1LDJ B;  2RSD A;  5G05 B;  2YRE A;  1WEN A;  4R8P K;  2G45 A;  5LKX A;  5LCW B;  4L7X A;  4N4F A;  4XI1 A;  5I3L A;  5H9M A;  2QIC A;  2JMI A;  3O70 A;  2F6N A;  4N3W A;  3LRQ A;  1Z60 A;  3HTK C;  2M6M A;  1V87 A;  3RPG B;  2KU3 A;  3GL6 A;  4B7Y C;  5H1V A;  1WEU A;  2FUU A;  3KNV A;  4UP0 A;  1WES A;  1WE9 A;  2G6Q A;  4GNE A;  3ZPV 1;  4O64 A;  1X4J A;  4W4U A;  4WZ3 B;  4FJC A;  2VJE B;  5AIT A;  2I50 A;  1E4U A;  2VPB A;  3KV5 A;  2XEU A;  2YSJ A;  1WGM A;  1WFK A;  2MD8 C;  2ECT A;  3GV4 A;  5B8D A;  2LV9 A;  3ZVZ B;  4AYC B;  2KYU A;  4CA1 A;  3L1Z B;  1WIM A;  3U5O A;  1VFY A;  4YBS A;  1XWH A;  4LK9 A;  3PHD A;  2HYE D;  1X4I A;  4S3O B;  4UP5 A;  1WEE A;  3HCS A;  1IYM A;  1RMD A;  4GNG A;  3LQH A;  2KWN A;  2KRE A;  3HCT A;  4CCG X;  4ZDT A;  3L11 A;  2JMD A;  1VYX A;  3N9P A;  3O37 A;  2KGI A;  5C13 A;  2YW8 A;  1T1H A;  3QZV A;  4AP4 A;  1HYI A;  2VJF A;  2KIZ A;  4LLB A;  3DQV R;  3RPG C;  2PUY A;  4R2Y A;  3EB6 A;  4ZUX U;  2YUR A;  3O35 A;  3N9L A;  1MM2 A;  4I7B A;  3MHS A;  4IC2 A;  2E6S A;  3N9O A;  4NN2 A;  3SOU A;  5FB1 A;  5B77 A;  2ECN A;  3ZYQ A;  2F6J A;  2MT5 A;  5KH7 A;  3T7L A;  3ZVY A;  2M3H A;  2RI7 A;  5G04 B;  4FO9 A;  2KE1 A;  3U5P A;  2CSY A;  2E6R A;  4IC3 A;  2ECI A;  2IDA A;  1WEQ A;  5LKZ A;  3O7A A;  4A0C D;  3O33 A;  5D1L B;  2CKL A;  1N87 A;  2YT5 A;  3MHH A;  5C11 A;  1F62 A;  3U5M A;  2EOD A;  3O34 A;  2L5U A;  4WZ2 A;  2LN0 A;  2YUC A;  1JOC A;  4ZQL A;  2CSZ A;  3M63 A;  4C9Z A;  2L0B A;  5TAB A;  2Y43 A;  2CKL B;  5DIN A;  2ZET C;  3N9M A;  3NG2 A;  2BAY A;  3N9N A;  1WEV A;  4BBQ A;  2HDP A;  2MD7 B;  2K16 A;  3SOW A;  5LKU A;  1JM7 A;  2MNZ A;  3ZNI A;  5KH3 A;  1U6G B;  3ZTG A;  3FL2 A;  4UI9 B;  4WZ0 A;  3U5N A;  2DX8 A;  5TDW A;  1FBV A;  4GB0 A;  3VK6 A;  4FIP A;  2K17 A;  4QF2 A;  2LRI C;  3V43 A;  4YAX A;  1FP0 A;  4QF3 A;  3SHB A;  3SOX A;  4YAB A;  3C6W A;  1LDK C;  5DKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...