3LRQA

Crystal structure of the u-box domain of human ubiquitin-protein ligase (e3), northeast structural genomics consortium target hr4604d.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
HMDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase TRIM37
publication title E3 UBIQUITIN-PROTEIN LIGASE RING DOMAIN FROM HUMAN TRIPARTITE MOTIF-CONTAINING PROTEIN 37 (TRIM37), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4604D.
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 18
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3lrqA00
5KH9A 5LKZA 3NG2A 2JMDA 4AYCB 2CSZA 3O36A 2M6MA 2OXQC 2MD7B 3ZPVE 4YATA 5KH3A 5D1LB 5TBNA 4PPEA 2C2VS 2QJ0A 4CCGX 2ECTA 2L43A 4B86C 2E6RA 4R8PK 2MUMA 5FERA 3HCTA 3IHPA 1RMDA 4YBTA 4V3LC 4YAXA 3ZPV1 1VFYA 2KGIA 4V3KC 1WE9A 4QF2A 2PUYA 5KH7A 3M62A 5H1VA 2G6QA 1IYMA 4L7XA 4MSXA 2YURA 1E4UA 4WZ3B 2M1RA 4FK5A 3HTKC 1Z6UA 4I7DA 4YABA 5H1UA 3KNVA 3KQIA 2YYRA 1K2FA 4AVXA 1LDJB 4AP4A 3U5NA 2ECJA 2L75A 1JM7A 4IC2A 3LRQA 4R2YA 2AN6A 1FBVA 1FP0A 4BHWA 1WEUA 5D1MB 2KR4A 3VK6A 1JOCA 2KE1A 1WEOA 4A4BA 2QIZA 2YSJA 3FL2A 5LKTA 5G0FA 5TABA 3T7LA 3N9NA 1WFKA 3N9MA 2XEUA 1WEWA 2KGGA 5FB1A 4WZ0A 5D1KB 5EYAF 2CKLA 4UP5A 5AIUA 2LV9A 3EB5A 5B75A 3M63A 2VPGA 2F42A 3HCUA 2K17A 4I7BA 5B79A 3DPLR 4AUQB 4NN2A 2L5UA 5DINA 3MHSA 2LGGA 3O33A 1VD4A 2BAYA 2VPBA 1X4JA 2H0DB 2YUCA 5FB0A 1N87A 5B8DA 3N9PA 1BORA 2KYUA 3MHHA 2ECGA 3ASLA 2LDRA 1ZBDB 2YHOA 3RTRB 2ECNA 1HYJA 3I2DA 1WENA 4ZUXU 4GNDA 4A0CD 4WZ2A 2VJEA 2VPEA 4N3WA 2RSDA 3C6WA 4FIPA 2YREA 2L0BA 3O35A 3U5MA 3EB6A 2QICA 4N4FA 4W4UA 1WGMA 1WEEA 1VYXA 5TDWA 1WEPA 5DKAA 2FUUA 3SOUA 2VP7A 1WESA 2IDAA 3LQHA 4YADA 2ECWA 1WEQA 4XI1A 4CA1A 4ZDTA 4YBSA 5AITA 2VJFA 3ZYQA 5H1TA 4P5OB 2LN0A 5J3XA 4AYCA 2EA6A 2M85A 4FO9A 2YW8A 5TDRA 3ZTGA 4YBMA 2HDPA 2E6SA 5FEYA 2VPDA 5LKUA 2D8SA 2FSAA 2K16A 2PNXA 2Y1MA 4UP0A 4A49A 2JRJA 3C5KA 2VNFA 1U6GB 4R7EA 2MIQA 3GL6A 4X3GA 4A4CA 2KU3A 2NAAA 4S3OB 3V43A 4C9ZA 4LJNA 4I7CA 5B78A 4GNFA 3O7AA 1DVPA 3KV6A 4FJCA 4GNEA 2MD8C 4LK9A 1HYIA 4F52B 3N9OA 1WILA 5B77A 2I50A 4BBQA 2KIZA 3L11A 4TKPB 5I3LA 2Y43A 2G45A 2HYED 1WEMA 3SOWA 3RPGB 2XB1A 3QZVA 4LLBA 4WA6A 3RPGC 3T6RA 2YU4A 5H9MA 3PURA 2JMJA 3PUQA 2UZGA 5G05B 4O64A 3L1XA 1JM7B 1CHCA 1MM2A 2LGKA 2KWOA 2MT5A 2C2LA 2KREA 2M3HA 5LCWB 2LXPC 4GNGA 2CSYA 3LQIA 2MA6A 4UI9B 1XWHA 3SOXA 2YQMA 2EGPA 1X4IA 2DX8A 2F6JA 2YT5A 3LQJA 2CT2A 4IC3A 2KFTA 2CKLB 3DQVR 2K1JA 3M99A 2LXHC 3KV5A 4LADB 4ZQLA 4YC9A 3U5PA 1V87A 2RI7A 3O34A 2K4DA 2YSMA 2FUIA 3SHBA 5C13A 4Q6FA 3O37A 3U5OA 1WIMA 1LDKC 2ECVA 2KWJA 4GB0A 2H0DA 2LGLA 3ZNIA 2MA5A 1WEVA 1T1HA 5G04B 1X4UA 3PHDA 2G43A 4L58A 2L80A 1Z60A 3N9QA 2MNZA 5LKXA 2VJEB 2LGVA 4MVTA 4QF3A 5B76A 2KWKA 2KWNA 3GV4A 2LRIC 3N9LA 2Y1NA 5TRBA 2F6NA 4S3OC 3ZVZB 3ZVYA 4LKAA 3HCSA 2YHNA 4PTBA 4B7YC 2MNYA 2YQLA 2JMIA 3L1ZB 1F62A 2EODA 3O70A 2ECIA 2LQ6A 1MM3A 5JG6A 5C11A 2ZETC 2VJFB 1G25A 1Z2QA
chains in the Genus database with same CATH superfamily
5KH9A 2D8UA 5LKZA 3NG2A 3FANA 2JMDA 4AYCB 2CSZA 3O36A 2M6MA 2OXQC 2MD7B 3ZPVE 4YATA 2JM3A 5KH3A 5D1LB 5TBNA 4PPEA 2C2VS 2QJ0A 4CCGX 2ECTA 2L43A 4B86C 2E6RA 4R8PK 2MUMA 5FERA 3HCTA 3IHPA 1RMDA 4YBTA 4V3LC 4YAXA 3ZPV1 1VFYA 2KGIA 3PLWA 3Q1DA 4V3KC 1WE9A 4QF2A 2PUYA 5KH7A 3M62A 5H1VA 2G6QA 1IYMA 4L7XA 4MSXA 2YURA 1E4UA 2KKYA 4WZ3B 2M1RA 2FFWA 2XP0A 3HTKC 4FK5A 1Z6UA 2XOZA 4I7DA 4YABA 5H1UA 3KNVA 3KQIA 2YYRA 1K2FA 4AVXA 2MKEA 1LDJB 2CSVA 4AP4A 3LJUX 2RR4A 3U5NA 2ECJA 2L75A 1JM7A 4IC2A 3LRQA 4R2YA 2AN6A 3H7HA 1FBVA 1FP0A 4BHWA 1WEUA 5D1MB 2KR4A 3VK6A 1JOCA 2KE1A 1WEOA 4A4BA 2QIZA 2YSJA 3DWDA 3FL2A 5LKTA 5G0FA 5TABA 3T7LA 3N9NA 1WFKA 3SUBA 3N9MA 2XEUA 1WEWA 2KGGA 5SVYA 2FD4A 5FB1A 4WZ0A 5D1KB 5EYAF 2CKLA 3KDEC 3LVRE 4UP5A 5AIUA 2LV9A 3EB5A 5B75A 3M63A 2VPGA 2F42A 3HCUA 2K17A 4I7BA 5B79A 3DPLR 4AUQB 3FEHA 4NN2A 2L5UA 4OGEA 5DINA 3MHSA 2LGGA 3O33A 1VD4A 2BAYA 2VPBA 2CRWA 1X4JA 2H0DB 2YUCA 5FB0A 1N87A 5B8DA 3N9PA 3E2DA 1BORA 2KYUA 3MHHA 5SVIA 2ECGA 3ASLA 2LDRA 1ZBDB 2YHOA 3RTRB 4F1PA 2ECNA 1HYJA 3I2DA 1WENA 4ZUXU 4GNDA 4A0CD 3T9KA 4WZ2A 2VJEA 2VPEA 4N3WA 2RSDA 3C6WA 4FIPA 2YREA 2L0BA 3O35A 3LDYA 3U5MA 3EB6A 2QICA 4N4FA 4W4UA 1WGMA 1WEEA 1VYXA 5TDWA 1WEPA 5DKAA 2FUUA 3SOUA 2VP7A 1WESA 2IDAA 3LQHA 4YADA 2ECWA 1WEQA 4XI1A 3FJUB 4CA1A 4ZDTA 4YBSA 2M13A 5AITA 2VJFA 3ZYQA 5H1TA 4P5OB 2LN0A 4O62A 5J3XA 4AYCA 2IQJA 2EA6A 2M85A 4FO9A 2EXUA 2YW8A 3JUEA 2YVRA 5TDRA 1DCQA 3ZTGA 4YBMA 2HDPA 5SVIB 2E6SA 5FEYA 2VPDA 5LKUA 2D8SA 2FSAA 2L7PA 2K16A 2PNXA 2Y1MA 4UP0A 4A49A 2JRJA 3C5KA 3O47A 2VNFA 1U6GB 4R7EA 2MIQA 3GL6A 4X3GA 4A4CA 2KU3A 2NAAA 4S3OB 3V43A 4C9ZA 4LJNA 3DDTA 4I7CA 5B78A 4GNFA 3O7AA 1DVPA 3KV6A 4FJCA 4GNEA 2MD8C 4LK9A 1HYIA 4F52B 3N9OA 1WILA 5B77A 2I50A 3M7KA 4BBQA 2KIZA 3L11A 4TKPB 5I3LA 2Y43A 2G45A 2HYED 1WEMA 3SOWA 3RPGB 2XB1A 3QZVA 4LLBA 4WA6A 3RPGC 3T6RA 2YU4A 5H9MA 2DSMA 3PURA 2JMJA 1MBMA 2DJAA 2EGMA 3PUQA 2UZGA 5SVXA 5G05B 4O64A 2XOYA 4Z0OA 3L1XA 1JM7B 1CHCA 1MM2A 2CRRA 2LGKA 2KWOA 2MT5A 2C2LA 2KREA 2M3HA 5LCWB 2LXPC 4GNGA 2CSYA 3LQIA 2MA6A 4UI9B 1XWHA 3SOXA 2YQMA 2EGPA 1X4IA 2CONA 2DX8A 2F6JA 2YT5A 3FAOA 3LQJA 2CT2A 4IC3A 2KFTA 2CKLB 3DQVR 2K1JA 3M99A 2LXHC 3KV5A 2LAUA 4LADB 4ZQLA 4YC9A 3U5PA 1V87A 2RI7A 3O34A 2K4DA 2OWAA 2YSMA 2FUIA 3SHBA 3LVQE 2E61A 4Z0RA 5C13A 4Q6FA 3O37A 3U5OA 1WIMA 4OGCA 1LDKC 2ECVA 2KWJA 4GB0A 2KKXA 2H0DA 2LGLA 3ZNIA 2MA5A 1WEVA 1T1HA 5G04B 4H9DA 1X4UA 3FM8C 3PHDA 2JUNA 2G43A 4L58A 2L80A 1Z60A 2XOCA 3N9QA 2MNZA 5LKXA 2VJEB 2LGVA 4MVTA 4QQ4A 4QF3A 5B76A 2B0OE 2KWNA 2KWKA 3GV4A 2LRIC 3N9LA 2Y1NA 5TRBA 2F6NA 4S3OC 3ZVZB 3ZVYA 4LKAA 3MDBC 3HCSA 2YHNA 2P57A 4PTBA 4B7YC 2MNYA 5K3QA 2YQLA 2JMIA 3L1ZB 1F62A 2EODA 3O70A 2ECIA 2LQ6A 1MM3A 5JG6A 5C11A 2ZETC 2VJFB 1G25A 1Z2QA
chains in the Genus database with same CATH topology
5KH9A 5LKZA 3NG2A 2JMDA 4AYCB 2CSZA 3O36A 2M6MA 2OXQC 2MD7B 3ZPVE 4YATA 5KH3A 5D1LB 5TBNA 4PPEA 2C2VS 2QJ0A 4CCGX 2ECTA 2L43A 4B86C 2E6RA 4R8PK 2MUMA 5FERA 3HCTA 3IHPA 1RMDA 4YBTA 4V3LC 4YAXA 3ZPV1 1VFYA 2KGIA 4V3KC 1WE9A 4QF2A 2PUYA 5KH7A 3M62A 5H1VA 2G6QA 1IYMA 4L7XA 4MSXA 2YURA 1E4UA 4WZ3B 2M1RA 4FK5A 3HTKC 1Z6UA 4I7DA 4YABA 5H1UA 3KNVA 3KQIA 2YYRA 1K2FA 4AVXA 1LDJB 4AP4A 3U5NA 2ECJA 2L75A 1JM7A 4IC2A 3LRQA 4R2YA 2AN6A 1FBVA 1FP0A 4BHWA 1WEUA 5D1MB 2KR4A 3VK6A 1JOCA 2KE1A 1WEOA 4A4BA 2QIZA 2YSJA 3FL2A 5LKTA 5G0FA 5TABA 3T7LA 3N9NA 1WFKA 3N9MA 2XEUA 1WEWA 2KGGA 5FB1A 4WZ0A 5D1KB 5EYAF 2CKLA 4UP5A 5AIUA 2LV9A 3EB5A 5B75A 3M63A 2VPGA 2F42A 3HCUA 2K17A 4I7BA 5B79A 3DPLR 4AUQB 4NN2A 2L5UA 5DINA 3MHSA 2LGGA 3O33A 1VD4A 2BAYA 2VPBA 1X4JA 2H0DB 2YUCA 5FB0A 1N87A 5B8DA 3N9PA 1BORA 2KYUA 3MHHA 2ECGA 3ASLA 2LDRA 1ZBDB 2YHOA 3RTRB 2ECNA 1HYJA 3I2DA 1WENA 4ZUXU 4GNDA 4A0CD 4WZ2A 2VJEA 2VPEA 4N3WA 2RSDA 3C6WA 4FIPA 2YREA 2L0BA 3O35A 3U5MA 3EB6A 2QICA 4N4FA 4W4UA 1WGMA 1WEEA 1VYXA 5TDWA 1WEPA 5DKAA 2FUUA 3SOUA 2VP7A 1WESA 2IDAA 3LQHA 4YADA 2ECWA 1WEQA 4XI1A 4CA1A 4ZDTA 4YBSA 5AITA 2VJFA 3ZYQA 5H1TA 4P5OB 2LN0A 5J3XA 4AYCA 2EA6A 2M85A 4FO9A 2YW8A 5TDRA 3ZTGA 4YBMA 2HDPA 2E6SA 5FEYA 2VPDA 5LKUA 2D8SA 2FSAA 2K16A 2PNXA 2Y1MA 4UP0A 4A49A 2JRJA 3C5KA 2VNFA 1U6GB 4R7EA 2MIQA 3GL6A 4X3GA 4A4CA 2KU3A 2NAAA 4S3OB 3V43A 4C9ZA 4LJNA 4I7CA 5B78A 4GNFA 3O7AA 1DVPA 3KV6A 4FJCA 4GNEA 2MD8C 4LK9A 1HYIA 4F52B 3N9OA 1WILA 5B77A 2I50A 4BBQA 2KIZA 3L11A 4TKPB 5I3LA 2Y43A 2G45A 2HYED 1WEMA 3SOWA 3RPGB 2XB1A 3QZVA 4LLBA 4WA6A 3RPGC 3T6RA 2YU4A 5H9MA 3PURA 2JMJA 3PUQA 2UZGA 5G05B 4O64A 3L1XA 1JM7B 1CHCA 1MM2A 2LGKA 2KWOA 2MT5A 2C2LA 2KREA 2M3HA 5LCWB 2LXPC 4GNGA 2CSYA 3LQIA 2MA6A 4UI9B 1XWHA 3SOXA 2YQMA 2EGPA 1X4IA 2DX8A 2F6JA 2YT5A 3LQJA 2CT2A 4IC3A 2KFTA 2CKLB 3DQVR 2K1JA 3M99A 2LXHC 3KV5A 4LADB 4ZQLA 4YC9A 3U5PA 1V87A 2RI7A 3O34A 2K4DA 2YSMA 2FUIA 3SHBA 5C13A 4Q6FA 3O37A 3U5OA 1WIMA 1LDKC 2ECVA 2KWJA 4GB0A 2H0DA 2LGLA 3ZNIA 2MA5A 1WEVA 1T1HA 5G04B 1X4UA 3PHDA 2G43A 4L58A 2L80A 1Z60A 3N9QA 2MNZA 5LKXA 2VJEB 2LGVA 4MVTA 4QF3A 5B76A 2KWKA 2KWNA 3GV4A 2LRIC 3N9LA 2Y1NA 5TRBA 2F6NA 4S3OC 3ZVZB 3ZVYA 4LKAA 3HCSA 2YHNA 4PTBA 4B7YC 2MNYA 2YQLA 2JMIA 3L1ZB 1F62A 2EODA 3O70A 2ECIA 2LQ6A 1MM3A 5JG6A 5C11A 2ZETC 2VJFB 1G25A 1Z2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH9 A;  5LKZ A;  3NG2 A;  2JMD A;  4AYC B;  2CSZ A;  3O36 A;  2M6M A;  2OXQ C;  2MD7 B;  3ZPV E;  4YAT A;  5KH3 A;  5D1L B;  5TBN A;  4PPE A;  2C2V S;  2QJ0 A;  4CCG X;  2ECT A;  2L43 A;  4B86 C;  2E6R A;  4R8P K;  2MUM A;  5FER A;  3HCT A;  3IHP A;  1RMD A;  4YBT A;  4V3L C;  4YAX A;  3ZPV 1;  1VFY A;  2KGI A;  4V3K C;  1WE9 A;  4QF2 A;  2PUY A;  5KH7 A;  3M62 A;  5H1V A;  2G6Q A;  1IYM A;  4L7X A;  4MSX A;  2YUR A;  1E4U A;  4WZ3 B;  2M1R A;  4FK5 A;  3HTK C;  1Z6U A;  4I7D A;  4YAB A;  5H1U A;  3KNV A;  3KQI A;  2YYR A;  1K2F A;  4AVX A;  1LDJ B;  4AP4 A;  3U5N A;  2ECJ A;  2L75 A;  1JM7 A;  4IC2 A;  3LRQ A;  4R2Y A;  2AN6 A;  1FBV A;  1FP0 A;  4BHW A;  1WEU A;  5D1M B;  2KR4 A;  3VK6 A;  1JOC A;  2KE1 A;  1WEO A;  4A4B A;  2QIZ A;  2YSJ A;  3FL2 A;  5LKT A;  5G0F A;  5TAB A;  3T7L A;  3N9N A;  1WFK A;  3N9M A;  2XEU A;  1WEW A;  2KGG A;  5FB1 A;  4WZ0 A;  5D1K B;  5EYA F;  2CKL A;  4UP5 A;  5AIU A;  2LV9 A;  3EB5 A;  5B75 A;  3M63 A;  2VPG A;  2F42 A;  3HCU A;  2K17 A;  4I7B A;  5B79 A;  3DPL R;  4AUQ B;  4NN2 A;  2L5U A;  5DIN A;  3MHS A;  2LGG A;  3O33 A;  1VD4 A;  2BAY A;  2VPB A;  1X4J A;  2H0D B;  2YUC A;  5FB0 A;  1N87 A;  5B8D A;  3N9P A;  1BOR A;  2KYU A;  3MHH A;  2ECG A;  3ASL A;  2LDR A;  1ZBD B;  2YHO A;  3RTR B;  2ECN A;  1HYJ A;  3I2D A;  1WEN A;  4ZUX U;  4GND A;  4A0C D;  4WZ2 A;  2VJE A;  2VPE A;  4N3W A;  2RSD A;  3C6W A;  4FIP A;  2YRE A;  2L0B A;  3O35 A;  3U5M A;  3EB6 A;  2QIC A;  4N4F A;  4W4U A;  1WGM A;  1WEE A;  1VYX A;  5TDW A;  1WEP A;  5DKA A;  2FUU A;  3SOU A;  2VP7 A;  1WES A;  2IDA A;  3LQH A;  4YAD A;  2ECW A;  1WEQ A;  4XI1 A;  4CA1 A;  4ZDT A;  4YBS A;  5AIT A;  2VJF A;  3ZYQ A;  5H1T A;  4P5O B;  2LN0 A;  5J3X A;  4AYC A;  2EA6 A;  2M85 A;  4FO9 A;  2YW8 A;  5TDR A;  3ZTG A;  4YBM A;  2HDP A;  2E6S A;  5FEY A;  2VPD A;  5LKU A;  2D8S A;  2FSA A;  2K16 A;  2PNX A;  2Y1M A;  4UP0 A;  4A49 A;  2JRJ A;  3C5K A;  2VNF A;  1U6G B;  4R7E A;  2MIQ A;  3GL6 A;  4X3G A;  4A4C A;  2KU3 A;  2NAA A;  4S3O B;  3V43 A;  4C9Z A;  4LJN A;  4I7C A;  5B78 A;  4GNF A;  3O7A A;  1DVP A;  3KV6 A;  4FJC A;  4GNE A;  2MD8 C;  4LK9 A;  1HYI A;  4F52 B;  3N9O A;  1WIL A;  5B77 A;  2I50 A;  4BBQ A;  2KIZ A;  3L11 A;  4TKP B;  5I3L A;  2Y43 A;  2G45 A;  2HYE D;  1WEM A;  3SOW A;  3RPG B;  2XB1 A;  3QZV A;  4LLB A;  4WA6 A;  3RPG C;  3T6R A;  2YU4 A;  5H9M A;  3PUR A;  2JMJ A;  3PUQ A;  2UZG A;  5G05 B;  4O64 A;  3L1X A;  1JM7 B;  1CHC A;  1MM2 A;  2LGK A;  2KWO A;  2MT5 A;  2C2L A;  2KRE A;  2M3H A;  5LCW B;  2LXP C;  4GNG A;  2CSY A;  3LQI A;  2MA6 A;  4UI9 B;  1XWH A;  3SOX A;  2YQM A;  2EGP A;  1X4I A;  2DX8 A;  2F6J A;  2YT5 A;  3LQJ A;  2CT2 A;  4IC3 A;  2KFT A;  2CKL B;  3DQV R;  2K1J A;  3M99 A;  2LXH C;  3KV5 A;  4LAD B;  4ZQL A;  4YC9 A;  3U5P A;  1V87 A;  2RI7 A;  3O34 A;  2K4D A;  2YSM A;  2FUI A;  3SHB A;  5C13 A;  4Q6F A;  3O37 A;  3U5O A;  1WIM A;  1LDK C;  2ECV A;  2KWJ A;  4GB0 A;  2H0D A;  2LGL A;  3ZNI A;  2MA5 A;  1WEV A;  1T1H A;  5G04 B;  1X4U A;  3PHD A;  2G43 A;  4L58 A;  2L80 A;  1Z60 A;  3N9Q A;  2MNZ A;  5LKX A;  2VJE B;  2LGV A;  4MVT A;  4QF3 A;  5B76 A;  2KWK A;  2KWN A;  3GV4 A;  2LRI C;  3N9L A;  2Y1N A;  5TRB A;  2F6N A;  4S3O C;  3ZVZ B;  3ZVY A;  4LKA A;  3HCS A;  2YHN A;  4PTB A;  4B7Y C;  2MNY A;  2YQL A;  2JMI A;  3L1Z B;  1F62 A;  2EOD A;  3O70 A;  2ECI A;  2LQ6 A;  1MM3 A;  5JG6 A;  5C11 A;  2ZET C;  2VJF B;  1G25 A;  1Z2Q A; 
#chains in the Genus database with same CATH topology
 5KH9 A;  2D8U A;  5LKZ A;  3NG2 A;  3FAN A;  2JMD A;  4AYC B;  2CSZ A;  3O36 A;  2M6M A;  2OXQ C;  2MD7 B;  3ZPV E;  4YAT A;  2JM3 A;  5KH3 A;  5D1L B;  5TBN A;  4PPE A;  2C2V S;  2QJ0 A;  4CCG X;  2ECT A;  2L43 A;  4B86 C;  2E6R A;  4R8P K;  2MUM A;  5FER A;  3HCT A;  3IHP A;  1RMD A;  4YBT A;  4V3L C;  4YAX A;  3ZPV 1;  1VFY A;  2KGI A;  3PLW A;  3Q1D A;  4V3K C;  1WE9 A;  4QF2 A;  2PUY A;  5KH7 A;  3M62 A;  5H1V A;  2G6Q A;  1IYM A;  4L7X A;  4MSX A;  2YUR A;  1E4U A;  2KKY A;  4WZ3 B;  2M1R A;  2FFW A;  2XP0 A;  3HTK C;  4FK5 A;  1Z6U A;  2XOZ A;  4I7D A;  4YAB A;  5H1U A;  3KNV A;  3KQI A;  2YYR A;  1K2F A;  4AVX A;  2MKE A;  1LDJ B;  2CSV A;  4AP4 A;  3LJU X;  2RR4 A;  3U5N A;  2ECJ A;  2L75 A;  1JM7 A;  4IC2 A;  3LRQ A;  4R2Y A;  2AN6 A;  3H7H A;  1FBV A;  1FP0 A;  4BHW A;  1WEU A;  5D1M B;  2KR4 A;  3VK6 A;  1JOC A;  2KE1 A;  1WEO A;  4A4B A;  2QIZ A;  2YSJ A;  3DWD A;  3FL2 A;  5LKT A;  5G0F A;  5TAB A;  3T7L A;  3N9N A;  1WFK A;  3SUB A;  3N9M A;  2XEU A;  1WEW A;  2KGG A;  5SVY A;  2FD4 A;  5FB1 A;  4WZ0 A;  5D1K B;  5EYA F;  2CKL A;  3KDE C;  3LVR E;  4UP5 A;  5AIU A;  2LV9 A;  3EB5 A;  5B75 A;  3M63 A;  2VPG A;  2F42 A;  3HCU A;  2K17 A;  4I7B A;  5B79 A;  3DPL R;  4AUQ B;  3FEH A;  4NN2 A;  2L5U A;  4OGE A;  5DIN A;  3MHS A;  2LGG A;  3O33 A;  1VD4 A;  2BAY A;  2VPB A;  2CRW A;  1X4J A;  2H0D B;  2YUC A;  5FB0 A;  1N87 A;  5B8D A;  3N9P A;  3E2D A;  1BOR A;  2KYU A;  3MHH A;  5SVI A;  2ECG A;  3ASL A;  2LDR A;  1ZBD B;  2YHO A;  3RTR B;  4F1P A;  2ECN A;  1HYJ A;  3I2D A;  1WEN A;  4ZUX U;  4GND A;  4A0C D;  3T9K A;  4WZ2 A;  2VJE A;  2VPE A;  4N3W A;  2RSD A;  3C6W A;  4FIP A;  2YRE A;  2L0B A;  3O35 A;  3LDY A;  3U5M A;  3EB6 A;  2QIC A;  4N4F A;  4W4U A;  1WGM A;  1WEE A;  1VYX A;  5TDW A;  1WEP A;  5DKA A;  2FUU A;  3SOU A;  2VP7 A;  1WES A;  2IDA A;  3LQH A;  4YAD A;  2ECW A;  1WEQ A;  4XI1 A;  3FJU B;  4CA1 A;  4ZDT A;  4YBS A;  2M13 A;  5AIT A;  2VJF A;  3ZYQ A;  5H1T A;  4P5O B;  2LN0 A;  4O62 A;  5J3X A;  4AYC A;  2IQJ A;  2EA6 A;  2M85 A;  4FO9 A;  2EXU A;  2YW8 A;  3JUE A;  2YVR A;  5TDR A;  1DCQ A;  3ZTG A;  4YBM A;  2HDP A;  5SVI B;  2E6S A;  5FEY A;  2VPD A;  5LKU A;  2D8S A;  2FSA A;  2L7P A;  2K16 A;  2PNX A;  2Y1M A;  4UP0 A;  4A49 A;  2JRJ A;  3C5K A;  3O47 A;  2VNF A;  1U6G B;  4R7E A;  2MIQ A;  3GL6 A;  4X3G A;  4A4C A;  2KU3 A;  2NAA A;  4S3O B;  3V43 A;  4C9Z A;  4LJN A;  3DDT A;  4I7C A;  5B78 A;  4GNF A;  3O7A A;  1DVP A;  3KV6 A;  4FJC A;  4GNE A;  2MD8 C;  4LK9 A;  1HYI A;  4F52 B;  3N9O A;  1WIL A;  5B77 A;  2I50 A;  3M7K A;  4BBQ A;  2KIZ A;  3L11 A;  4TKP B;  5I3L A;  2Y43 A;  2G45 A;  2HYE D;  1WEM A;  3SOW A;  3RPG B;  2XB1 A;  3QZV A;  4LLB A;  4WA6 A;  3RPG C;  3T6R A;  2YU4 A;  5H9M A;  2DSM A;  3PUR A;  2JMJ A;  1MBM A;  2DJA A;  2EGM A;  3PUQ A;  2UZG A;  5SVX A;  5G05 B;  4O64 A;  2XOY A;  4Z0O A;  3L1X A;  1JM7 B;  1CHC A;  1MM2 A;  2CRR A;  2LGK A;  2KWO A;  2MT5 A;  2C2L A;  2KRE A;  2M3H A;  5LCW B;  2LXP C;  4GNG A;  2CSY A;  3LQI A;  2MA6 A;  4UI9 B;  1XWH A;  3SOX A;  2YQM A;  2EGP A;  1X4I A;  2CON A;  2DX8 A;  2F6J A;  2YT5 A;  3FAO A;  3LQJ A;  2CT2 A;  4IC3 A;  2KFT A;  2CKL B;  3DQV R;  2K1J A;  3M99 A;  2LXH C;  3KV5 A;  2LAU A;  4LAD B;  4ZQL A;  4YC9 A;  3U5P A;  1V87 A;  2RI7 A;  3O34 A;  2K4D A;  2OWA A;  2YSM A;  2FUI A;  3SHB A;  3LVQ E;  2E61 A;  4Z0R A;  5C13 A;  4Q6F A;  3O37 A;  3U5O A;  1WIM A;  4OGC A;  1LDK C;  2ECV A;  2KWJ A;  4GB0 A;  2KKX A;  2H0D A;  2LGL A;  3ZNI A;  2MA5 A;  1WEV A;  1T1H A;  5G04 B;  4H9D A;  1X4U A;  3FM8 C;  3PHD A;  2JUN A;  2G43 A;  4L58 A;  2L80 A;  1Z60 A;  2XOC A;  3N9Q A;  2MNZ A;  5LKX A;  2VJE B;  2LGV A;  4MVT A;  4QQ4 A;  4QF3 A;  5B76 A;  2B0O E;  2KWN A;  2KWK A;  3GV4 A;  2LRI C;  3N9L A;  2Y1N A;  5TRB A;  2F6N A;  4S3O C;  3ZVZ B;  3ZVY A;  4LKA A;  3MDB C;  3HCS A;  2YHN A;  2P57 A;  4PTB A;  4B7Y C;  2MNY A;  5K3Q A;  2YQL A;  2JMI A;  3L1Z B;  1F62 A;  2EOD A;  3O70 A;  2ECI A;  2LQ6 A;  1MM3 A;  5JG6 A;  5C11 A;  2ZET C;  2VJF B;  1G25 A;  1Z2Q A; 
#chains in the Genus database with same CATH homology
 5KH9 A;  5LKZ A;  3NG2 A;  2JMD A;  4AYC B;  2CSZ A;  3O36 A;  2M6M A;  2OXQ C;  2MD7 B;  3ZPV E;  4YAT A;  5KH3 A;  5D1L B;  5TBN A;  4PPE A;  2C2V S;  2QJ0 A;  4CCG X;  2ECT A;  2L43 A;  4B86 C;  2E6R A;  4R8P K;  2MUM A;  5FER A;  3HCT A;  3IHP A;  1RMD A;  4YBT A;  4V3L C;  4YAX A;  3ZPV 1;  1VFY A;  2KGI A;  4V3K C;  1WE9 A;  4QF2 A;  2PUY A;  5KH7 A;  3M62 A;  5H1V A;  2G6Q A;  1IYM A;  4L7X A;  4MSX A;  2YUR A;  1E4U A;  4WZ3 B;  2M1R A;  4FK5 A;  3HTK C;  1Z6U A;  4I7D A;  4YAB A;  5H1U A;  3KNV A;  3KQI A;  2YYR A;  1K2F A;  4AVX A;  1LDJ B;  4AP4 A;  3U5N A;  2ECJ A;  2L75 A;  1JM7 A;  4IC2 A;  3LRQ A;  4R2Y A;  2AN6 A;  1FBV A;  1FP0 A;  4BHW A;  1WEU A;  5D1M B;  2KR4 A;  3VK6 A;  1JOC A;  2KE1 A;  1WEO A;  4A4B A;  2QIZ A;  2YSJ A;  3FL2 A;  5LKT A;  5G0F A;  5TAB A;  3T7L A;  3N9N A;  1WFK A;  3N9M A;  2XEU A;  1WEW A;  2KGG A;  5FB1 A;  4WZ0 A;  5D1K B;  5EYA F;  2CKL A;  4UP5 A;  5AIU A;  2LV9 A;  3EB5 A;  5B75 A;  3M63 A;  2VPG A;  2F42 A;  3HCU A;  2K17 A;  4I7B A;  5B79 A;  3DPL R;  4AUQ B;  4NN2 A;  2L5U A;  5DIN A;  3MHS A;  2LGG A;  3O33 A;  1VD4 A;  2BAY A;  2VPB A;  1X4J A;  2H0D B;  2YUC A;  5FB0 A;  1N87 A;  5B8D A;  3N9P A;  1BOR A;  2KYU A;  3MHH A;  2ECG A;  3ASL A;  2LDR A;  1ZBD B;  2YHO A;  3RTR B;  2ECN A;  1HYJ A;  3I2D A;  1WEN A;  4ZUX U;  4GND A;  4A0C D;  4WZ2 A;  2VJE A;  2VPE A;  4N3W A;  2RSD A;  3C6W A;  4FIP A;  2YRE A;  2L0B A;  3O35 A;  3U5M A;  3EB6 A;  2QIC A;  4N4F A;  4W4U A;  1WGM A;  1WEE A;  1VYX A;  5TDW A;  1WEP A;  5DKA A;  2FUU A;  3SOU A;  2VP7 A;  1WES A;  2IDA A;  3LQH A;  4YAD A;  2ECW A;  1WEQ A;  4XI1 A;  4CA1 A;  4ZDT A;  4YBS A;  5AIT A;  2VJF A;  3ZYQ A;  5H1T A;  4P5O B;  2LN0 A;  5J3X A;  4AYC A;  2EA6 A;  2M85 A;  4FO9 A;  2YW8 A;  5TDR A;  3ZTG A;  4YBM A;  2HDP A;  2E6S A;  5FEY A;  2VPD A;  5LKU A;  2D8S A;  2FSA A;  2K16 A;  2PNX A;  2Y1M A;  4UP0 A;  4A49 A;  2JRJ A;  3C5K A;  2VNF A;  1U6G B;  4R7E A;  2MIQ A;  3GL6 A;  4X3G A;  4A4C A;  2KU3 A;  2NAA A;  4S3O B;  3V43 A;  4C9Z A;  4LJN A;  4I7C A;  5B78 A;  4GNF A;  3O7A A;  1DVP A;  3KV6 A;  4FJC A;  4GNE A;  2MD8 C;  4LK9 A;  1HYI A;  4F52 B;  3N9O A;  1WIL A;  5B77 A;  2I50 A;  4BBQ A;  2KIZ A;  3L11 A;  4TKP B;  5I3L A;  2Y43 A;  2G45 A;  2HYE D;  1WEM A;  3SOW A;  3RPG B;  2XB1 A;  3QZV A;  4LLB A;  4WA6 A;  3RPG C;  3T6R A;  2YU4 A;  5H9M A;  3PUR A;  2JMJ A;  3PUQ A;  2UZG A;  5G05 B;  4O64 A;  3L1X A;  1JM7 B;  1CHC A;  1MM2 A;  2LGK A;  2KWO A;  2MT5 A;  2C2L A;  2KRE A;  2M3H A;  5LCW B;  2LXP C;  4GNG A;  2CSY A;  3LQI A;  2MA6 A;  4UI9 B;  1XWH A;  3SOX A;  2YQM A;  2EGP A;  1X4I A;  2DX8 A;  2F6J A;  2YT5 A;  3LQJ A;  2CT2 A;  4IC3 A;  2KFT A;  2CKL B;  3DQV R;  2K1J A;  3M99 A;  2LXH C;  3KV5 A;  4LAD B;  4ZQL A;  4YC9 A;  3U5P A;  1V87 A;  2RI7 A;  3O34 A;  2K4D A;  2YSM A;  2FUI A;  3SHB A;  5C13 A;  4Q6F A;  3O37 A;  3U5O A;  1WIM A;  1LDK C;  2ECV A;  2KWJ A;  4GB0 A;  2H0D A;  2LGL A;  3ZNI A;  2MA5 A;  1WEV A;  1T1H A;  5G04 B;  1X4U A;  3PHD A;  2G43 A;  4L58 A;  2L80 A;  1Z60 A;  3N9Q A;  2MNZ A;  5LKX A;  2VJE B;  2LGV A;  4MVT A;  4QF3 A;  5B76 A;  2KWK A;  2KWN A;  3GV4 A;  2LRI C;  3N9L A;  2Y1N A;  5TRB A;  2F6N A;  4S3O C;  3ZVZ B;  3ZVY A;  4LKA A;  3HCS A;  2YHN A;  4PTB A;  4B7Y C;  2MNY A;  2YQL A;  2JMI A;  3L1Z B;  1F62 A;  2EOD A;  3O70 A;  2ECI A;  2LQ6 A;  1MM3 A;  5JG6 A;  5C11 A;  2ZET C;  2VJF B;  1G25 A;  1Z2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...