1WEQA

Solution structure of phd domain in phd finger protein 7
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
85
structure length
85
Chain Sequence
GSSGSSGELEPGAFSELYQRYRHCDAPICLYEQGRDSFEDEGRWRLILCATCGSHGTHRDCSSLRPNSKKWECNECLPASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 7
publication title Solution structure of PHD domain in PHD finger protein 7
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 3
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weqA00
2JMIA 2MD8C 2ECGA 2LXHC 1VYXA 4YBTA 5KH7A 2MNYA 4A49A 2MA6A 5FERA 4LLBA 2YYRA 2VNFA 1XWHA 2KR4A 3GL6A 4S3OB 3RPGB 1CHCA 3U5MA 3V43A 4WZ2A 4LKAA 2NAAA 5EYAF 3L1ZB 1BORA 3FL2A 3HCSA 2FUIA 2LV9A 1G25A 2LN0A 2L5UA 2L80A 3ZNIA 3SOUA 2KREA 3N9LA 3C5KA 1FP0A 3HCTA 4R2YA 4MVTA 2C2LA 4WZ0A 4A0CD 2YT5A 4XI1A 2KE1A 4W4UA 4B7YC 5LKZA 4PTBA 2YHNA 4AVXA 4ZUXU 5FEYA 1LDKC 1WEEA 3VK6A 2YSMA 1WFKA 4Q6FA 2YU4A 5H9MA 2LGGA 2LGVA 2VJFA 4YC9A 2YSJA 3ZTGA 3SOXA 4UP0A 3U5OA 2CSYA 4YBSA 1WEOA 3O7AA 3DQVR 3O35A 4O64A 5G0FA 1WE9A 3L1XA 4V3KC 4A4BA 4R8PK 2KWJA 4I7CA 1WIMA 2E6RA 4L7XA 4CCGX 1E4UA 2XEUA 4B86C 2JRJA 3SOWA 2YURA 4UI9B 4A4CA 2FSAA 2YW8A 3IHPA 3KQIA 2G6QA 3ZVZB 4YAXA 5J3XA 1F62A 5C13A 3O37A 1X4IA 3GV4A 2KGGA 2F6NA 3O33A 3SHBA 5LKTA 4C9ZA 5B75A 2RI7A 3PURA 2H0DB 2QJ0A 2ECVA 2D8SA 2KYUA 3T6RA 4GNEA 2IDAA 2M1RA 2F42A 3M62A 2VPEA 3N9PA 5FB1A 3PUQA 5D1KB 1T1HA 3M63A 2LXPC 1MM2A 2CT2A 2VPBA 1U6GB 3I2DA 3HTKC 3N9OA 4R7EA 3DPLR 2PNXA 5H1TA 1RMDA 3O70A 5TRBA 3KV6A 2MT5A 2Y1NA 3LQHA 5AIUA 2ECNA 3ZYQA 4FIPA 4CA1A 4IC3A 2YREA 2QICA 2KWOA 2YHOA 1ZBDB 5DINA 4BBQA 1FBVA 5B76A 2KU3A 3ASLA 4N4FA 2OXQC 2AN6A 3KV5A 2E6SA 1JM7B 2F6JA 3EB5A 4I7DA 2JMJA 5B79A 2G43A 2LQ6A 1V87A 1X4JA 2XB1A 2HYED 4QF2A 2KIZA 5D1LB 3QZVA 3U5NA 2M3HA 2LRIC 4GNGA 4MSXA 4X3GA 5TDRA 4WZ3B 2L0BA 2CKLB 5KH3A 4WA6A 2M85A 1LDJB 1VFYA 1WEMA 2MIQA 2LGKA 1Z2QA 3ZPVE 4ZQLA 4PPEA 1Z6UA 3EB6A 2MA5A 1N87A 2HDPA 2K16A 4IC2A 3LQJA 3N9MA 2K1JA 2BAYA 5B77A 4AYCA 2ECIA 3ZVYA 5LKUA 4FJCA 2VJEB 2VPGA 4F52B 4FO9A 2H0DA 2YUCA 4BHWA 4AYCB 5JG6A 3O36A 2Y43A 2K17A 4LK9A 2UZGA 1K2FA 1HYJA 1WESA 4GNDA 2MD7B 2PUYA 5KH9A 3M99A 1JOCA 4LADB 2EA6A 2I50A 4YADA 2ECJA 3U5PA 3HCUA 4FK5A 1WEQA 4N3WA 2LDRA 2ECTA 4AP4A 3N9NA 3PHDA 1WEVA 2DX8A 5G04B 1MM3A 3KNVA 1WGMA 5FB0A 2KWNA 1HYIA 5B78A 2RSDA 3C6WA 3L11A 4GNFA 4YATA 2ZETC 1JM7A 5I3LA 2L43A 4AUQB 5LKXA 4UP5A 4I7BA 5TBNA 3RTRB 4ZDTA 4GB0A 4YABA 2KGIA 2KWKA 2YQLA 3N9QA 1X4UA 1WILA 2JMDA 2L75A 2CKLA 3T7LA 5C11A 1WEPA 1DVPA 3RPGC 4S3OC 2KFTA 2ECWA 2VPDA 1WENA 5G05B 5TABA 4NN2A 2K4DA 2M6MA 3LQIA 1Z60A 5TDWA 3MHSA 4L58A 5H1UA 2MUMA 2VJEA 2EGPA 2LGLA 5H1VA 4LJNA 2FUUA 1WEWA 4QF3A 1WEUA 2Y1MA 5D1MB 2VJFB 3ZPV1 2VP7A 4V3LC 2CSZA 5DKAA 4TKPB 1IYMA 3NG2A 3MHHA 1VD4A 2G45A 2MNZA 5LCWB 3O34A 3LRQA 5B8DA 2YQMA 5AITA 2QIZA 4P5OB 2C2VS 2EODA 4YBMA
chains in the Genus database with same CATH superfamily
2JMIA 2MD8C 2ECGA 3O47A 4Z0RA 2LXHC 1VYXA 5SVIA 4YBTA 3MDBC 5KH7A 2MNYA 2FFWA 4A49A 2MA6A 5FERA 4LLBA 2YYRA 2VNFA 1XWHA 2KR4A 3GL6A 4S3OB 5SVIB 3RPGB 1CHCA 2JM3A 3U5MA 3V43A 3DDTA 4WZ2A 4LKAA 2NAAA 5EYAF 3L1ZB 1BORA 3FL2A 3HCSA 2FUIA 2LV9A 1G25A 2LN0A 3FJUB 2L5UA 2L80A 3ZNIA 3SOUA 2KREA 3N9LA 2DJAA 3C5KA 1FP0A 5K3QA 4YBMA 3HCTA 4R2YA 3LJUX 4MVTA 2C2LA 4WZ0A 4A0CD 2L7PA 2YT5A 2M13A 4XI1A 2KE1A 3LVQE 4W4UA 4B7YC 2RR4A 5LKZA 4PTBA 2YHNA 4AVXA 2XP0A 4ZUXU 5FEYA 3LDYA 1LDKC 1WEEA 3VK6A 2YSMA 1WFKA 4Q6FA 3SUBA 2YU4A 5H9MA 2LGGA 2LGVA 2KKYA 2VJFA 4YC9A 2YSJA 3ZTGA 3SOXA 4UP0A 3U5OA 2CSYA 4YBSA 1WEOA 3O7AA 3DQVR 3O35A 4O64A 5G0FA 1WE9A 3L1XA 2DSMA 4V3KC 4A4BA 4R8PK 2KWJA 4I7CA 1WIMA 2E6RA 4H9DA 4L7XA 4CCGX 1E4UA 2XEUA 3LVRE 4B86C 2JRJA 3SOWA 2OWAA 2YURA 4UI9B 4A4CA 2FSAA 2YW8A 3IHPA 3KQIA 2G6QA 3ZVZB 4YAXA 5J3XA 1F62A 5C13A 3O37A 2XOCA 1X4IA 2LAUA 2JUNA 3GV4A 2KGGA 2F6NA 4F1PA 3O33A 3SHBA 5LKTA 4C9ZA 5B75A 2RI7A 3PURA 2H0DB 2CSVA 2QJ0A 2ECVA 2D8SA 2KYUA 3T6RA 4GNEA 2IDAA 2M1RA 2F42A 3M62A 2VPEA 3N9PA 3FANA 1DCQA 2CONA 5FB1A 3PUQA 5D1KB 2MKEA 1T1HA 3M63A 2CRWA 2LXPC 1MM2A 2CT2A 2VPBA 2D8UA 1U6GB 3I2DA 3HTKC 3N9OA 3T9KA 4R7EA 3DPLR 2PNXA 5H1TA 1RMDA 3O70A 5TRBA 3KV6A 2MT5A 2Y1NA 3LQHA 5AIUA 2ECNA 3ZYQA 4FIPA 4CA1A 4IC3A 2YREA 2QICA 2KWOA 2YHOA 1ZBDB 5DINA 4BBQA 1FBVA 5B76A 2KU3A 3ASLA 4N4FA 2OXQC 2AN6A 3KV5A 2E6SA 1JM7B 2F6JA 3EB5A 4I7DA 2JMJA 5B79A 2G43A 4QQ4A 2LQ6A 1V87A 1X4JA 2XB1A 2HYED 2KKXA 4QF2A 2KIZA 5D1LB 3QZVA 3U5NA 2M3HA 2LRIC 4GNGA 4MSXA 4X3GA 5TDRA 4WZ3B 3H7HA 2L0BA 2CKLB 5KH3A 4WA6A 2M85A 1LDJB 1VFYA 1WEMA 2MIQA 2LGKA 1Z2QA 2CRRA 2XOYA 3ZPVE 4ZQLA 4PPEA 1Z6UA 3EB6A 2MA5A 1N87A 2HDPA 2K16A 4IC2A 3M7KA 3LQJA 3N9MA 2K1JA 2BAYA 5B77A 4AYCA 2ECIA 3ZVYA 5LKUA 4FJCA 2VJEB 2VPGA 4F52B 4FO9A 2H0DA 2YUCA 4BHWA 3Q1DA 4AYCB 5JG6A 3O36A 3FM8C 2Y43A 2K17A 4LK9A 2UZGA 1K2FA 1HYJA 1WESA 4GNDA 2MD7B 2PUYA 5KH9A 3M99A 1JOCA 4LADB 3PLWA 2EA6A 2IQJA 2I50A 3E2DA 4YADA 2ECJA 3U5PA 3HCUA 2B0OE 4FK5A 3KDEC 1WEQA 4N3WA 2LDRA 2ECTA 2FD4A 4AP4A 3N9NA 3DWDA 3PHDA 1WEVA 2DX8A 5G04B 1MM3A 2EGMA 3KNVA 1WGMA 5FB0A 2KWNA 1HYIA 5B78A 2RSDA 3C6WA 3L11A 4GNFA 4YATA 2ZETC 1JM7A 5I3LA 2L43A 4AUQB 5LKXA 4UP5A 4I7BA 5TBNA 3RTRB 2XOZA 4ZDTA 4GB0A 4YABA 2KGIA 2KWKA 2YQLA 3N9QA 1X4UA 1WILA 2JMDA 2L75A 2CKLA 3T7LA 4Z0OA 1WEPA 5C11A 1DVPA 3RPGC 4S3OC 2KFTA 2ECWA 5SVXA 2VPDA 1WENA 5G05B 2E61A 5TABA 4NN2A 2K4DA 2M6MA 3LQIA 1Z60A 5TDWA 3MHSA 4L58A 5H1UA 2MUMA 2EXUA 2VJEA 2EGPA 2LGLA 4OGEA 5H1VA 4LJNA 2FUUA 2P57A 1WEWA 4QF3A 1WEUA 2Y1MA 5D1MB 1MBMA 2VJFB 5SVYA 4O62A 3JUEA 3ZPV1 2VP7A 4V3LC 2CSZA 5DKAA 4TKPB 1IYMA 3NG2A 3MHHA 1VD4A 2G45A 2MNZA 5LCWB 3O34A 3LRQA 5B8DA 4OGCA 2YQMA 5AITA 2QIZA 4P5OB 2YVRA 2C2VS 3FAOA 2EODA 3FEHA
chains in the Genus database with same CATH topology
2JMIA 2MD8C 2ECGA 2LXHC 1VYXA 4YBTA 5KH7A 2MNYA 4A49A 2MA6A 5FERA 4LLBA 2YYRA 2VNFA 1XWHA 2KR4A 3GL6A 4S3OB 3RPGB 1CHCA 3U5MA 3V43A 4WZ2A 4LKAA 2NAAA 5EYAF 3L1ZB 1BORA 3FL2A 3HCSA 2FUIA 2LV9A 1G25A 2LN0A 2L5UA 2L80A 3ZNIA 3SOUA 2KREA 3N9LA 3C5KA 1FP0A 3HCTA 4R2YA 4MVTA 2C2LA 4WZ0A 4A0CD 2YT5A 4XI1A 2KE1A 4W4UA 4B7YC 5LKZA 4PTBA 2YHNA 4AVXA 4ZUXU 5FEYA 1LDKC 1WEEA 3VK6A 2YSMA 1WFKA 4Q6FA 2YU4A 5H9MA 2LGGA 2LGVA 2VJFA 4YC9A 2YSJA 3ZTGA 3SOXA 4UP0A 3U5OA 2CSYA 4YBSA 1WEOA 3O7AA 3DQVR 3O35A 4O64A 5G0FA 1WE9A 3L1XA 4V3KC 4A4BA 4R8PK 2KWJA 4I7CA 1WIMA 2E6RA 4L7XA 4CCGX 1E4UA 2XEUA 4B86C 2JRJA 3SOWA 2YURA 4UI9B 4A4CA 2FSAA 2YW8A 3IHPA 3KQIA 2G6QA 3ZVZB 4YAXA 5J3XA 1F62A 5C13A 3O37A 1X4IA 3GV4A 2KGGA 2F6NA 3O33A 3SHBA 5LKTA 4C9ZA 5B75A 2RI7A 3PURA 2H0DB 2QJ0A 2ECVA 2D8SA 2KYUA 3T6RA 4GNEA 2IDAA 2M1RA 2F42A 3M62A 2VPEA 3N9PA 5FB1A 3PUQA 5D1KB 1T1HA 3M63A 2LXPC 1MM2A 2CT2A 2VPBA 1U6GB 3I2DA 3HTKC 3N9OA 4R7EA 3DPLR 2PNXA 5H1TA 1RMDA 3O70A 5TRBA 3KV6A 2MT5A 2Y1NA 3LQHA 5AIUA 2ECNA 3ZYQA 4FIPA 4CA1A 4IC3A 2YREA 2QICA 2KWOA 2YHOA 1ZBDB 5DINA 4BBQA 1FBVA 5B76A 2KU3A 3ASLA 4N4FA 2OXQC 2AN6A 3KV5A 2E6SA 1JM7B 2F6JA 3EB5A 4I7DA 2JMJA 5B79A 2G43A 2LQ6A 1V87A 1X4JA 2XB1A 2HYED 4QF2A 2KIZA 5D1LB 3QZVA 3U5NA 2M3HA 2LRIC 4GNGA 4MSXA 4X3GA 5TDRA 4WZ3B 2L0BA 2CKLB 5KH3A 4WA6A 2M85A 1LDJB 1VFYA 1WEMA 2MIQA 2LGKA 1Z2QA 3ZPVE 4ZQLA 4PPEA 1Z6UA 3EB6A 2MA5A 1N87A 2HDPA 2K16A 4IC2A 3LQJA 3N9MA 2K1JA 2BAYA 5B77A 4AYCA 2ECIA 3ZVYA 5LKUA 4FJCA 2VJEB 2VPGA 4F52B 4FO9A 2H0DA 2YUCA 4BHWA 4AYCB 5JG6A 3O36A 2Y43A 2K17A 4LK9A 2UZGA 1K2FA 1HYJA 1WESA 4GNDA 2MD7B 2PUYA 5KH9A 3M99A 1JOCA 4LADB 2EA6A 2I50A 4YADA 2ECJA 3U5PA 3HCUA 4FK5A 1WEQA 4N3WA 2LDRA 2ECTA 4AP4A 3N9NA 3PHDA 1WEVA 2DX8A 5G04B 1MM3A 3KNVA 1WGMA 5FB0A 2KWNA 1HYIA 5B78A 2RSDA 3C6WA 3L11A 4GNFA 4YATA 2ZETC 1JM7A 5I3LA 2L43A 4AUQB 5LKXA 4UP5A 4I7BA 5TBNA 3RTRB 4ZDTA 4GB0A 4YABA 2KGIA 2KWKA 2YQLA 3N9QA 1X4UA 1WILA 2JMDA 2L75A 2CKLA 3T7LA 5C11A 1WEPA 1DVPA 3RPGC 4S3OC 2KFTA 2ECWA 2VPDA 1WENA 5G05B 5TABA 4NN2A 2K4DA 2M6MA 3LQIA 1Z60A 5TDWA 3MHSA 4L58A 5H1UA 2MUMA 2VJEA 2EGPA 2LGLA 5H1VA 4LJNA 2FUUA 1WEWA 4QF3A 1WEUA 2Y1MA 5D1MB 2VJFB 3ZPV1 2VP7A 4V3LC 2CSZA 5DKAA 4TKPB 1IYMA 3NG2A 3MHHA 1VD4A 2G45A 2MNZA 5LCWB 3O34A 3LRQA 5B8DA 2YQMA 5AITA 2QIZA 4P5OB 2C2VS 2EODA 4YBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMI A;  2MD8 C;  2ECG A;  2LXH C;  1VYX A;  4YBT A;  5KH7 A;  2MNY A;  4A49 A;  2MA6 A;  5FER A;  4LLB A;  2YYR A;  2VNF A;  1XWH A;  2KR4 A;  3GL6 A;  4S3O B;  3RPG B;  1CHC A;  3U5M A;  3V43 A;  4WZ2 A;  4LKA A;  2NAA A;  5EYA F;  3L1Z B;  1BOR A;  3FL2 A;  3HCS A;  2FUI A;  2LV9 A;  1G25 A;  2LN0 A;  2L5U A;  2L80 A;  3ZNI A;  3SOU A;  2KRE A;  3N9L A;  3C5K A;  1FP0 A;  3HCT A;  4R2Y A;  4MVT A;  2C2L A;  4WZ0 A;  4A0C D;  2YT5 A;  4XI1 A;  2KE1 A;  4W4U A;  4B7Y C;  5LKZ A;  4PTB A;  2YHN A;  4AVX A;  4ZUX U;  5FEY A;  1LDK C;  1WEE A;  3VK6 A;  2YSM A;  1WFK A;  4Q6F A;  2YU4 A;  5H9M A;  2LGG A;  2LGV A;  2VJF A;  4YC9 A;  2YSJ A;  3ZTG A;  3SOX A;  4UP0 A;  3U5O A;  2CSY A;  4YBS A;  1WEO A;  3O7A A;  3DQV R;  3O35 A;  4O64 A;  5G0F A;  1WE9 A;  3L1X A;  4V3K C;  4A4B A;  4R8P K;  2KWJ A;  4I7C A;  1WIM A;  2E6R A;  4L7X A;  4CCG X;  1E4U A;  2XEU A;  4B86 C;  2JRJ A;  3SOW A;  2YUR A;  4UI9 B;  4A4C A;  2FSA A;  2YW8 A;  3IHP A;  3KQI A;  2G6Q A;  3ZVZ B;  4YAX A;  5J3X A;  1F62 A;  5C13 A;  3O37 A;  1X4I A;  3GV4 A;  2KGG A;  2F6N A;  3O33 A;  3SHB A;  5LKT A;  4C9Z A;  5B75 A;  2RI7 A;  3PUR A;  2H0D B;  2QJ0 A;  2ECV A;  2D8S A;  2KYU A;  3T6R A;  4GNE A;  2IDA A;  2M1R A;  2F42 A;  3M62 A;  2VPE A;  3N9P A;  5FB1 A;  3PUQ A;  5D1K B;  1T1H A;  3M63 A;  2LXP C;  1MM2 A;  2CT2 A;  2VPB A;  1U6G B;  3I2D A;  3HTK C;  3N9O A;  4R7E A;  3DPL R;  2PNX A;  5H1T A;  1RMD A;  3O70 A;  5TRB A;  3KV6 A;  2MT5 A;  2Y1N A;  3LQH A;  5AIU A;  2ECN A;  3ZYQ A;  4FIP A;  4CA1 A;  4IC3 A;  2YRE A;  2QIC A;  2KWO A;  2YHO A;  1ZBD B;  5DIN A;  4BBQ A;  1FBV A;  5B76 A;  2KU3 A;  3ASL A;  4N4F A;  2OXQ C;  2AN6 A;  3KV5 A;  2E6S A;  1JM7 B;  2F6J A;  3EB5 A;  4I7D A;  2JMJ A;  5B79 A;  2G43 A;  2LQ6 A;  1V87 A;  1X4J A;  2XB1 A;  2HYE D;  4QF2 A;  2KIZ A;  5D1L B;  3QZV A;  3U5N A;  2M3H A;  2LRI C;  4GNG A;  4MSX A;  4X3G A;  5TDR A;  4WZ3 B;  2L0B A;  2CKL B;  5KH3 A;  4WA6 A;  2M85 A;  1LDJ B;  1VFY A;  1WEM A;  2MIQ A;  2LGK A;  1Z2Q A;  3ZPV E;  4ZQL A;  4PPE A;  1Z6U A;  3EB6 A;  2MA5 A;  1N87 A;  2HDP A;  2K16 A;  4IC2 A;  3LQJ A;  3N9M A;  2K1J A;  2BAY A;  5B77 A;  4AYC A;  2ECI A;  3ZVY A;  5LKU A;  4FJC A;  2VJE B;  2VPG A;  4F52 B;  4FO9 A;  2H0D A;  2YUC A;  4BHW A;  4AYC B;  5JG6 A;  3O36 A;  2Y43 A;  2K17 A;  4LK9 A;  2UZG A;  1K2F A;  1HYJ A;  1WES A;  4GND A;  2MD7 B;  2PUY A;  5KH9 A;  3M99 A;  1JOC A;  4LAD B;  2EA6 A;  2I50 A;  4YAD A;  2ECJ A;  3U5P A;  3HCU A;  4FK5 A;  1WEQ A;  4N3W A;  2LDR A;  2ECT A;  4AP4 A;  3N9N A;  3PHD A;  1WEV A;  2DX8 A;  5G04 B;  1MM3 A;  3KNV A;  1WGM A;  5FB0 A;  2KWN A;  1HYI A;  5B78 A;  2RSD A;  3C6W A;  3L11 A;  4GNF A;  4YAT A;  2ZET C;  1JM7 A;  5I3L A;  2L43 A;  4AUQ B;  5LKX A;  4UP5 A;  4I7B A;  5TBN A;  3RTR B;  4ZDT A;  4GB0 A;  4YAB A;  2KGI A;  2KWK A;  2YQL A;  3N9Q A;  1X4U A;  1WIL A;  2JMD A;  2L75 A;  2CKL A;  3T7L A;  5C11 A;  1WEP A;  1DVP A;  3RPG C;  4S3O C;  2KFT A;  2ECW A;  2VPD A;  1WEN A;  5G05 B;  5TAB A;  4NN2 A;  2K4D A;  2M6M A;  3LQI A;  1Z60 A;  5TDW A;  3MHS A;  4L58 A;  5H1U A;  2MUM A;  2VJE A;  2EGP A;  2LGL A;  5H1V A;  4LJN A;  2FUU A;  1WEW A;  4QF3 A;  1WEU A;  2Y1M A;  5D1M B;  2VJF B;  3ZPV 1;  2VP7 A;  4V3L C;  2CSZ A;  5DKA A;  4TKP B;  1IYM A;  3NG2 A;  3MHH A;  1VD4 A;  2G45 A;  2MNZ A;  5LCW B;  3O34 A;  3LRQ A;  5B8D A;  2YQM A;  5AIT A;  2QIZ A;  4P5O B;  2C2V S;  2EOD A;  4YBM A; 
#chains in the Genus database with same CATH topology
 2JMI A;  2MD8 C;  2ECG A;  3O47 A;  4Z0R A;  2LXH C;  1VYX A;  5SVI A;  4YBT A;  3MDB C;  5KH7 A;  2MNY A;  2FFW A;  4A49 A;  2MA6 A;  5FER A;  4LLB A;  2YYR A;  2VNF A;  1XWH A;  2KR4 A;  3GL6 A;  4S3O B;  5SVI B;  3RPG B;  1CHC A;  2JM3 A;  3U5M A;  3V43 A;  3DDT A;  4WZ2 A;  4LKA A;  2NAA A;  5EYA F;  3L1Z B;  1BOR A;  3FL2 A;  3HCS A;  2FUI A;  2LV9 A;  1G25 A;  2LN0 A;  3FJU B;  2L5U A;  2L80 A;  3ZNI A;  3SOU A;  2KRE A;  3N9L A;  2DJA A;  3C5K A;  1FP0 A;  5K3Q A;  4YBM A;  3HCT A;  4R2Y A;  3LJU X;  4MVT A;  2C2L A;  4WZ0 A;  4A0C D;  2L7P A;  2YT5 A;  2M13 A;  4XI1 A;  2KE1 A;  3LVQ E;  4W4U A;  4B7Y C;  2RR4 A;  5LKZ A;  4PTB A;  2YHN A;  4AVX A;  2XP0 A;  4ZUX U;  5FEY A;  3LDY A;  1LDK C;  1WEE A;  3VK6 A;  2YSM A;  1WFK A;  4Q6F A;  3SUB A;  2YU4 A;  5H9M A;  2LGG A;  2LGV A;  2KKY A;  2VJF A;  4YC9 A;  2YSJ A;  3ZTG A;  3SOX A;  4UP0 A;  3U5O A;  2CSY A;  4YBS A;  1WEO A;  3O7A A;  3DQV R;  3O35 A;  4O64 A;  5G0F A;  1WE9 A;  3L1X A;  2DSM A;  4V3K C;  4A4B A;  4R8P K;  2KWJ A;  4I7C A;  1WIM A;  2E6R A;  4H9D A;  4L7X A;  4CCG X;  1E4U A;  2XEU A;  3LVR E;  4B86 C;  2JRJ A;  3SOW A;  2OWA A;  2YUR A;  4UI9 B;  4A4C A;  2FSA A;  2YW8 A;  3IHP A;  3KQI A;  2G6Q A;  3ZVZ B;  4YAX A;  5J3X A;  1F62 A;  5C13 A;  3O37 A;  2XOC A;  1X4I A;  2LAU A;  2JUN A;  3GV4 A;  2KGG A;  2F6N A;  4F1P A;  3O33 A;  3SHB A;  5LKT A;  4C9Z A;  5B75 A;  2RI7 A;  3PUR A;  2H0D B;  2CSV A;  2QJ0 A;  2ECV A;  2D8S A;  2KYU A;  3T6R A;  4GNE A;  2IDA A;  2M1R A;  2F42 A;  3M62 A;  2VPE A;  3N9P A;  3FAN A;  1DCQ A;  2CON A;  5FB1 A;  3PUQ A;  5D1K B;  2MKE A;  1T1H A;  3M63 A;  2CRW A;  2LXP C;  1MM2 A;  2CT2 A;  2VPB A;  2D8U A;  1U6G B;  3I2D A;  3HTK C;  3N9O A;  3T9K A;  4R7E A;  3DPL R;  2PNX A;  5H1T A;  1RMD A;  3O70 A;  5TRB A;  3KV6 A;  2MT5 A;  2Y1N A;  3LQH A;  5AIU A;  2ECN A;  3ZYQ A;  4FIP A;  4CA1 A;  4IC3 A;  2YRE A;  2QIC A;  2KWO A;  2YHO A;  1ZBD B;  5DIN A;  4BBQ A;  1FBV A;  5B76 A;  2KU3 A;  3ASL A;  4N4F A;  2OXQ C;  2AN6 A;  3KV5 A;  2E6S A;  1JM7 B;  2F6J A;  3EB5 A;  4I7D A;  2JMJ A;  5B79 A;  2G43 A;  4QQ4 A;  2LQ6 A;  1V87 A;  1X4J A;  2XB1 A;  2HYE D;  2KKX A;  4QF2 A;  2KIZ A;  5D1L B;  3QZV A;  3U5N A;  2M3H A;  2LRI C;  4GNG A;  4MSX A;  4X3G A;  5TDR A;  4WZ3 B;  3H7H A;  2L0B A;  2CKL B;  5KH3 A;  4WA6 A;  2M85 A;  1LDJ B;  1VFY A;  1WEM A;  2MIQ A;  2LGK A;  1Z2Q A;  2CRR A;  2XOY A;  3ZPV E;  4ZQL A;  4PPE A;  1Z6U A;  3EB6 A;  2MA5 A;  1N87 A;  2HDP A;  2K16 A;  4IC2 A;  3M7K A;  3LQJ A;  3N9M A;  2K1J A;  2BAY A;  5B77 A;  4AYC A;  2ECI A;  3ZVY A;  5LKU A;  4FJC A;  2VJE B;  2VPG A;  4F52 B;  4FO9 A;  2H0D A;  2YUC A;  4BHW A;  3Q1D A;  4AYC B;  5JG6 A;  3O36 A;  3FM8 C;  2Y43 A;  2K17 A;  4LK9 A;  2UZG A;  1K2F A;  1HYJ A;  1WES A;  4GND A;  2MD7 B;  2PUY A;  5KH9 A;  3M99 A;  1JOC A;  4LAD B;  3PLW A;  2EA6 A;  2IQJ A;  2I50 A;  3E2D A;  4YAD A;  2ECJ A;  3U5P A;  3HCU A;  2B0O E;  4FK5 A;  3KDE C;  1WEQ A;  4N3W A;  2LDR A;  2ECT A;  2FD4 A;  4AP4 A;  3N9N A;  3DWD A;  3PHD A;  1WEV A;  2DX8 A;  5G04 B;  1MM3 A;  2EGM A;  3KNV A;  1WGM A;  5FB0 A;  2KWN A;  1HYI A;  5B78 A;  2RSD A;  3C6W A;  3L11 A;  4GNF A;  4YAT A;  2ZET C;  1JM7 A;  5I3L A;  2L43 A;  4AUQ B;  5LKX A;  4UP5 A;  4I7B A;  5TBN A;  3RTR B;  2XOZ A;  4ZDT A;  4GB0 A;  4YAB A;  2KGI A;  2KWK A;  2YQL A;  3N9Q A;  1X4U A;  1WIL A;  2JMD A;  2L75 A;  2CKL A;  3T7L A;  4Z0O A;  1WEP A;  5C11 A;  1DVP A;  3RPG C;  4S3O C;  2KFT A;  2ECW A;  5SVX A;  2VPD A;  1WEN A;  5G05 B;  2E61 A;  5TAB A;  4NN2 A;  2K4D A;  2M6M A;  3LQI A;  1Z60 A;  5TDW A;  3MHS A;  4L58 A;  5H1U A;  2MUM A;  2EXU A;  2VJE A;  2EGP A;  2LGL A;  4OGE A;  5H1V A;  4LJN A;  2FUU A;  2P57 A;  1WEW A;  4QF3 A;  1WEU A;  2Y1M A;  5D1M B;  1MBM A;  2VJF B;  5SVY A;  4O62 A;  3JUE A;  3ZPV 1;  2VP7 A;  4V3L C;  2CSZ A;  5DKA A;  4TKP B;  1IYM A;  3NG2 A;  3MHH A;  1VD4 A;  2G45 A;  2MNZ A;  5LCW B;  3O34 A;  3LRQ A;  5B8D A;  4OGC A;  2YQM A;  5AIT A;  2QIZ A;  4P5O B;  2YVR A;  2C2V S;  3FAO A;  2EOD A;  3FEH A; 
#chains in the Genus database with same CATH homology
 2JMI A;  2MD8 C;  2ECG A;  2LXH C;  1VYX A;  4YBT A;  5KH7 A;  2MNY A;  4A49 A;  2MA6 A;  5FER A;  4LLB A;  2YYR A;  2VNF A;  1XWH A;  2KR4 A;  3GL6 A;  4S3O B;  3RPG B;  1CHC A;  3U5M A;  3V43 A;  4WZ2 A;  4LKA A;  2NAA A;  5EYA F;  3L1Z B;  1BOR A;  3FL2 A;  3HCS A;  2FUI A;  2LV9 A;  1G25 A;  2LN0 A;  2L5U A;  2L80 A;  3ZNI A;  3SOU A;  2KRE A;  3N9L A;  3C5K A;  1FP0 A;  3HCT A;  4R2Y A;  4MVT A;  2C2L A;  4WZ0 A;  4A0C D;  2YT5 A;  4XI1 A;  2KE1 A;  4W4U A;  4B7Y C;  5LKZ A;  4PTB A;  2YHN A;  4AVX A;  4ZUX U;  5FEY A;  1LDK C;  1WEE A;  3VK6 A;  2YSM A;  1WFK A;  4Q6F A;  2YU4 A;  5H9M A;  2LGG A;  2LGV A;  2VJF A;  4YC9 A;  2YSJ A;  3ZTG A;  3SOX A;  4UP0 A;  3U5O A;  2CSY A;  4YBS A;  1WEO A;  3O7A A;  3DQV R;  3O35 A;  4O64 A;  5G0F A;  1WE9 A;  3L1X A;  4V3K C;  4A4B A;  4R8P K;  2KWJ A;  4I7C A;  1WIM A;  2E6R A;  4L7X A;  4CCG X;  1E4U A;  2XEU A;  4B86 C;  2JRJ A;  3SOW A;  2YUR A;  4UI9 B;  4A4C A;  2FSA A;  2YW8 A;  3IHP A;  3KQI A;  2G6Q A;  3ZVZ B;  4YAX A;  5J3X A;  1F62 A;  5C13 A;  3O37 A;  1X4I A;  3GV4 A;  2KGG A;  2F6N A;  3O33 A;  3SHB A;  5LKT A;  4C9Z A;  5B75 A;  2RI7 A;  3PUR A;  2H0D B;  2QJ0 A;  2ECV A;  2D8S A;  2KYU A;  3T6R A;  4GNE A;  2IDA A;  2M1R A;  2F42 A;  3M62 A;  2VPE A;  3N9P A;  5FB1 A;  3PUQ A;  5D1K B;  1T1H A;  3M63 A;  2LXP C;  1MM2 A;  2CT2 A;  2VPB A;  1U6G B;  3I2D A;  3HTK C;  3N9O A;  4R7E A;  3DPL R;  2PNX A;  5H1T A;  1RMD A;  3O70 A;  5TRB A;  3KV6 A;  2MT5 A;  2Y1N A;  3LQH A;  5AIU A;  2ECN A;  3ZYQ A;  4FIP A;  4CA1 A;  4IC3 A;  2YRE A;  2QIC A;  2KWO A;  2YHO A;  1ZBD B;  5DIN A;  4BBQ A;  1FBV A;  5B76 A;  2KU3 A;  3ASL A;  4N4F A;  2OXQ C;  2AN6 A;  3KV5 A;  2E6S A;  1JM7 B;  2F6J A;  3EB5 A;  4I7D A;  2JMJ A;  5B79 A;  2G43 A;  2LQ6 A;  1V87 A;  1X4J A;  2XB1 A;  2HYE D;  4QF2 A;  2KIZ A;  5D1L B;  3QZV A;  3U5N A;  2M3H A;  2LRI C;  4GNG A;  4MSX A;  4X3G A;  5TDR A;  4WZ3 B;  2L0B A;  2CKL B;  5KH3 A;  4WA6 A;  2M85 A;  1LDJ B;  1VFY A;  1WEM A;  2MIQ A;  2LGK A;  1Z2Q A;  3ZPV E;  4ZQL A;  4PPE A;  1Z6U A;  3EB6 A;  2MA5 A;  1N87 A;  2HDP A;  2K16 A;  4IC2 A;  3LQJ A;  3N9M A;  2K1J A;  2BAY A;  5B77 A;  4AYC A;  2ECI A;  3ZVY A;  5LKU A;  4FJC A;  2VJE B;  2VPG A;  4F52 B;  4FO9 A;  2H0D A;  2YUC A;  4BHW A;  4AYC B;  5JG6 A;  3O36 A;  2Y43 A;  2K17 A;  4LK9 A;  2UZG A;  1K2F A;  1HYJ A;  1WES A;  4GND A;  2MD7 B;  2PUY A;  5KH9 A;  3M99 A;  1JOC A;  4LAD B;  2EA6 A;  2I50 A;  4YAD A;  2ECJ A;  3U5P A;  3HCU A;  4FK5 A;  1WEQ A;  4N3W A;  2LDR A;  2ECT A;  4AP4 A;  3N9N A;  3PHD A;  1WEV A;  2DX8 A;  5G04 B;  1MM3 A;  3KNV A;  1WGM A;  5FB0 A;  2KWN A;  1HYI A;  5B78 A;  2RSD A;  3C6W A;  3L11 A;  4GNF A;  4YAT A;  2ZET C;  1JM7 A;  5I3L A;  2L43 A;  4AUQ B;  5LKX A;  4UP5 A;  4I7B A;  5TBN A;  3RTR B;  4ZDT A;  4GB0 A;  4YAB A;  2KGI A;  2KWK A;  2YQL A;  3N9Q A;  1X4U A;  1WIL A;  2JMD A;  2L75 A;  2CKL A;  3T7L A;  5C11 A;  1WEP A;  1DVP A;  3RPG C;  4S3O C;  2KFT A;  2ECW A;  2VPD A;  1WEN A;  5G05 B;  5TAB A;  4NN2 A;  2K4D A;  2M6M A;  3LQI A;  1Z60 A;  5TDW A;  3MHS A;  4L58 A;  5H1U A;  2MUM A;  2VJE A;  2EGP A;  2LGL A;  5H1V A;  4LJN A;  2FUU A;  1WEW A;  4QF3 A;  1WEU A;  2Y1M A;  5D1M B;  2VJF B;  3ZPV 1;  2VP7 A;  4V3L C;  2CSZ A;  5DKA A;  4TKP B;  1IYM A;  3NG2 A;  3MHH A;  1VD4 A;  2G45 A;  2MNZ A;  5LCW B;  3O34 A;  3LRQ A;  5B8D A;  2YQM A;  5AIT A;  2QIZ A;  4P5O B;  2C2V S;  2EOD A;  4YBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...