1WEQA

Solution structure of phd domain in phd finger protein 7
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
85
structure length
85
Chain Sequence
GSSGSSGELEPGAFSELYQRYRHCDAPICLYEQGRDSFEDEGRWRLILCATCGSHGTHRDCSSLRPNSKKWECNECLPASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PHD finger protein 7
publication title Solution structure of PHD domain in PHD finger protein 7
rcsb
source organism Mus musculus
total genus 3
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weqA00
5KH9A 2KGIA 2F6NA 4C9ZA 3O70A 2LGKA 2MUMA 1HYJA 5FB0A 4WZ0A 3ZPVE 1Z6UA 2CSZA 2EGPA 5LKTA 4A49A 4I7CA 2G6QA 3O37A 4ZDTA 2JMJA 3EB5A 3M63A 4R7EA 2AN6A 5D1KB 5H1TA 3T7LA 2E6RA 4FO9A 3KNVA 2CSYA 2YT5A 1HYIA 1WEQA 2K16A 4UI9B 5TDRA 3NG2A 2M85A 2PUYA 4A4CA 1WGMA 1Z60A 2YSJA 2M3HA 3PHDA 4LK9A 2YHNA 3L1ZB 2M6MA 4YADA 4TKPB 5KH7A 4UP5A 2EA6A 4QF2A 3PURA 4N3WA 3M62A 4YABA 1N87A 5AITA 2YHOA 2ZETC 5KH3A 3MHHA 2RSDA 5JG6A 3O33A 1CHCA 3ZPV1 4BHWA 5C13A 2VNFA 2QJ0A 2LN0A 3ZVYA 4LKAA 1WEPA 5I3LA 2LXPC 1IYMA 1VFYA 2LV9A 2LRIC 1JM7A 4GNFA 2YSMA 3KV6A 2G43A 2KFTA 5DKAA 1VYXA 2ECNA 2VJEA 3U5OA 4W4UA 4YBSA 4XI1A 4R8PK 2H0DA 2MT5A 5J3XA 1K2FA 1MM3A 3RPGB 3SOWA 3PUQA 2Y1MA 4CA1A 1JM7B 4GNGA 3DQVR 2MA5A 3ZYQA 1WIMA 2FSAA 4YATA 2YREA 2MA6A 3SOUA 2YQLA 4YC9A 2H0DB 3IHPA 4GB0A 1G25A 4AYCA 2YU4A 5TABA 2YUCA 1V87A 5LKZA 5D1MB 2LQ6A 4FIPA 3V43A 2ECWA 2I50A 5B76A 4IC2A 2M1RA 1WEOA 1T1HA 5TRBA 3O34A 4UP0A 3KV5A 3N9OA 5TDWA 2QIZA 3N9QA 4F52B 2K1JA 1VD4A 4AYCB 1WEVA 1X4JA 2MNYA 2VPDA 3T6RA 2QICA 2KR4A 1F62A 3SHBA 1WEEA 3LQIA 2VPGA 2LGVA 4YAXA 2ECGA 2LDRA 2ECTA 2G45A 2FUIA 2C2VS 2BAYA 2VJFB 3N9LA 4MSXA 3O35A 5H9MA 2PNXA 2MD7B 4L7XA 3LQHA 2MD8C 5B8DA 5AIUA 5G0FA 2ECIA 4V3LC 5DINA 2K4DA 2XEUA 3FL2A 4CCGX 2JMIA 4ZUXU 3SOXA 5TBNA 4GNDA 4S3OB 4AUQB 1WFKA 1FBVA 5LCWB 3N9MA 3GL6A 2ECVA 5H1VA 3L1XA 2KGGA 2JRJA 5D1LB 2Y43A 5G05B 2KWNA 2YW8A 3VK6A 3ZVZB 2F6JA 3ASLA 4GNEA 2DX8A 5LKXA 2VPBA 3N9PA 2L75A 1LDJB 3ZNIA 2YQMA 1WESA 3I2DA 4FJCA 5FERA 5LKUA 5H1UA 3M99A 4S3OC 3EB6A 3O36A 4YBTA 2C2LA 4LLBA 4WA6A 4FK5A 4AP4A 1MM2A 5B79A 2HYED 4R2YA 2L43A 1BORA 3ZTGA 2VJFA 3HCTA 3RPGC 2EODA 4O64A 2CKLB 4I7BA 5C11A 5G04B 1FP0A 2MNZA 2LGLA 5EYAF 1WEUA 5B75A 3DPLR 4I7DA 2F42A 2LGGA 5B77A 2L80A 3HCSA 2IDAA 4NN2A 1LDKC 3GV4A 2YURA 1E4UA 2KE1A 1X4IA 4ZQLA 2LXHC 1RMDA 1U6GB 2KYUA 5FB1A 2MIQA 4AVXA 3KQIA 1ZBDB 5B78A 1DVPA 3HCUA 4WZ3B 4A4BA 3U5PA 3U5NA 2XB1A 3C5KA 4N4FA 2KWKA 4PPEA 2YYRA 3U5MA 4PTBA 2NAAA 1XWHA 2KWJA 1WEWA 4BBQA 3QZVA 2K17A 2VP7A 2KIZA 2D8SA 5FEYA 4WZ2A 2FUUA 3N9NA 4B7YC 2JMDA 4IC3A 4YBMA 2KREA 1WE9A 4LADB 2HDPA 3HTKC 1X4UA 2OXQC 2CT2A 1Z2QA 1JOCA 2KWOA 2L0BA 4P5OB 4QF3A 3L11A 1WILA 3MHSA 4LJNA 2KU3A 2RI7A 4MVTA 2UZGA 3C6WA 2E6SA 2CKLA 4L58A 4X3GA 2Y1NA 2VPEA 3O7AA 1WENA 4Q6FA 3RTRB 2ECJA 4A0CD 2L5UA 3LQJA 2VJEB 3LRQA 1WEMA 4B86C 4V3KC
chains in the Genus database with same CATH superfamily
5KH9A 2KGIA 2F6NA 4C9ZA 2JUNA 3O70A 2LGKA 2MUMA 4F1PA 5FB0A 1HYJA 4WZ0A 4QQ4A 3ZPVE 1Z6UA 2CSZA 2IQJA 2EGPA 5LKTA 4A49A 4I7CA 2G6QA 3O37A 4ZDTA 2JMJA 3EB5A 3E2DA 3M63A 4R7EA 2AN6A 5D1KB 4Z0OA 2DSMA 5H1TA 3T7LA 2E6RA 4FO9A 3KNVA 2CSYA 2YT5A 1HYIA 1WEQA 2K16A 4UI9B 3SUBA 5TDRA 3NG2A 2M85A 2PUYA 4A4CA 1WGMA 1Z60A 3DWDA 3LDYA 2CRRA 4LK9A 2M3HA 2YSJA 3PHDA 2YHNA 3L1ZB 2M6MA 4YADA 4TKPB 4Z0RA 5KH7A 4UP5A 2EA6A 4QF2A 3PURA 4N3WA 3M7KA 3M62A 2XOYA 4YABA 1N87A 5AITA 2YHOA 2ZETC 5KH3A 3MHHA 2RSDA 5JG6A 3O33A 5SVIA 1CHCA 3ZPV1 4BHWA 5C13A 2VNFA 2QJ0A 2LN0A 3ZVYA 4LKAA 1WEPA 5I3LA 2LXPC 1IYMA 1VFYA 2LV9A 2LRIC 1JM7A 4GNFA 2FFWA 2YSMA 3KV6A 2G43A 2KFTA 5DKAA 1VYXA 2ECNA 2VJEA 3U5OA 4W4UA 4YBSA 4XI1A 4R8PK 2H0DA 5SVIB 2MT5A 2CSVA 5J3XA 1MBMA 1K2FA 3LJUX 1MM3A 3RPGB 5K3QA 3SOWA 3FAOA 3PUQA 2Y1MA 4CA1A 1JM7B 4GNGA 3DQVR 2E61A 2MA5A 3ZYQA 1WIMA 3Q1DA 2FSAA 4YATA 2YREA 2MA6A 3KDEC 3SOUA 2YQLA 4YC9A 2H0DB 3IHPA 4GB0A 1G25A 2B0OE 4AYCA 2CRWA 2YU4A 5TABA 2YUCA 1V87A 5LKZA 5D1MB 2LQ6A 4FIPA 3V43A 2ECWA 2I50A 5B76A 4IC2A 2M1RA 1WEOA 1T1HA 5TRBA 3O34A 4UP0A 3KV5A 3N9OA 5TDWA 2QIZA 3N9QA 4F52B 2MKEA 2D8UA 2K1JA 1VD4A 4AYCB 1WEVA 1X4JA 2MNYA 2VPDA 2DJAA 3T6RA 2QICA 2KR4A 1F62A 2XOZA 3SHBA 1WEEA 3LQIA 2VPGA 2LGVA 4YAXA 2ECGA 2KKXA 2LDRA 2ECTA 2G45A 2FUIA 2C2VS 2BAYA 3FM8C 2VJFB 3N9LA 4MSXA 3O35A 5H9MA 4OGEA 3FJUB 2PNXA 3MDBC 2MD7B 4L7XA 3LQHA 2MD8C 5B8DA 5AIUA 5G0FA 2ECIA 4V3LC 5DINA 2K4DA 2XEUA 3FL2A 4CCGX 2JMIA 4ZUXU 4O62A 3SOXA 5TBNA 4GNDA 4S3OB 3PLWA 2OWAA 4AUQB 1WFKA 3DDTA 1FBVA 5LCWB 3N9MA 3GL6A 3H7HA 2ECVA 5H1VA 3LVQE 3L1XA 2KGGA 2JRJA 5D1LB 2Y43A 3FEHA 5G05B 2KWNA 2YW8A 2RR4A 3LVRE 3VK6A 3ZVZB 2F6JA 3ASLA 4GNEA 2DX8A 5LKXA 2LAUA 2KKYA 2EGMA 2VPBA 5SVXA 4OGCA 3N9PA 2L75A 1LDJB 3ZNIA 2YQMA 1WESA 3I2DA 4FJCA 5FERA 5LKUA 5H1UA 3M99A 4S3OC 3EB6A 3O36A 4YBTA 2C2LA 4LLBA 4WA6A 4FK5A 4AP4A 3T9KA 2JM3A 1MM2A 5B79A 2HYED 4R2YA 2L43A 1BORA 1DCQA 2CONA 3ZTGA 2VJFA 3HCTA 3RPGC 2EODA 4O64A 2CKLB 4I7BA 5C11A 5G04B 1FP0A 2MNZA 2LGLA 5EYAF 1WEUA 5B75A 2FD4A 3DPLR 4I7DA 2F42A 2LGGA 5B77A 2L80A 3HCSA 2IDAA 4NN2A 1LDKC 3GV4A 2YURA 1E4UA 2KE1A 1X4IA 4ZQLA 2LXHC 1RMDA 1U6GB 2KYUA 5FB1A 2MIQA 4H9DA 4AVXA 3KQIA 1ZBDB 5B78A 1DVPA 3HCUA 4WZ3B 4A4BA 3U5PA 3U5NA 2XB1A 3C5KA 3FANA 4N4FA 2KWKA 4PPEA 2YYRA 3U5MA 3O47A 4PTBA 2NAAA 2YVRA 1XWHA 2KWJA 1WEWA 4BBQA 3QZVA 2K17A 2VP7A 2KIZA 2D8SA 2L7PA 5FEYA 4WZ2A 2FUUA 3N9NA 2P57A 4B7YC 2JMDA 4IC3A 2XOCA 4YBMA 2KREA 1WE9A 4LADB 2HDPA 3HTKC 1X4UA 2OXQC 2CT2A 1Z2QA 1JOCA 2KWOA 2L0BA 4P5OB 4QF3A 3L11A 1WILA 3MHSA 4LJNA 2KU3A 2RI7A 2M13A 5SVYA 4MVTA 2UZGA 3C6WA 2E6SA 3JUEA 2CKLA 4L58A 4X3GA 2Y1NA 2VPEA 3O7AA 1WENA 4Q6FA 3RTRB 2ECJA 4A0CD 2L5UA 3LQJA 2VJEB 3LRQA 2XP0A 1WEMA 4B86C 4V3KC 2EXUA
chains in the Genus database with same CATH topology
5KH9A 2KGIA 2F6NA 4C9ZA 3O70A 2LGKA 2MUMA 1HYJA 5FB0A 4WZ0A 3ZPVE 1Z6UA 2CSZA 2EGPA 5LKTA 4A49A 4I7CA 2G6QA 3O37A 4ZDTA 2JMJA 3EB5A 3M63A 4R7EA 2AN6A 5D1KB 5H1TA 3T7LA 2E6RA 4FO9A 3KNVA 2CSYA 2YT5A 1HYIA 1WEQA 2K16A 4UI9B 5TDRA 3NG2A 2M85A 2PUYA 4A4CA 1WGMA 1Z60A 2YSJA 2M3HA 3PHDA 4LK9A 2YHNA 3L1ZB 2M6MA 4YADA 4TKPB 5KH7A 4UP5A 2EA6A 4QF2A 3PURA 4N3WA 3M62A 4YABA 1N87A 5AITA 2YHOA 2ZETC 5KH3A 3MHHA 2RSDA 5JG6A 3O33A 1CHCA 3ZPV1 4BHWA 5C13A 2VNFA 2QJ0A 2LN0A 3ZVYA 4LKAA 1WEPA 5I3LA 2LXPC 1IYMA 1VFYA 2LV9A 2LRIC 1JM7A 4GNFA 2YSMA 3KV6A 2G43A 2KFTA 5DKAA 1VYXA 2ECNA 2VJEA 3U5OA 4W4UA 4YBSA 4XI1A 4R8PK 2H0DA 2MT5A 5J3XA 1K2FA 1MM3A 3RPGB 3SOWA 3PUQA 2Y1MA 4CA1A 1JM7B 4GNGA 3DQVR 2MA5A 3ZYQA 1WIMA 2FSAA 4YATA 2YREA 2MA6A 3SOUA 2YQLA 4YC9A 2H0DB 3IHPA 4GB0A 1G25A 4AYCA 2YU4A 5TABA 2YUCA 1V87A 5LKZA 5D1MB 2LQ6A 4FIPA 3V43A 2ECWA 2I50A 5B76A 4IC2A 2M1RA 1WEOA 1T1HA 5TRBA 3O34A 4UP0A 3KV5A 3N9OA 5TDWA 2QIZA 3N9QA 4F52B 2K1JA 1VD4A 4AYCB 1WEVA 1X4JA 2MNYA 2VPDA 3T6RA 2QICA 2KR4A 1F62A 3SHBA 1WEEA 3LQIA 2VPGA 2LGVA 4YAXA 2ECGA 2LDRA 2ECTA 2G45A 2FUIA 2C2VS 2BAYA 2VJFB 3N9LA 4MSXA 3O35A 5H9MA 2PNXA 2MD7B 4L7XA 3LQHA 2MD8C 5B8DA 5AIUA 5G0FA 2ECIA 4V3LC 5DINA 2K4DA 2XEUA 3FL2A 4CCGX 2JMIA 4ZUXU 3SOXA 5TBNA 4GNDA 4S3OB 4AUQB 1WFKA 1FBVA 5LCWB 3N9MA 3GL6A 2ECVA 5H1VA 3L1XA 2KGGA 2JRJA 5D1LB 2Y43A 5G05B 2KWNA 2YW8A 3VK6A 3ZVZB 2F6JA 3ASLA 4GNEA 2DX8A 5LKXA 2VPBA 3N9PA 2L75A 1LDJB 3ZNIA 2YQMA 1WESA 3I2DA 4FJCA 5FERA 5LKUA 5H1UA 3M99A 4S3OC 3EB6A 3O36A 4YBTA 2C2LA 4LLBA 4WA6A 4FK5A 4AP4A 1MM2A 5B79A 2HYED 4R2YA 2L43A 1BORA 3ZTGA 2VJFA 3HCTA 3RPGC 2EODA 4O64A 2CKLB 4I7BA 5C11A 5G04B 1FP0A 2MNZA 2LGLA 5EYAF 1WEUA 5B75A 3DPLR 4I7DA 2F42A 2LGGA 5B77A 2L80A 3HCSA 2IDAA 4NN2A 1LDKC 3GV4A 2YURA 1E4UA 2KE1A 1X4IA 4ZQLA 2LXHC 1RMDA 1U6GB 2KYUA 5FB1A 2MIQA 4AVXA 3KQIA 1ZBDB 5B78A 1DVPA 3HCUA 4WZ3B 4A4BA 3U5PA 3U5NA 2XB1A 3C5KA 4N4FA 2KWKA 4PPEA 2YYRA 3U5MA 4PTBA 2NAAA 1XWHA 2KWJA 1WEWA 4BBQA 3QZVA 2K17A 2VP7A 2KIZA 2D8SA 5FEYA 4WZ2A 2FUUA 3N9NA 4B7YC 2JMDA 4IC3A 4YBMA 2KREA 1WE9A 4LADB 2HDPA 3HTKC 1X4UA 2OXQC 2CT2A 1Z2QA 1JOCA 2KWOA 2L0BA 4P5OB 4QF3A 3L11A 1WILA 3MHSA 4LJNA 2KU3A 2RI7A 4MVTA 2UZGA 3C6WA 2E6SA 2CKLA 4L58A 4X3GA 2Y1NA 2VPEA 3O7AA 1WENA 4Q6FA 3RTRB 2ECJA 4A0CD 2L5UA 3LQJA 2VJEB 3LRQA 1WEMA 4B86C 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH9 A;  2KGI A;  2F6N A;  4C9Z A;  3O70 A;  2LGK A;  2MUM A;  1HYJ A;  5FB0 A;  4WZ0 A;  3ZPV E;  1Z6U A;  2CSZ A;  2EGP A;  5LKT A;  4A49 A;  4I7C A;  2G6Q A;  3O37 A;  4ZDT A;  2JMJ A;  3EB5 A;  3M63 A;  4R7E A;  2AN6 A;  5D1K B;  5H1T A;  3T7L A;  2E6R A;  4FO9 A;  3KNV A;  2CSY A;  2YT5 A;  1HYI A;  1WEQ A;  2K16 A;  4UI9 B;  5TDR A;  3NG2 A;  2M85 A;  2PUY A;  4A4C A;  1WGM A;  1Z60 A;  2YSJ A;  2M3H A;  3PHD A;  4LK9 A;  2YHN A;  3L1Z B;  2M6M A;  4YAD A;  4TKP B;  5KH7 A;  4UP5 A;  2EA6 A;  4QF2 A;  3PUR A;  4N3W A;  3M62 A;  4YAB A;  1N87 A;  5AIT A;  2YHO A;  2ZET C;  5KH3 A;  3MHH A;  2RSD A;  5JG6 A;  3O33 A;  1CHC A;  3ZPV 1;  4BHW A;  5C13 A;  2VNF A;  2QJ0 A;  2LN0 A;  3ZVY A;  4LKA A;  1WEP A;  5I3L A;  2LXP C;  1IYM A;  1VFY A;  2LV9 A;  2LRI C;  1JM7 A;  4GNF A;  2YSM A;  3KV6 A;  2G43 A;  2KFT A;  5DKA A;  1VYX A;  2ECN A;  2VJE A;  3U5O A;  4W4U A;  4YBS A;  4XI1 A;  4R8P K;  2H0D A;  2MT5 A;  5J3X A;  1K2F A;  1MM3 A;  3RPG B;  3SOW A;  3PUQ A;  2Y1M A;  4CA1 A;  1JM7 B;  4GNG A;  3DQV R;  2MA5 A;  3ZYQ A;  1WIM A;  2FSA A;  4YAT A;  2YRE A;  2MA6 A;  3SOU A;  2YQL A;  4YC9 A;  2H0D B;  3IHP A;  4GB0 A;  1G25 A;  4AYC A;  2YU4 A;  5TAB A;  2YUC A;  1V87 A;  5LKZ A;  5D1M B;  2LQ6 A;  4FIP A;  3V43 A;  2ECW A;  2I50 A;  5B76 A;  4IC2 A;  2M1R A;  1WEO A;  1T1H A;  5TRB A;  3O34 A;  4UP0 A;  3KV5 A;  3N9O A;  5TDW A;  2QIZ A;  3N9Q A;  4F52 B;  2K1J A;  1VD4 A;  4AYC B;  1WEV A;  1X4J A;  2MNY A;  2VPD A;  3T6R A;  2QIC A;  2KR4 A;  1F62 A;  3SHB A;  1WEE A;  3LQI A;  2VPG A;  2LGV A;  4YAX A;  2ECG A;  2LDR A;  2ECT A;  2G45 A;  2FUI A;  2C2V S;  2BAY A;  2VJF B;  3N9L A;  4MSX A;  3O35 A;  5H9M A;  2PNX A;  2MD7 B;  4L7X A;  3LQH A;  2MD8 C;  5B8D A;  5AIU A;  5G0F A;  2ECI A;  4V3L C;  5DIN A;  2K4D A;  2XEU A;  3FL2 A;  4CCG X;  2JMI A;  4ZUX U;  3SOX A;  5TBN A;  4GND A;  4S3O B;  4AUQ B;  1WFK A;  1FBV A;  5LCW B;  3N9M A;  3GL6 A;  2ECV A;  5H1V A;  3L1X A;  2KGG A;  2JRJ A;  5D1L B;  2Y43 A;  5G05 B;  2KWN A;  2YW8 A;  3VK6 A;  3ZVZ B;  2F6J A;  3ASL A;  4GNE A;  2DX8 A;  5LKX A;  2VPB A;  3N9P A;  2L75 A;  1LDJ B;  3ZNI A;  2YQM A;  1WES A;  3I2D A;  4FJC A;  5FER A;  5LKU A;  5H1U A;  3M99 A;  4S3O C;  3EB6 A;  3O36 A;  4YBT A;  2C2L A;  4LLB A;  4WA6 A;  4FK5 A;  4AP4 A;  1MM2 A;  5B79 A;  2HYE D;  4R2Y A;  2L43 A;  1BOR A;  3ZTG A;  2VJF A;  3HCT A;  3RPG C;  2EOD A;  4O64 A;  2CKL B;  4I7B A;  5C11 A;  5G04 B;  1FP0 A;  2MNZ A;  2LGL A;  5EYA F;  1WEU A;  5B75 A;  3DPL R;  4I7D A;  2F42 A;  2LGG A;  5B77 A;  2L80 A;  3HCS A;  2IDA A;  4NN2 A;  1LDK C;  3GV4 A;  2YUR A;  1E4U A;  2KE1 A;  1X4I A;  4ZQL A;  2LXH C;  1RMD A;  1U6G B;  2KYU A;  5FB1 A;  2MIQ A;  4AVX A;  3KQI A;  1ZBD B;  5B78 A;  1DVP A;  3HCU A;  4WZ3 B;  4A4B A;  3U5P A;  3U5N A;  2XB1 A;  3C5K A;  4N4F A;  2KWK A;  4PPE A;  2YYR A;  3U5M A;  4PTB A;  2NAA A;  1XWH A;  2KWJ A;  1WEW A;  4BBQ A;  3QZV A;  2K17 A;  2VP7 A;  2KIZ A;  2D8S A;  5FEY A;  4WZ2 A;  2FUU A;  3N9N A;  4B7Y C;  2JMD A;  4IC3 A;  4YBM A;  2KRE A;  1WE9 A;  4LAD B;  2HDP A;  3HTK C;  1X4U A;  2OXQ C;  2CT2 A;  1Z2Q A;  1JOC A;  2KWO A;  2L0B A;  4P5O B;  4QF3 A;  3L11 A;  1WIL A;  3MHS A;  4LJN A;  2KU3 A;  2RI7 A;  4MVT A;  2UZG A;  3C6W A;  2E6S A;  2CKL A;  4L58 A;  4X3G A;  2Y1N A;  2VPE A;  3O7A A;  1WEN A;  4Q6F A;  3RTR B;  2ECJ A;  4A0C D;  2L5U A;  3LQJ A;  2VJE B;  3LRQ A;  1WEM A;  4B86 C;  4V3K C; 
#chains in the Genus database with same CATH topology
 5KH9 A;  2KGI A;  2F6N A;  4C9Z A;  2JUN A;  3O70 A;  2LGK A;  2MUM A;  4F1P A;  5FB0 A;  1HYJ A;  4WZ0 A;  4QQ4 A;  3ZPV E;  1Z6U A;  2CSZ A;  2IQJ A;  2EGP A;  5LKT A;  4A49 A;  4I7C A;  2G6Q A;  3O37 A;  4ZDT A;  2JMJ A;  3EB5 A;  3E2D A;  3M63 A;  4R7E A;  2AN6 A;  5D1K B;  4Z0O A;  2DSM A;  5H1T A;  3T7L A;  2E6R A;  4FO9 A;  3KNV A;  2CSY A;  2YT5 A;  1HYI A;  1WEQ A;  2K16 A;  4UI9 B;  3SUB A;  5TDR A;  3NG2 A;  2M85 A;  2PUY A;  4A4C A;  1WGM A;  1Z60 A;  3DWD A;  3LDY A;  2CRR A;  4LK9 A;  2M3H A;  2YSJ A;  3PHD A;  2YHN A;  3L1Z B;  2M6M A;  4YAD A;  4TKP B;  4Z0R A;  5KH7 A;  4UP5 A;  2EA6 A;  4QF2 A;  3PUR A;  4N3W A;  3M7K A;  3M62 A;  2XOY A;  4YAB A;  1N87 A;  5AIT A;  2YHO A;  2ZET C;  5KH3 A;  3MHH A;  2RSD A;  5JG6 A;  3O33 A;  5SVI A;  1CHC A;  3ZPV 1;  4BHW A;  5C13 A;  2VNF A;  2QJ0 A;  2LN0 A;  3ZVY A;  4LKA A;  1WEP A;  5I3L A;  2LXP C;  1IYM A;  1VFY A;  2LV9 A;  2LRI C;  1JM7 A;  4GNF A;  2FFW A;  2YSM A;  3KV6 A;  2G43 A;  2KFT A;  5DKA A;  1VYX A;  2ECN A;  2VJE A;  3U5O A;  4W4U A;  4YBS A;  4XI1 A;  4R8P K;  2H0D A;  5SVI B;  2MT5 A;  2CSV A;  5J3X A;  1MBM A;  1K2F A;  3LJU X;  1MM3 A;  3RPG B;  5K3Q A;  3SOW A;  3FAO A;  3PUQ A;  2Y1M A;  4CA1 A;  1JM7 B;  4GNG A;  3DQV R;  2E61 A;  2MA5 A;  3ZYQ A;  1WIM A;  3Q1D A;  2FSA A;  4YAT A;  2YRE A;  2MA6 A;  3KDE C;  3SOU A;  2YQL A;  4YC9 A;  2H0D B;  3IHP A;  4GB0 A;  1G25 A;  2B0O E;  4AYC A;  2CRW A;  2YU4 A;  5TAB A;  2YUC A;  1V87 A;  5LKZ A;  5D1M B;  2LQ6 A;  4FIP A;  3V43 A;  2ECW A;  2I50 A;  5B76 A;  4IC2 A;  2M1R A;  1WEO A;  1T1H A;  5TRB A;  3O34 A;  4UP0 A;  3KV5 A;  3N9O A;  5TDW A;  2QIZ A;  3N9Q A;  4F52 B;  2MKE A;  2D8U A;  2K1J A;  1VD4 A;  4AYC B;  1WEV A;  1X4J A;  2MNY A;  2VPD A;  2DJA A;  3T6R A;  2QIC A;  2KR4 A;  1F62 A;  2XOZ A;  3SHB A;  1WEE A;  3LQI A;  2VPG A;  2LGV A;  4YAX A;  2ECG A;  2KKX A;  2LDR A;  2ECT A;  2G45 A;  2FUI A;  2C2V S;  2BAY A;  3FM8 C;  2VJF B;  3N9L A;  4MSX A;  3O35 A;  5H9M A;  4OGE A;  3FJU B;  2PNX A;  3MDB C;  2MD7 B;  4L7X A;  3LQH A;  2MD8 C;  5B8D A;  5AIU A;  5G0F A;  2ECI A;  4V3L C;  5DIN A;  2K4D A;  2XEU A;  3FL2 A;  4CCG X;  2JMI A;  4ZUX U;  4O62 A;  3SOX A;  5TBN A;  4GND A;  4S3O B;  3PLW A;  2OWA A;  4AUQ B;  1WFK A;  3DDT A;  1FBV A;  5LCW B;  3N9M A;  3GL6 A;  3H7H A;  2ECV A;  5H1V A;  3LVQ E;  3L1X A;  2KGG A;  2JRJ A;  5D1L B;  2Y43 A;  3FEH A;  5G05 B;  2KWN A;  2YW8 A;  2RR4 A;  3LVR E;  3VK6 A;  3ZVZ B;  2F6J A;  3ASL A;  4GNE A;  2DX8 A;  5LKX A;  2LAU A;  2KKY A;  2EGM A;  2VPB A;  5SVX A;  4OGC A;  3N9P A;  2L75 A;  1LDJ B;  3ZNI A;  2YQM A;  1WES A;  3I2D A;  4FJC A;  5FER A;  5LKU A;  5H1U A;  3M99 A;  4S3O C;  3EB6 A;  3O36 A;  4YBT A;  2C2L A;  4LLB A;  4WA6 A;  4FK5 A;  4AP4 A;  3T9K A;  2JM3 A;  1MM2 A;  5B79 A;  2HYE D;  4R2Y A;  2L43 A;  1BOR A;  1DCQ A;  2CON A;  3ZTG A;  2VJF A;  3HCT A;  3RPG C;  2EOD A;  4O64 A;  2CKL B;  4I7B A;  5C11 A;  5G04 B;  1FP0 A;  2MNZ A;  2LGL A;  5EYA F;  1WEU A;  5B75 A;  2FD4 A;  3DPL R;  4I7D A;  2F42 A;  2LGG A;  5B77 A;  2L80 A;  3HCS A;  2IDA A;  4NN2 A;  1LDK C;  3GV4 A;  2YUR A;  1E4U A;  2KE1 A;  1X4I A;  4ZQL A;  2LXH C;  1RMD A;  1U6G B;  2KYU A;  5FB1 A;  2MIQ A;  4H9D A;  4AVX A;  3KQI A;  1ZBD B;  5B78 A;  1DVP A;  3HCU A;  4WZ3 B;  4A4B A;  3U5P A;  3U5N A;  2XB1 A;  3C5K A;  3FAN A;  4N4F A;  2KWK A;  4PPE A;  2YYR A;  3U5M A;  3O47 A;  4PTB A;  2NAA A;  2YVR A;  1XWH A;  2KWJ A;  1WEW A;  4BBQ A;  3QZV A;  2K17 A;  2VP7 A;  2KIZ A;  2D8S A;  2L7P A;  5FEY A;  4WZ2 A;  2FUU A;  3N9N A;  2P57 A;  4B7Y C;  2JMD A;  4IC3 A;  2XOC A;  4YBM A;  2KRE A;  1WE9 A;  4LAD B;  2HDP A;  3HTK C;  1X4U A;  2OXQ C;  2CT2 A;  1Z2Q A;  1JOC A;  2KWO A;  2L0B A;  4P5O B;  4QF3 A;  3L11 A;  1WIL A;  3MHS A;  4LJN A;  2KU3 A;  2RI7 A;  2M13 A;  5SVY A;  4MVT A;  2UZG A;  3C6W A;  2E6S A;  3JUE A;  2CKL A;  4L58 A;  4X3G A;  2Y1N A;  2VPE A;  3O7A A;  1WEN A;  4Q6F A;  3RTR B;  2ECJ A;  4A0C D;  2L5U A;  3LQJ A;  2VJE B;  3LRQ A;  2XP0 A;  1WEM A;  4B86 C;  4V3K C;  2EXU A; 
#chains in the Genus database with same CATH homology
 5KH9 A;  2KGI A;  2F6N A;  4C9Z A;  3O70 A;  2LGK A;  2MUM A;  1HYJ A;  5FB0 A;  4WZ0 A;  3ZPV E;  1Z6U A;  2CSZ A;  2EGP A;  5LKT A;  4A49 A;  4I7C A;  2G6Q A;  3O37 A;  4ZDT A;  2JMJ A;  3EB5 A;  3M63 A;  4R7E A;  2AN6 A;  5D1K B;  5H1T A;  3T7L A;  2E6R A;  4FO9 A;  3KNV A;  2CSY A;  2YT5 A;  1HYI A;  1WEQ A;  2K16 A;  4UI9 B;  5TDR A;  3NG2 A;  2M85 A;  2PUY A;  4A4C A;  1WGM A;  1Z60 A;  2YSJ A;  2M3H A;  3PHD A;  4LK9 A;  2YHN A;  3L1Z B;  2M6M A;  4YAD A;  4TKP B;  5KH7 A;  4UP5 A;  2EA6 A;  4QF2 A;  3PUR A;  4N3W A;  3M62 A;  4YAB A;  1N87 A;  5AIT A;  2YHO A;  2ZET C;  5KH3 A;  3MHH A;  2RSD A;  5JG6 A;  3O33 A;  1CHC A;  3ZPV 1;  4BHW A;  5C13 A;  2VNF A;  2QJ0 A;  2LN0 A;  3ZVY A;  4LKA A;  1WEP A;  5I3L A;  2LXP C;  1IYM A;  1VFY A;  2LV9 A;  2LRI C;  1JM7 A;  4GNF A;  2YSM A;  3KV6 A;  2G43 A;  2KFT A;  5DKA A;  1VYX A;  2ECN A;  2VJE A;  3U5O A;  4W4U A;  4YBS A;  4XI1 A;  4R8P K;  2H0D A;  2MT5 A;  5J3X A;  1K2F A;  1MM3 A;  3RPG B;  3SOW A;  3PUQ A;  2Y1M A;  4CA1 A;  1JM7 B;  4GNG A;  3DQV R;  2MA5 A;  3ZYQ A;  1WIM A;  2FSA A;  4YAT A;  2YRE A;  2MA6 A;  3SOU A;  2YQL A;  4YC9 A;  2H0D B;  3IHP A;  4GB0 A;  1G25 A;  4AYC A;  2YU4 A;  5TAB A;  2YUC A;  1V87 A;  5LKZ A;  5D1M B;  2LQ6 A;  4FIP A;  3V43 A;  2ECW A;  2I50 A;  5B76 A;  4IC2 A;  2M1R A;  1WEO A;  1T1H A;  5TRB A;  3O34 A;  4UP0 A;  3KV5 A;  3N9O A;  5TDW A;  2QIZ A;  3N9Q A;  4F52 B;  2K1J A;  1VD4 A;  4AYC B;  1WEV A;  1X4J A;  2MNY A;  2VPD A;  3T6R A;  2QIC A;  2KR4 A;  1F62 A;  3SHB A;  1WEE A;  3LQI A;  2VPG A;  2LGV A;  4YAX A;  2ECG A;  2LDR A;  2ECT A;  2G45 A;  2FUI A;  2C2V S;  2BAY A;  2VJF B;  3N9L A;  4MSX A;  3O35 A;  5H9M A;  2PNX A;  2MD7 B;  4L7X A;  3LQH A;  2MD8 C;  5B8D A;  5AIU A;  5G0F A;  2ECI A;  4V3L C;  5DIN A;  2K4D A;  2XEU A;  3FL2 A;  4CCG X;  2JMI A;  4ZUX U;  3SOX A;  5TBN A;  4GND A;  4S3O B;  4AUQ B;  1WFK A;  1FBV A;  5LCW B;  3N9M A;  3GL6 A;  2ECV A;  5H1V A;  3L1X A;  2KGG A;  2JRJ A;  5D1L B;  2Y43 A;  5G05 B;  2KWN A;  2YW8 A;  3VK6 A;  3ZVZ B;  2F6J A;  3ASL A;  4GNE A;  2DX8 A;  5LKX A;  2VPB A;  3N9P A;  2L75 A;  1LDJ B;  3ZNI A;  2YQM A;  1WES A;  3I2D A;  4FJC A;  5FER A;  5LKU A;  5H1U A;  3M99 A;  4S3O C;  3EB6 A;  3O36 A;  4YBT A;  2C2L A;  4LLB A;  4WA6 A;  4FK5 A;  4AP4 A;  1MM2 A;  5B79 A;  2HYE D;  4R2Y A;  2L43 A;  1BOR A;  3ZTG A;  2VJF A;  3HCT A;  3RPG C;  2EOD A;  4O64 A;  2CKL B;  4I7B A;  5C11 A;  5G04 B;  1FP0 A;  2MNZ A;  2LGL A;  5EYA F;  1WEU A;  5B75 A;  3DPL R;  4I7D A;  2F42 A;  2LGG A;  5B77 A;  2L80 A;  3HCS A;  2IDA A;  4NN2 A;  1LDK C;  3GV4 A;  2YUR A;  1E4U A;  2KE1 A;  1X4I A;  4ZQL A;  2LXH C;  1RMD A;  1U6G B;  2KYU A;  5FB1 A;  2MIQ A;  4AVX A;  3KQI A;  1ZBD B;  5B78 A;  1DVP A;  3HCU A;  4WZ3 B;  4A4B A;  3U5P A;  3U5N A;  2XB1 A;  3C5K A;  4N4F A;  2KWK A;  4PPE A;  2YYR A;  3U5M A;  4PTB A;  2NAA A;  1XWH A;  2KWJ A;  1WEW A;  4BBQ A;  3QZV A;  2K17 A;  2VP7 A;  2KIZ A;  2D8S A;  5FEY A;  4WZ2 A;  2FUU A;  3N9N A;  4B7Y C;  2JMD A;  4IC3 A;  4YBM A;  2KRE A;  1WE9 A;  4LAD B;  2HDP A;  3HTK C;  1X4U A;  2OXQ C;  2CT2 A;  1Z2Q A;  1JOC A;  2KWO A;  2L0B A;  4P5O B;  4QF3 A;  3L11 A;  1WIL A;  3MHS A;  4LJN A;  2KU3 A;  2RI7 A;  4MVT A;  2UZG A;  3C6W A;  2E6S A;  2CKL A;  4L58 A;  4X3G A;  2Y1N A;  2VPE A;  3O7A A;  1WEN A;  4Q6F A;  3RTR B;  2ECJ A;  4A0C D;  2L5U A;  3LQJ A;  2VJE B;  3LRQ A;  1WEM A;  4B86 C;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...