1WEQA

Solution structure of phd domain in phd finger protein 7
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGELEPGAFSELYQRYRHCDAPICLYEQGRDSFEDEGRWRLILCATCGSHGTHRDCSSLRPNSKKWECNECLPASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 7
publication title Solution structure of PHD domain in PHD finger protein 7
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 3
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weqA00
2MNZA 3O70A 1LDKC 4UI9B 5TABA 4YBMA 2MIQA 3U5NA 3LQIA 3ZPV1 4FK5A 2HYED 2KIZA 2VPBA 4AYCA 4I7CA 2JRJA 1VD4A 3ZVZB 2K16A 3SOUA 2EA6A 5LKTA 2XEUA 3N9QA 2FUUA 1WGMA 1IYMA 2LGKA 4UP0A 3SOWA 4WZ2A 3FL2A 4P5OB 3HTKC 2KR4A 2L0BA 4FO9A 1WILA 1Z60A 4IC3A 2ECGA 4FJCA 2JMIA 1Z6UA 5B77A 2AN6A 2MD8C 2YQMA 3I2DA 4BHWA 1X4UA 2VPDA 2XB1A 2ECTA 4QF3A 4R2YA 5LCWB 2VPEA 4LLBA 2KU3A 2Y43A 5LKXA 2F6NA 2LV9A 2ECNA 1MM3A 3N9MA 4LADB 4B86C 2YSMA 2FSAA 2M85A 2MNYA 3T6RA 5D1KB 2MD7B 2Y1MA 3LQJA 4V3LC 2RI7A 2K1JA 3O33A 1WESA 2YT5A 1X4IA 5DKAA 2ECVA 4I7DA 3M99A 3O37A 5H1UA 1WFKA 2DX8A 5H1TA 4A4BA 1N87A 3HCTA 1Z2QA 3GV4A 3GL6A 5TBNA 1K2FA 4WZ0A 3N9PA 2KWKA 2CKLA 1JM7A 2F42A 4GB0A 4GNDA 4PPEA 5FB1A 3KV5A 4WZ3B 3M62A 3ZVYA 2MT5A 2PUYA 4IC2A 2RSDA 4NN2A 2EGPA 2M1RA 5G05B 1V87A 5DINA 2BAYA 4AP4A 4AYCB 2PNXA 5C11A 5B75A 2LQ6A 4A49A 3T7LA 5JG6A 5KH7A 2Y1NA 3O35A 2YHOA 5J3XA 3M63A 5KH3A 1G25A 2YUCA 2VJEB 3ASLA 2KWOA 2KWJA 2I50A 4MSXA 4XI1A 3KNVA 4A4CA 1RMDA 3EB5A 5AITA 3V43A 4UP5A 5H9MA 3ZTGA 1WEPA 1FBVA 5B79A 2C2LA 1X4JA 1WE9A 4I7BA 5I3LA 1HYIA 2YREA 2LXPC 2E6SA 2VJFB 2KYUA 2YU4A 3VK6A 2D8SA 2L43A 3L11A 2K4DA 2LN0A 2MA6A 4N3WA 2NAAA 1VFYA 1WEMA 3O7AA 4LK9A 2LGLA 2M3HA 2LDRA 4ZDTA 2KWNA 2C2VS 4PTBA 5FEYA 2LXHC 1WEWA 4Q6FA 2FUIA 1WEUA 2VNFA 3C6WA 4QF2A 2H0DA 3C5KA 2OXQC 5AIUA 2YYRA 2JMDA 3QZVA 3U5OA 2QIZA 4WA6A 2CT2A 2YW8A 3PURA 2K17A 3U5PA 3ZPVE 5B8DA 5FERA 5H1VA 4LKAA 3N9OA 3MHSA 4A0CD 4L58A 4F52B 1E4UA 4TKPB 3N9LA 1WENA 5D1LB 2VPGA 4CA1A 3HCUA 5TDRA 2E6RA 2ECIA 3KQIA 2UZGA 2KGGA 5LKZA 3RTRB 3LRQA 1XWHA 4GNGA 3RPGC 4GNFA 5TDWA 4C9ZA 2G6QA 5B76A 2MUMA 2KGIA 5G0FA 4YABA 2HDPA 4YC9A 1HYJA 4X3GA 2IDAA 2YHNA 3O36A 4O64A 1LDJB 2YQLA 4AUQB 3RPGB 2ECWA 1WIMA 2YURA 4GNEA 1DVPA 3MHHA 3SHBA 4R8PK 3U5MA 4MVTA 4YBTA 2VJEA 3DPLR 3EB6A 4YATA 2LGVA 4AVXA 2CSYA 1BORA 2QJ0A 4S3OC 1VYXA 4FIPA 5TRBA 3ZYQA 1WEEA 2QICA 3PHDA 2F6JA 1WEQA 5C13A 1WEVA 2L5UA 1FP0A 4V3KC 5D1MB 2LGGA 5G04B 5EYAF 1JOCA 2M6MA 2VJFA 3IHPA 4S3OB 3N9NA 3LQHA 4YADA 4CCGX 5KH9A 1F62A 5FB0A 4W4UA 4ZQLA 2ZETC 1MM2A 2VP7A 5B78A 2KREA 4BBQA 2H0DB 1CHCA 2LRIC 3SOXA 1ZBDB 2L80A 3L1XA 4YAXA 2G43A 4ZUXU 2ECJA 2CSZA 2YSJA 4L7XA 4N4FA 3KV6A 2KE1A 2CKLB 3NG2A 5LKUA 1JM7B 2KFTA 2L75A 2EODA 3ZNIA 2JMJA 2G45A 3PUQA 3O34A 4B7YC 1T1HA 3DQVR 4R7EA 2MA5A 1U6GB 3HCSA 4LJNA 3L1ZB 1WEOA 4YBSA
chains in the Genus database with same CATH superfamily
2MNZA 3O70A 1LDKC 5SVYA 4UI9B 5TABA 3DDTA 4YBMA 2MIQA 3U5NA 3LQIA 3ZPV1 4FK5A 2HYED 2KIZA 2XOCA 3JUEA 2VPBA 4AYCA 4I7CA 2JRJA 1VD4A 3ZVZB 2K16A 2IQJA 3FEHA 3SOUA 2EA6A 5LKTA 2XEUA 3N9QA 2FUUA 2JUNA 1WGMA 4O62A 1IYMA 2LGKA 4UP0A 3SOWA 4WZ2A 3FL2A 4P5OB 3HTKC 2KR4A 2L0BA 4FO9A 1WILA 2KKYA 1Z60A 4IC3A 2ECGA 4FJCA 2JMIA 2L7PA 1Z6UA 5B77A 2AN6A 2MD8C 2YQMA 2E61A 3E2DA 3I2DA 4BHWA 1X4UA 2VPDA 4F1PA 2XB1A 3DWDA 2ECTA 4QF3A 4R2YA 5LCWB 2VPEA 4LLBA 1DCQA 2CSVA 2KU3A 3MDBC 2Y43A 5LKXA 3LDYA 2F6NA 2LV9A 2ECNA 1MM3A 3N9MA 4LADB 4B86C 2YSMA 2FSAA 2M85A 2MNYA 4Z0RA 3T6RA 5D1KB 2MD7B 2Y1MA 3LQJA 4V3LC 2RI7A 2K1JA 3O33A 1WESA 2YT5A 1X4IA 5DKAA 2XP0A 2ECVA 4I7DA 3M99A 3O37A 5H1UA 1WFKA 2DX8A 5H1TA 4A4BA 1N87A 2RR4A 3HCTA 1Z2QA 3GV4A 3GL6A 5TBNA 1K2FA 4WZ0A 2JM3A 3N9PA 2KWKA 2CKLA 1JM7A 2F42A 4GB0A 4GNDA 4PPEA 5FB1A 3KV5A 4WZ3B 3M62A 3ZVYA 2MT5A 2PUYA 4IC2A 3KDEC 2RSDA 4NN2A 2EGPA 2M1RA 5G05B 1V87A 2CRRA 5DINA 2BAYA 4AP4A 4AYCB 2PNXA 5C11A 5B75A 2LQ6A 4A49A 3T7LA 5JG6A 5KH7A 2Y1NA 2CONA 3O35A 2YHOA 5J3XA 3M63A 5KH3A 1G25A 2YUCA 2VJEB 3ASLA 3SUBA 2KWOA 2KWJA 2I50A 4MSXA 4XI1A 3KNVA 4A4CA 1RMDA 3EB5A 5AITA 3V43A 4UP5A 5H9MA 3ZTGA 1WEPA 1FBVA 5B79A 2C2LA 1X4JA 1WE9A 2B0OE 4I7BA 3LJUX 5I3LA 1HYIA 2YREA 3H7HA 2LXPC 2E6SA 2VJFB 2KYUA 2YU4A 3VK6A 2D8SA 2L43A 3L11A 2K4DA 2LN0A 2MA6A 4N3WA 2NAAA 1VFYA 5SVIB 3FJUB 1WEMA 3O7AA 4LK9A 2LGLA 2M3HA 2LDRA 2OWAA 4ZDTA 2KWNA 2C2VS 5SVXA 4PTBA 5FEYA 2LXHC 2DJAA 1WEWA 4H9DA 4Q6FA 2FUIA 1WEUA 2VNFA 3C6WA 4QF2A 2H0DA 3C5KA 2OXQC 5AIUA 2FFWA 2YYRA 2JMDA 3QZVA 3U5OA 2QIZA 4WA6A 2CT2A 2YW8A 3PURA 2K17A 3U5PA 3Q1DA 3ZPVE 5B8DA 5FERA 5H1VA 4LKAA 3N9OA 2FD4A 3MHSA 4A0CD 4L58A 4F52B 1E4UA 4TKPB 3N9LA 1WENA 5D1LB 2VPGA 1MBMA 3FM8C 3HCUA 4CA1A 2D8UA 5TDRA 2E6RA 2ECIA 3KQIA 2UZGA 2KGGA 5LKZA 2LAUA 3RTRB 3LRQA 1XWHA 4GNGA 2XOZA 5K3QA 3RPGC 2EGMA 2DSMA 4GNFA 5TDWA 4C9ZA 2G6QA 5B76A 2MUMA 4QQ4A 2KGIA 5G0FA 4YABA 2HDPA 4YC9A 1HYJA 4X3GA 2IDAA 2YHNA 3O36A 4O64A 1LDJB 2YQLA 4AUQB 3RPGB 2ECWA 1WIMA 2YURA 4GNEA 1DVPA 3MHHA 3SHBA 4R8PK 3U5MA 4MVTA 4YBTA 2VJEA 3DPLR 3EB6A 4OGEA 4YATA 2LGVA 4AVXA 2MKEA 3M7KA 2CSYA 1BORA 2QJ0A 4S3OC 1VYXA 4FIPA 5TRBA 3ZYQA 1WEEA 2QICA 3PHDA 4OGCA 2F6JA 1WEQA 5C13A 3FANA 1WEVA 2L5UA 1FP0A 4V3KC 5D1MB 2LGGA 5G04B 5EYAF 1JOCA 2M6MA 2VJFA 3IHPA 4S3OB 3N9NA 3LQHA 4YADA 4Z0OA 4CCGX 5KH9A 1F62A 2EXUA 5FB0A 4W4UA 4ZQLA 2ZETC 3FAOA 3PLWA 1MM2A 2P57A 2VP7A 5B78A 2KREA 4BBQA 2H0DB 5SVIA 1CHCA 2LRIC 2XOYA 3SOXA 1ZBDB 2L80A 3L1XA 4YAXA 2G43A 3O47A 4ZUXU 2ECJA 2CSZA 2YSJA 4L7XA 4N4FA 3KV6A 3LVQE 2KE1A 2CKLB 3NG2A 5LKUA 1JM7B 3T9KA 2KFTA 2L75A 2EODA 2KKXA 3LVRE 3ZNIA 2JMJA 2G45A 3PUQA 3O34A 2CRWA 4B7YC 1T1HA 3DQVR 2YVRA 4R7EA 2MA5A 1U6GB 3HCSA 4LJNA 3L1ZB 1WEOA 4YBSA 2M13A
chains in the Genus database with same CATH topology
2MNZA 3O70A 1LDKC 4UI9B 5TABA 4YBMA 2MIQA 3U5NA 3LQIA 3ZPV1 4FK5A 2HYED 2KIZA 2VPBA 4AYCA 4I7CA 2JRJA 1VD4A 3ZVZB 2K16A 3SOUA 2EA6A 5LKTA 2XEUA 3N9QA 2FUUA 1WGMA 1IYMA 2LGKA 4UP0A 3SOWA 4WZ2A 3FL2A 4P5OB 3HTKC 2KR4A 2L0BA 4FO9A 1WILA 1Z60A 4IC3A 2ECGA 4FJCA 2JMIA 1Z6UA 5B77A 2AN6A 2MD8C 2YQMA 3I2DA 4BHWA 1X4UA 2VPDA 2XB1A 2ECTA 4QF3A 4R2YA 5LCWB 2VPEA 4LLBA 2KU3A 2Y43A 5LKXA 2F6NA 2LV9A 2ECNA 1MM3A 3N9MA 4LADB 4B86C 2YSMA 2FSAA 2M85A 2MNYA 3T6RA 5D1KB 2MD7B 2Y1MA 3LQJA 4V3LC 2RI7A 2K1JA 3O33A 1WESA 2YT5A 1X4IA 5DKAA 2ECVA 4I7DA 3M99A 3O37A 5H1UA 1WFKA 2DX8A 5H1TA 4A4BA 1N87A 3HCTA 1Z2QA 3GV4A 3GL6A 5TBNA 1K2FA 4WZ0A 3N9PA 2KWKA 2CKLA 1JM7A 2F42A 4GB0A 4GNDA 4PPEA 5FB1A 3KV5A 4WZ3B 3M62A 3ZVYA 2MT5A 2PUYA 4IC2A 2RSDA 4NN2A 2EGPA 2M1RA 5G05B 1V87A 5DINA 2BAYA 4AP4A 4AYCB 2PNXA 5C11A 5B75A 2LQ6A 4A49A 3T7LA 5JG6A 5KH7A 2Y1NA 3O35A 2YHOA 5J3XA 3M63A 5KH3A 1G25A 2YUCA 2VJEB 3ASLA 2KWOA 2KWJA 2I50A 4MSXA 4XI1A 3KNVA 4A4CA 1RMDA 3EB5A 5AITA 3V43A 4UP5A 5H9MA 3ZTGA 1WEPA 1FBVA 5B79A 2C2LA 1X4JA 1WE9A 4I7BA 5I3LA 1HYIA 2YREA 2LXPC 2E6SA 2VJFB 2KYUA 2YU4A 3VK6A 2D8SA 2L43A 3L11A 2K4DA 2LN0A 2MA6A 4N3WA 2NAAA 1VFYA 1WEMA 3O7AA 4LK9A 2LGLA 2M3HA 2LDRA 4ZDTA 2KWNA 2C2VS 4PTBA 5FEYA 2LXHC 1WEWA 4Q6FA 2FUIA 1WEUA 2VNFA 3C6WA 4QF2A 2H0DA 3C5KA 2OXQC 5AIUA 2YYRA 2JMDA 3QZVA 3U5OA 2QIZA 4WA6A 2CT2A 2YW8A 3PURA 2K17A 3U5PA 3ZPVE 5B8DA 5FERA 5H1VA 4LKAA 3N9OA 3MHSA 4A0CD 4L58A 4F52B 1E4UA 4TKPB 3N9LA 1WENA 5D1LB 2VPGA 4CA1A 3HCUA 5TDRA 2E6RA 2ECIA 3KQIA 2UZGA 2KGGA 5LKZA 3RTRB 3LRQA 1XWHA 4GNGA 3RPGC 4GNFA 5TDWA 4C9ZA 2G6QA 5B76A 2MUMA 2KGIA 5G0FA 4YABA 2HDPA 4YC9A 1HYJA 4X3GA 2IDAA 2YHNA 3O36A 4O64A 1LDJB 2YQLA 4AUQB 3RPGB 2ECWA 1WIMA 2YURA 4GNEA 1DVPA 3MHHA 3SHBA 4R8PK 3U5MA 4MVTA 4YBTA 2VJEA 3DPLR 3EB6A 4YATA 2LGVA 4AVXA 2CSYA 1BORA 2QJ0A 4S3OC 1VYXA 4FIPA 5TRBA 3ZYQA 1WEEA 2QICA 3PHDA 2F6JA 1WEQA 5C13A 1WEVA 2L5UA 1FP0A 4V3KC 5D1MB 2LGGA 5G04B 5EYAF 1JOCA 2M6MA 2VJFA 3IHPA 4S3OB 3N9NA 3LQHA 4YADA 4CCGX 5KH9A 1F62A 5FB0A 4W4UA 4ZQLA 2ZETC 1MM2A 2VP7A 5B78A 2KREA 4BBQA 2H0DB 1CHCA 2LRIC 3SOXA 1ZBDB 2L80A 3L1XA 4YAXA 2G43A 4ZUXU 2ECJA 2CSZA 2YSJA 4L7XA 4N4FA 3KV6A 2KE1A 2CKLB 3NG2A 5LKUA 1JM7B 2KFTA 2L75A 2EODA 3ZNIA 2JMJA 2G45A 3PUQA 3O34A 4B7YC 1T1HA 3DQVR 4R7EA 2MA5A 1U6GB 3HCSA 4LJNA 3L1ZB 1WEOA 4YBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNZ A;  3O70 A;  1LDK C;  4UI9 B;  5TAB A;  4YBM A;  2MIQ A;  3U5N A;  3LQI A;  3ZPV 1;  4FK5 A;  2HYE D;  2KIZ A;  2VPB A;  4AYC A;  4I7C A;  2JRJ A;  1VD4 A;  3ZVZ B;  2K16 A;  3SOU A;  2EA6 A;  5LKT A;  2XEU A;  3N9Q A;  2FUU A;  1WGM A;  1IYM A;  2LGK A;  4UP0 A;  3SOW A;  4WZ2 A;  3FL2 A;  4P5O B;  3HTK C;  2KR4 A;  2L0B A;  4FO9 A;  1WIL A;  1Z60 A;  4IC3 A;  2ECG A;  4FJC A;  2JMI A;  1Z6U A;  5B77 A;  2AN6 A;  2MD8 C;  2YQM A;  3I2D A;  4BHW A;  1X4U A;  2VPD A;  2XB1 A;  2ECT A;  4QF3 A;  4R2Y A;  5LCW B;  2VPE A;  4LLB A;  2KU3 A;  2Y43 A;  5LKX A;  2F6N A;  2LV9 A;  2ECN A;  1MM3 A;  3N9M A;  4LAD B;  4B86 C;  2YSM A;  2FSA A;  2M85 A;  2MNY A;  3T6R A;  5D1K B;  2MD7 B;  2Y1M A;  3LQJ A;  4V3L C;  2RI7 A;  2K1J A;  3O33 A;  1WES A;  2YT5 A;  1X4I A;  5DKA A;  2ECV A;  4I7D A;  3M99 A;  3O37 A;  5H1U A;  1WFK A;  2DX8 A;  5H1T A;  4A4B A;  1N87 A;  3HCT A;  1Z2Q A;  3GV4 A;  3GL6 A;  5TBN A;  1K2F A;  4WZ0 A;  3N9P A;  2KWK A;  2CKL A;  1JM7 A;  2F42 A;  4GB0 A;  4GND A;  4PPE A;  5FB1 A;  3KV5 A;  4WZ3 B;  3M62 A;  3ZVY A;  2MT5 A;  2PUY A;  4IC2 A;  2RSD A;  4NN2 A;  2EGP A;  2M1R A;  5G05 B;  1V87 A;  5DIN A;  2BAY A;  4AP4 A;  4AYC B;  2PNX A;  5C11 A;  5B75 A;  2LQ6 A;  4A49 A;  3T7L A;  5JG6 A;  5KH7 A;  2Y1N A;  3O35 A;  2YHO A;  5J3X A;  3M63 A;  5KH3 A;  1G25 A;  2YUC A;  2VJE B;  3ASL A;  2KWO A;  2KWJ A;  2I50 A;  4MSX A;  4XI1 A;  3KNV A;  4A4C A;  1RMD A;  3EB5 A;  5AIT A;  3V43 A;  4UP5 A;  5H9M A;  3ZTG A;  1WEP A;  1FBV A;  5B79 A;  2C2L A;  1X4J A;  1WE9 A;  4I7B A;  5I3L A;  1HYI A;  2YRE A;  2LXP C;  2E6S A;  2VJF B;  2KYU A;  2YU4 A;  3VK6 A;  2D8S A;  2L43 A;  3L11 A;  2K4D A;  2LN0 A;  2MA6 A;  4N3W A;  2NAA A;  1VFY A;  1WEM A;  3O7A A;  4LK9 A;  2LGL A;  2M3H A;  2LDR A;  4ZDT A;  2KWN A;  2C2V S;  4PTB A;  5FEY A;  2LXH C;  1WEW A;  4Q6F A;  2FUI A;  1WEU A;  2VNF A;  3C6W A;  4QF2 A;  2H0D A;  3C5K A;  2OXQ C;  5AIU A;  2YYR A;  2JMD A;  3QZV A;  3U5O A;  2QIZ A;  4WA6 A;  2CT2 A;  2YW8 A;  3PUR A;  2K17 A;  3U5P A;  3ZPV E;  5B8D A;  5FER A;  5H1V A;  4LKA A;  3N9O A;  3MHS A;  4A0C D;  4L58 A;  4F52 B;  1E4U A;  4TKP B;  3N9L A;  1WEN A;  5D1L B;  2VPG A;  4CA1 A;  3HCU A;  5TDR A;  2E6R A;  2ECI A;  3KQI A;  2UZG A;  2KGG A;  5LKZ A;  3RTR B;  3LRQ A;  1XWH A;  4GNG A;  3RPG C;  4GNF A;  5TDW A;  4C9Z A;  2G6Q A;  5B76 A;  2MUM A;  2KGI A;  5G0F A;  4YAB A;  2HDP A;  4YC9 A;  1HYJ A;  4X3G A;  2IDA A;  2YHN A;  3O36 A;  4O64 A;  1LDJ B;  2YQL A;  4AUQ B;  3RPG B;  2ECW A;  1WIM A;  2YUR A;  4GNE A;  1DVP A;  3MHH A;  3SHB A;  4R8P K;  3U5M A;  4MVT A;  4YBT A;  2VJE A;  3DPL R;  3EB6 A;  4YAT A;  2LGV A;  4AVX A;  2CSY A;  1BOR A;  2QJ0 A;  4S3O C;  1VYX A;  4FIP A;  5TRB A;  3ZYQ A;  1WEE A;  2QIC A;  3PHD A;  2F6J A;  1WEQ A;  5C13 A;  1WEV A;  2L5U A;  1FP0 A;  4V3K C;  5D1M B;  2LGG A;  5G04 B;  5EYA F;  1JOC A;  2M6M A;  2VJF A;  3IHP A;  4S3O B;  3N9N A;  3LQH A;  4YAD A;  4CCG X;  5KH9 A;  1F62 A;  5FB0 A;  4W4U A;  4ZQL A;  2ZET C;  1MM2 A;  2VP7 A;  5B78 A;  2KRE A;  4BBQ A;  2H0D B;  1CHC A;  2LRI C;  3SOX A;  1ZBD B;  2L80 A;  3L1X A;  4YAX A;  2G43 A;  4ZUX U;  2ECJ A;  2CSZ A;  2YSJ A;  4L7X A;  4N4F A;  3KV6 A;  2KE1 A;  2CKL B;  3NG2 A;  5LKU A;  1JM7 B;  2KFT A;  2L75 A;  2EOD A;  3ZNI A;  2JMJ A;  2G45 A;  3PUQ A;  3O34 A;  4B7Y C;  1T1H A;  3DQV R;  4R7E A;  2MA5 A;  1U6G B;  3HCS A;  4LJN A;  3L1Z B;  1WEO A;  4YBS A; 
#chains in the Genus database with same CATH topology
 2MNZ A;  3O70 A;  1LDK C;  5SVY A;  4UI9 B;  5TAB A;  3DDT A;  4YBM A;  2MIQ A;  3U5N A;  3LQI A;  3ZPV 1;  4FK5 A;  2HYE D;  2KIZ A;  2XOC A;  3JUE A;  2VPB A;  4AYC A;  4I7C A;  2JRJ A;  1VD4 A;  3ZVZ B;  2K16 A;  2IQJ A;  3FEH A;  3SOU A;  2EA6 A;  5LKT A;  2XEU A;  3N9Q A;  2FUU A;  2JUN A;  1WGM A;  4O62 A;  1IYM A;  2LGK A;  4UP0 A;  3SOW A;  4WZ2 A;  3FL2 A;  4P5O B;  3HTK C;  2KR4 A;  2L0B A;  4FO9 A;  1WIL A;  2KKY A;  1Z60 A;  4IC3 A;  2ECG A;  4FJC A;  2JMI A;  2L7P A;  1Z6U A;  5B77 A;  2AN6 A;  2MD8 C;  2YQM A;  2E61 A;  3E2D A;  3I2D A;  4BHW A;  1X4U A;  2VPD A;  4F1P A;  2XB1 A;  3DWD A;  2ECT A;  4QF3 A;  4R2Y A;  5LCW B;  2VPE A;  4LLB A;  1DCQ A;  2CSV A;  2KU3 A;  3MDB C;  2Y43 A;  5LKX A;  3LDY A;  2F6N A;  2LV9 A;  2ECN A;  1MM3 A;  3N9M A;  4LAD B;  4B86 C;  2YSM A;  2FSA A;  2M85 A;  2MNY A;  4Z0R A;  3T6R A;  5D1K B;  2MD7 B;  2Y1M A;  3LQJ A;  4V3L C;  2RI7 A;  2K1J A;  3O33 A;  1WES A;  2YT5 A;  1X4I A;  5DKA A;  2XP0 A;  2ECV A;  4I7D A;  3M99 A;  3O37 A;  5H1U A;  1WFK A;  2DX8 A;  5H1T A;  4A4B A;  1N87 A;  2RR4 A;  3HCT A;  1Z2Q A;  3GV4 A;  3GL6 A;  5TBN A;  1K2F A;  4WZ0 A;  2JM3 A;  3N9P A;  2KWK A;  2CKL A;  1JM7 A;  2F42 A;  4GB0 A;  4GND A;  4PPE A;  5FB1 A;  3KV5 A;  4WZ3 B;  3M62 A;  3ZVY A;  2MT5 A;  2PUY A;  4IC2 A;  3KDE C;  2RSD A;  4NN2 A;  2EGP A;  2M1R A;  5G05 B;  1V87 A;  2CRR A;  5DIN A;  2BAY A;  4AP4 A;  4AYC B;  2PNX A;  5C11 A;  5B75 A;  2LQ6 A;  4A49 A;  3T7L A;  5JG6 A;  5KH7 A;  2Y1N A;  2CON A;  3O35 A;  2YHO A;  5J3X A;  3M63 A;  5KH3 A;  1G25 A;  2YUC A;  2VJE B;  3ASL A;  3SUB A;  2KWO A;  2KWJ A;  2I50 A;  4MSX A;  4XI1 A;  3KNV A;  4A4C A;  1RMD A;  3EB5 A;  5AIT A;  3V43 A;  4UP5 A;  5H9M A;  3ZTG A;  1WEP A;  1FBV A;  5B79 A;  2C2L A;  1X4J A;  1WE9 A;  2B0O E;  4I7B A;  3LJU X;  5I3L A;  1HYI A;  2YRE A;  3H7H A;  2LXP C;  2E6S A;  2VJF B;  2KYU A;  2YU4 A;  3VK6 A;  2D8S A;  2L43 A;  3L11 A;  2K4D A;  2LN0 A;  2MA6 A;  4N3W A;  2NAA A;  1VFY A;  5SVI B;  3FJU B;  1WEM A;  3O7A A;  4LK9 A;  2LGL A;  2M3H A;  2LDR A;  2OWA A;  4ZDT A;  2KWN A;  2C2V S;  5SVX A;  4PTB A;  5FEY A;  2LXH C;  2DJA A;  1WEW A;  4H9D A;  4Q6F A;  2FUI A;  1WEU A;  2VNF A;  3C6W A;  4QF2 A;  2H0D A;  3C5K A;  2OXQ C;  5AIU A;  2FFW A;  2YYR A;  2JMD A;  3QZV A;  3U5O A;  2QIZ A;  4WA6 A;  2CT2 A;  2YW8 A;  3PUR A;  2K17 A;  3U5P A;  3Q1D A;  3ZPV E;  5B8D A;  5FER A;  5H1V A;  4LKA A;  3N9O A;  2FD4 A;  3MHS A;  4A0C D;  4L58 A;  4F52 B;  1E4U A;  4TKP B;  3N9L A;  1WEN A;  5D1L B;  2VPG A;  1MBM A;  3FM8 C;  3HCU A;  4CA1 A;  2D8U A;  5TDR A;  2E6R A;  2ECI A;  3KQI A;  2UZG A;  2KGG A;  5LKZ A;  2LAU A;  3RTR B;  3LRQ A;  1XWH A;  4GNG A;  2XOZ A;  5K3Q A;  3RPG C;  2EGM A;  2DSM A;  4GNF A;  5TDW A;  4C9Z A;  2G6Q A;  5B76 A;  2MUM A;  4QQ4 A;  2KGI A;  5G0F A;  4YAB A;  2HDP A;  4YC9 A;  1HYJ A;  4X3G A;  2IDA A;  2YHN A;  3O36 A;  4O64 A;  1LDJ B;  2YQL A;  4AUQ B;  3RPG B;  2ECW A;  1WIM A;  2YUR A;  4GNE A;  1DVP A;  3MHH A;  3SHB A;  4R8P K;  3U5M A;  4MVT A;  4YBT A;  2VJE A;  3DPL R;  3EB6 A;  4OGE A;  4YAT A;  2LGV A;  4AVX A;  2MKE A;  3M7K A;  2CSY A;  1BOR A;  2QJ0 A;  4S3O C;  1VYX A;  4FIP A;  5TRB A;  3ZYQ A;  1WEE A;  2QIC A;  3PHD A;  4OGC A;  2F6J A;  1WEQ A;  5C13 A;  3FAN A;  1WEV A;  2L5U A;  1FP0 A;  4V3K C;  5D1M B;  2LGG A;  5G04 B;  5EYA F;  1JOC A;  2M6M A;  2VJF A;  3IHP A;  4S3O B;  3N9N A;  3LQH A;  4YAD A;  4Z0O A;  4CCG X;  5KH9 A;  1F62 A;  2EXU A;  5FB0 A;  4W4U A;  4ZQL A;  2ZET C;  3FAO A;  3PLW A;  1MM2 A;  2P57 A;  2VP7 A;  5B78 A;  2KRE A;  4BBQ A;  2H0D B;  5SVI A;  1CHC A;  2LRI C;  2XOY A;  3SOX A;  1ZBD B;  2L80 A;  3L1X A;  4YAX A;  2G43 A;  3O47 A;  4ZUX U;  2ECJ A;  2CSZ A;  2YSJ A;  4L7X A;  4N4F A;  3KV6 A;  3LVQ E;  2KE1 A;  2CKL B;  3NG2 A;  5LKU A;  1JM7 B;  3T9K A;  2KFT A;  2L75 A;  2EOD A;  2KKX A;  3LVR E;  3ZNI A;  2JMJ A;  2G45 A;  3PUQ A;  3O34 A;  2CRW A;  4B7Y C;  1T1H A;  3DQV R;  2YVR A;  4R7E A;  2MA5 A;  1U6G B;  3HCS A;  4LJN A;  3L1Z B;  1WEO A;  4YBS A;  2M13 A; 
#chains in the Genus database with same CATH homology
 2MNZ A;  3O70 A;  1LDK C;  4UI9 B;  5TAB A;  4YBM A;  2MIQ A;  3U5N A;  3LQI A;  3ZPV 1;  4FK5 A;  2HYE D;  2KIZ A;  2VPB A;  4AYC A;  4I7C A;  2JRJ A;  1VD4 A;  3ZVZ B;  2K16 A;  3SOU A;  2EA6 A;  5LKT A;  2XEU A;  3N9Q A;  2FUU A;  1WGM A;  1IYM A;  2LGK A;  4UP0 A;  3SOW A;  4WZ2 A;  3FL2 A;  4P5O B;  3HTK C;  2KR4 A;  2L0B A;  4FO9 A;  1WIL A;  1Z60 A;  4IC3 A;  2ECG A;  4FJC A;  2JMI A;  1Z6U A;  5B77 A;  2AN6 A;  2MD8 C;  2YQM A;  3I2D A;  4BHW A;  1X4U A;  2VPD A;  2XB1 A;  2ECT A;  4QF3 A;  4R2Y A;  5LCW B;  2VPE A;  4LLB A;  2KU3 A;  2Y43 A;  5LKX A;  2F6N A;  2LV9 A;  2ECN A;  1MM3 A;  3N9M A;  4LAD B;  4B86 C;  2YSM A;  2FSA A;  2M85 A;  2MNY A;  3T6R A;  5D1K B;  2MD7 B;  2Y1M A;  3LQJ A;  4V3L C;  2RI7 A;  2K1J A;  3O33 A;  1WES A;  2YT5 A;  1X4I A;  5DKA A;  2ECV A;  4I7D A;  3M99 A;  3O37 A;  5H1U A;  1WFK A;  2DX8 A;  5H1T A;  4A4B A;  1N87 A;  3HCT A;  1Z2Q A;  3GV4 A;  3GL6 A;  5TBN A;  1K2F A;  4WZ0 A;  3N9P A;  2KWK A;  2CKL A;  1JM7 A;  2F42 A;  4GB0 A;  4GND A;  4PPE A;  5FB1 A;  3KV5 A;  4WZ3 B;  3M62 A;  3ZVY A;  2MT5 A;  2PUY A;  4IC2 A;  2RSD A;  4NN2 A;  2EGP A;  2M1R A;  5G05 B;  1V87 A;  5DIN A;  2BAY A;  4AP4 A;  4AYC B;  2PNX A;  5C11 A;  5B75 A;  2LQ6 A;  4A49 A;  3T7L A;  5JG6 A;  5KH7 A;  2Y1N A;  3O35 A;  2YHO A;  5J3X A;  3M63 A;  5KH3 A;  1G25 A;  2YUC A;  2VJE B;  3ASL A;  2KWO A;  2KWJ A;  2I50 A;  4MSX A;  4XI1 A;  3KNV A;  4A4C A;  1RMD A;  3EB5 A;  5AIT A;  3V43 A;  4UP5 A;  5H9M A;  3ZTG A;  1WEP A;  1FBV A;  5B79 A;  2C2L A;  1X4J A;  1WE9 A;  4I7B A;  5I3L A;  1HYI A;  2YRE A;  2LXP C;  2E6S A;  2VJF B;  2KYU A;  2YU4 A;  3VK6 A;  2D8S A;  2L43 A;  3L11 A;  2K4D A;  2LN0 A;  2MA6 A;  4N3W A;  2NAA A;  1VFY A;  1WEM A;  3O7A A;  4LK9 A;  2LGL A;  2M3H A;  2LDR A;  4ZDT A;  2KWN A;  2C2V S;  4PTB A;  5FEY A;  2LXH C;  1WEW A;  4Q6F A;  2FUI A;  1WEU A;  2VNF A;  3C6W A;  4QF2 A;  2H0D A;  3C5K A;  2OXQ C;  5AIU A;  2YYR A;  2JMD A;  3QZV A;  3U5O A;  2QIZ A;  4WA6 A;  2CT2 A;  2YW8 A;  3PUR A;  2K17 A;  3U5P A;  3ZPV E;  5B8D A;  5FER A;  5H1V A;  4LKA A;  3N9O A;  3MHS A;  4A0C D;  4L58 A;  4F52 B;  1E4U A;  4TKP B;  3N9L A;  1WEN A;  5D1L B;  2VPG A;  4CA1 A;  3HCU A;  5TDR A;  2E6R A;  2ECI A;  3KQI A;  2UZG A;  2KGG A;  5LKZ A;  3RTR B;  3LRQ A;  1XWH A;  4GNG A;  3RPG C;  4GNF A;  5TDW A;  4C9Z A;  2G6Q A;  5B76 A;  2MUM A;  2KGI A;  5G0F A;  4YAB A;  2HDP A;  4YC9 A;  1HYJ A;  4X3G A;  2IDA A;  2YHN A;  3O36 A;  4O64 A;  1LDJ B;  2YQL A;  4AUQ B;  3RPG B;  2ECW A;  1WIM A;  2YUR A;  4GNE A;  1DVP A;  3MHH A;  3SHB A;  4R8P K;  3U5M A;  4MVT A;  4YBT A;  2VJE A;  3DPL R;  3EB6 A;  4YAT A;  2LGV A;  4AVX A;  2CSY A;  1BOR A;  2QJ0 A;  4S3O C;  1VYX A;  4FIP A;  5TRB A;  3ZYQ A;  1WEE A;  2QIC A;  3PHD A;  2F6J A;  1WEQ A;  5C13 A;  1WEV A;  2L5U A;  1FP0 A;  4V3K C;  5D1M B;  2LGG A;  5G04 B;  5EYA F;  1JOC A;  2M6M A;  2VJF A;  3IHP A;  4S3O B;  3N9N A;  3LQH A;  4YAD A;  4CCG X;  5KH9 A;  1F62 A;  5FB0 A;  4W4U A;  4ZQL A;  2ZET C;  1MM2 A;  2VP7 A;  5B78 A;  2KRE A;  4BBQ A;  2H0D B;  1CHC A;  2LRI C;  3SOX A;  1ZBD B;  2L80 A;  3L1X A;  4YAX A;  2G43 A;  4ZUX U;  2ECJ A;  2CSZ A;  2YSJ A;  4L7X A;  4N4F A;  3KV6 A;  2KE1 A;  2CKL B;  3NG2 A;  5LKU A;  1JM7 B;  2KFT A;  2L75 A;  2EOD A;  3ZNI A;  2JMJ A;  2G45 A;  3PUQ A;  3O34 A;  4B7Y C;  1T1H A;  3DQV R;  4R7E A;  2MA5 A;  1U6G B;  3HCS A;  4LJN A;  3L1Z B;  1WEO A;  4YBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...