3LRQA

Crystal structure of the u-box domain of human ubiquitin-protein ligase (e3), northeast structural genomics consortium target hr4604d.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
b'HMDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase TRIM37
publication title E3 UBIQUITIN-PROTEIN LIGASE RING DOMAIN FROM HUMAN TRIPARTITE MOTIF-CONTAINING PROTEIN 37 (TRIM37), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4604D.
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 18
structure length 82
sequence length 82
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3lrqA00
3SOUA 1WIMA 5C13A 3M63A 4R7EA 4V3KC 5KH9A 5J3XA 2I50A 4FO9A 1G25A 3FL2A 4ZUXU 2M85A 2LV9A 2EGPA 3RPGC 2MA6A 2PUYA 4X3GA 3O33A 2YT5A 4AP4A 1WEPA 3RTRB 2LDRA 3GV4A 1Z6UA 5I3LA 1WGMA 2VPEA 2RI7A 3O35A 4B7YC 5TBNA 2LGKA 1WEQA 5G0FA 2Y1NA 2Y43A 2KWJA 5FB0A 1V87A 4ZQLA 2YURA 1HYJA 5H1VA 3HCSA 3M62A 3PURA 3HCUA 1IYMA 2ECWA 4UP5A 3O34A 5LCWB 3N9LA 4P5OB 2QICA 2FUUA 3LQJA 2KU3A 3LRQA 4A0CD 3I2DA 1VFYA 1RMDA 4LADB 4S3OC 2MT5A 4R2YA 4QF2A 3NG2A 2G6QA 3T6RA 3ZVZB 5EYAF 2YYRA 3ZPV1 2XB1A 2CT2A 5B78A 1DVPA 5B8DA 4B86C 2JMDA 2LN0A 3U5MA 2YW8A 3PUQA 5LKTA 2KREA 2IDAA 2K17A 2G45A 2K4DA 3EB6A 3EB5A 1WESA 1U6GB 2KWKA 4C9ZA 4YBMA 4V3LC 5B75A 2M1RA 5KH3A 2KWNA 2KIZA 3L11A 3SOWA 2KGIA 2Y1MA 3GL6A 4WZ3B 2KYUA 2ECVA 5DKAA 2LQ6A 4GB0A 1LDJB 4FIPA 4YBSA 2BAYA 3L1XA 3M99A 3VK6A 2ECGA 5G04B 2K16A 3O37A 3U5OA 5KH7A 2YQLA 2CSZA 4L58A 4NN2A 2LXPC 3L1ZB 2LGLA 5LKUA 5LKXA 2QJ0A 2MD8C 2VJEA 2YHOA 1FP0A 4YBTA 4R8PK 2G43A 2E6SA 3ZNIA 4WZ0A 2L80A 3KQIA 1MM2A 2YQMA 1WENA 5FEYA 1CHCA 4A49A 2L43A 2F42A 2AN6A 2VJEB 2JRJA 4LJNA 1WEOA 3ZYQA 2K1JA 1XWHA 4GNDA 2H0DA 5D1LB 2MUMA 3HTKC 4W4UA 2QIZA 1WFKA 5H1UA 5D1MB 5H9MA 2LGGA 3O7AA 4N3WA 2KGGA 3KV5A 3U5NA 1WEVA 1T1HA 3C5KA 3SOXA 4MVTA 1WILA 1BORA 4BBQA 2C2LA 4IC3A 2H0DB 2LXHC 2YSJA 3T7LA 1JM7B 4GNGA 1WEWA 4YATA 4LLBA 5G05B 3N9PA 5B79A 5JG6A 4AVXA 3DQVR 2JMJA 2L5UA 3DPLR 4BHWA 2L75A 5TRBA 4N4FA 5AIUA 1X4JA 4WZ2A 1F62A 3U5PA 4GNFA 4I7DA 2OXQC 4UP0A 2PNXA 4XI1A 4PPEA 5TDWA 2EODA 1Z60A 2D8SA 4FK5A 5B77A 2EA6A 1ZBDB 2C2VS 1E4UA 2YREA 4O64A 2KR4A 3MHSA 4YC9A 3PHDA 3KNVA 1Z2QA 3MHHA 2YU4A 2UZGA 2ECJA 2ECIA 4CA1A 2E6RA 1N87A 2MA5A 3ZPVE 4LK9A 4AUQB 1MM3A 2MNZA 3HCTA 4YADA 2MNYA 2M6MA 4UI9B 3N9QA 3RPGB 4I7CA 3KV6A 4WA6A 1X4IA 4QF3A 2RSDA 2MD7B 5FB1A 3ZVYA 2CSYA 3ZTGA 4I7BA 2YHNA 1WE9A 2F6NA 3O36A 5H1TA 3N9OA 1X4UA 2M3HA 2YSMA 4FJCA 2NAAA 1WEUA 3N9MA 1JM7A 2LRIC 3QZVA 2FSAA 4PTBA 4MSXA 2VP7A 2DX8A 1HYIA 4A4CA 1LDKC 3N9NA 4CCGX 2ZETC 4AYCA 4ZDTA 2YUCA 1WEEA 4YAXA 1K2FA 4Q6FA 2VPDA 4TKPB 2HDPA 2F6JA 3ASLA 3LQHA 3V43A 4L7XA 4IC2A 4S3OB 2FUIA 5TABA 2VPGA 2VJFA 2CKLA 2KWOA 4GNEA 5DINA 2ECTA 3SHBA 4A4BA 4AYCB 2L0BA 2KE1A 3O70A 1JOCA 5C11A 2MIQA 2VNFA 5AITA 5TDRA 5B76A 4F52B 3IHPA 2LGVA 3C6WA 2ECNA 1VYXA 4LKAA 2VJFB 4YABA 1FBVA 2CKLB 2HYED 1WEMA 2XEUA 2VPBA 5D1KB 1VD4A 2KFTA 5LKZA 3LQIA 2JMIA 5FERA
chains in the Genus database with same CATH superfamily
4H9DA 3SOUA 3FM8C 1WIMA 5C13A 3M63A 4R7EA 4V3KC 5KH9A 5J3XA 2I50A 4FO9A 1G25A 3FL2A 4ZUXU 2M85A 2LV9A 2EGPA 3RPGC 2MA6A 2PUYA 3LVRE 4X3GA 3O33A 5SVIA 2YT5A 4AP4A 1WEPA 3FANA 3RTRB 2LDRA 2XOCA 3GV4A 1Z6UA 5I3LA 1WGMA 4QQ4A 2VPEA 3O35A 2RI7A 4B7YC 5TBNA 2LGKA 1WEQA 5G0FA 2Y1NA 2Y43A 2KWJA 5FB0A 1V87A 4ZQLA 2CRWA 5SVIB 2YURA 1HYJA 5H1VA 3HCSA 3M62A 2JM3A 3PURA 3HCUA 1IYMA 2ECWA 4UP5A 3O34A 5LCWB 3N9LA 4P5OB 2QICA 4Z0RA 2FUUA 3LQJA 2KU3A 3LRQA 1MBMA 4A0CD 3I2DA 1VFYA 1RMDA 4F1PA 4LADB 4S3OC 2MT5A 4R2YA 2RR4A 4QF2A 3NG2A 4O62A 2IQJA 2G6QA 5K3QA 3T6RA 3ZVZB 5EYAF 2YYRA 3ZPV1 2XB1A 2CT2A 5B78A 1DVPA 2D8UA 5B8DA 4B86C 2JMDA 3LDYA 2LN0A 3U5MA 2YW8A 3PUQA 5LKTA 2KREA 2IDAA 2K17A 2G45A 2K4DA 3EB6A 3EB5A 1WESA 1U6GB 2KWKA 4C9ZA 4YBMA 4V3LC 5B75A 2M1RA 5KH3A 2KWNA 2CONA 2KIZA 3L11A 3SOWA 2KGIA 2Y1MA 3GL6A 4WZ3B 3FJUB 2KYUA 2ECVA 2JUNA 5DKAA 2LQ6A 4GB0A 1LDJB 4FIPA 4YBSA 2L7PA 2BAYA 3L1XA 3M99A 3VK6A 2ECGA 5G04B 2K16A 3O37A 3U5OA 3FEHA 2YQLA 2CSZA 5KH7A 4L58A 4NN2A 2LXPC 3L1ZB 2DJAA 2LGLA 5LKUA 5LKXA 2QJ0A 2MD8C 2VJEA 2MKEA 2YHOA 1FP0A 4YBTA 4R8PK 2G43A 2E6SA 3Q1DA 3ZNIA 4WZ0A 2L80A 3KQIA 2EGMA 2M13A 1MM2A 2YQMA 1WENA 5FEYA 1CHCA 4A49A 2L43A 2F42A 2AN6A 2VJEB 2JRJA 4LJNA 1WEOA 3ZYQA 2K1JA 1XWHA 4GNDA 2H0DA 5D1LB 3SUBA 2MUMA 3HTKC 4W4UA 2QIZA 1WFKA 5H1UA 5D1MB 5H9MA 2LGGA 3O7AA 4N3WA 2KGGA 4OGEA 3KV5A 3U5NA 1WEVA 1T1HA 3C5KA 3SOXA 4MVTA 3E2DA 1WILA 1BORA 2XOZA 4BBQA 2C2LA 4IC3A 2H0DB 2LXHC 2YSJA 3T7LA 2KKXA 1JM7B 2KKYA 4GNGA 1WEWA 4YATA 4LLBA 5G05B 3N9PA 5B79A 5JG6A 4AVXA 3DQVR 2JMJA 2L5UA 3DPLR 3FAOA 3M7KA 4BHWA 2L75A 5TRBA 4N4FA 2B0OE 5AIUA 1X4JA 4WZ2A 1F62A 3U5PA 4GNFA 3LVQE 4I7DA 2OXQC 2FD4A 4UP0A 2PNXA 4XI1A 4PPEA 5TDWA 2EODA 1Z60A 2XP0A 2D8SA 3T9KA 3PLWA 4FK5A 3O47A 5B77A 2EA6A 1ZBDB 2C2VS 1DCQA 1E4UA 2YREA 4O64A 2KR4A 3MHSA 4YC9A 3PHDA 3KNVA 1Z2QA 3MHHA 2YU4A 2UZGA 2ECJA 2ECIA 4CA1A 2E6RA 1N87A 2CSVA 2MA5A 3ZPVE 2LAUA 4LK9A 4AUQB 3LJUX 1MM3A 2MNZA 3HCTA 4YADA 2MNYA 2M6MA 4UI9B 3N9QA 3RPGB 2OWAA 4I7CA 3KV6A 4WA6A 1X4IA 4QF3A 2RSDA 2MD7B 3KDEC 5FB1A 3ZVYA 2CSYA 3ZTGA 3JUEA 4I7BA 2YHNA 1WE9A 2F6NA 3O36A 5H1TA 3N9OA 1X4UA 2M3HA 2CRRA 2P57A 2YSMA 4FJCA 2NAAA 1WEUA 3N9MA 1JM7A 2LRIC 3QZVA 2FSAA 2EXUA 3MDBC 4PTBA 4MSXA 2VP7A 2DX8A 1HYIA 4A4CA 1LDKC 3N9NA 4CCGX 2ZETC 4AYCA 4ZDTA 2YUCA 2DSMA 1WEEA 4YAXA 1K2FA 4Q6FA 3DWDA 2E61A 2VPDA 4TKPB 5SVXA 2YVRA 2HDPA 2F6JA 3DDTA 3ASLA 3LQHA 3V43A 4L7XA 4IC2A 4S3OB 2FUIA 5TABA 2VPGA 2VJFA 2CKLA 2KWOA 4GNEA 5DINA 2ECTA 3SHBA 4A4BA 4AYCB 2L0BA 2KE1A 3H7HA 3O70A 1JOCA 5C11A 2MIQA 4Z0OA 2VNFA 5AITA 2XOYA 5TDRA 5SVYA 5B76A 4F52B 3IHPA 2LGVA 3C6WA 2ECNA 2FFWA 1VYXA 4LKAA 2VJFB 4YABA 1FBVA 2CKLB 2HYED 1WEMA 2XEUA 2VPBA 4OGCA 5D1KB 1VD4A 2KFTA 5LKZA 3LQIA 2JMIA 5FERA
chains in the Genus database with same CATH topology
3SOUA 1WIMA 5C13A 3M63A 4R7EA 4V3KC 5KH9A 5J3XA 2I50A 4FO9A 1G25A 3FL2A 4ZUXU 2M85A 2LV9A 2EGPA 3RPGC 2MA6A 2PUYA 4X3GA 3O33A 2YT5A 4AP4A 1WEPA 3RTRB 2LDRA 3GV4A 1Z6UA 5I3LA 1WGMA 2VPEA 2RI7A 3O35A 4B7YC 5TBNA 2LGKA 1WEQA 5G0FA 2Y1NA 2Y43A 2KWJA 5FB0A 1V87A 4ZQLA 2YURA 1HYJA 5H1VA 3HCSA 3M62A 3PURA 3HCUA 1IYMA 2ECWA 4UP5A 3O34A 5LCWB 3N9LA 4P5OB 2QICA 2FUUA 3LQJA 2KU3A 3LRQA 4A0CD 3I2DA 1VFYA 1RMDA 4LADB 4S3OC 2MT5A 4R2YA 4QF2A 3NG2A 2G6QA 3T6RA 3ZVZB 5EYAF 2YYRA 3ZPV1 2XB1A 2CT2A 5B78A 1DVPA 5B8DA 4B86C 2JMDA 2LN0A 3U5MA 2YW8A 3PUQA 5LKTA 2KREA 2IDAA 2K17A 2G45A 2K4DA 3EB6A 3EB5A 1WESA 1U6GB 2KWKA 4C9ZA 4YBMA 4V3LC 5B75A 2M1RA 5KH3A 2KWNA 2KIZA 3L11A 3SOWA 2KGIA 2Y1MA 3GL6A 4WZ3B 2KYUA 2ECVA 5DKAA 2LQ6A 4GB0A 1LDJB 4FIPA 4YBSA 2BAYA 3L1XA 3M99A 3VK6A 2ECGA 5G04B 2K16A 3O37A 3U5OA 5KH7A 2YQLA 2CSZA 4L58A 4NN2A 2LXPC 3L1ZB 2LGLA 5LKUA 5LKXA 2QJ0A 2MD8C 2VJEA 2YHOA 1FP0A 4YBTA 4R8PK 2G43A 2E6SA 3ZNIA 4WZ0A 2L80A 3KQIA 1MM2A 2YQMA 1WENA 5FEYA 1CHCA 4A49A 2L43A 2F42A 2AN6A 2VJEB 2JRJA 4LJNA 1WEOA 3ZYQA 2K1JA 1XWHA 4GNDA 2H0DA 5D1LB 2MUMA 3HTKC 4W4UA 2QIZA 1WFKA 5H1UA 5D1MB 5H9MA 2LGGA 3O7AA 4N3WA 2KGGA 3KV5A 3U5NA 1WEVA 1T1HA 3C5KA 3SOXA 4MVTA 1WILA 1BORA 4BBQA 2C2LA 4IC3A 2H0DB 2LXHC 2YSJA 3T7LA 1JM7B 4GNGA 1WEWA 4YATA 4LLBA 5G05B 3N9PA 5B79A 5JG6A 4AVXA 3DQVR 2JMJA 2L5UA 3DPLR 4BHWA 2L75A 5TRBA 4N4FA 5AIUA 1X4JA 4WZ2A 1F62A 3U5PA 4GNFA 4I7DA 2OXQC 4UP0A 2PNXA 4XI1A 4PPEA 5TDWA 2EODA 1Z60A 2D8SA 4FK5A 5B77A 2EA6A 1ZBDB 2C2VS 1E4UA 2YREA 4O64A 2KR4A 3MHSA 4YC9A 3PHDA 3KNVA 1Z2QA 3MHHA 2YU4A 2UZGA 2ECJA 2ECIA 4CA1A 2E6RA 1N87A 2MA5A 3ZPVE 4LK9A 4AUQB 1MM3A 2MNZA 3HCTA 4YADA 2MNYA 2M6MA 4UI9B 3N9QA 3RPGB 4I7CA 3KV6A 4WA6A 1X4IA 4QF3A 2RSDA 2MD7B 5FB1A 3ZVYA 2CSYA 3ZTGA 4I7BA 2YHNA 1WE9A 2F6NA 3O36A 5H1TA 3N9OA 1X4UA 2M3HA 2YSMA 4FJCA 2NAAA 1WEUA 3N9MA 1JM7A 2LRIC 3QZVA 2FSAA 4PTBA 4MSXA 2VP7A 2DX8A 1HYIA 4A4CA 1LDKC 3N9NA 4CCGX 2ZETC 4AYCA 4ZDTA 2YUCA 1WEEA 4YAXA 1K2FA 4Q6FA 2VPDA 4TKPB 2HDPA 2F6JA 3ASLA 3LQHA 3V43A 4L7XA 4IC2A 4S3OB 2FUIA 5TABA 2VPGA 2VJFA 2CKLA 2KWOA 4GNEA 5DINA 2ECTA 3SHBA 4A4BA 4AYCB 2L0BA 2KE1A 3O70A 1JOCA 5C11A 2MIQA 2VNFA 5AITA 5TDRA 5B76A 4F52B 3IHPA 2LGVA 3C6WA 2ECNA 1VYXA 4LKAA 2VJFB 4YABA 1FBVA 2CKLB 2HYED 1WEMA 2XEUA 2VPBA 5D1KB 1VD4A 2KFTA 5LKZA 3LQIA 2JMIA 5FERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOU A;  1WIM A;  5C13 A;  3M63 A;  4R7E A;  4V3K C;  5KH9 A;  5J3X A;  2I50 A;  4FO9 A;  1G25 A;  3FL2 A;  4ZUX U;  2M85 A;  2LV9 A;  2EGP A;  3RPG C;  2MA6 A;  2PUY A;  4X3G A;  3O33 A;  2YT5 A;  4AP4 A;  1WEP A;  3RTR B;  2LDR A;  3GV4 A;  1Z6U A;  5I3L A;  1WGM A;  2VPE A;  2RI7 A;  3O35 A;  4B7Y C;  5TBN A;  2LGK A;  1WEQ A;  5G0F A;  2Y1N A;  2Y43 A;  2KWJ A;  5FB0 A;  1V87 A;  4ZQL A;  2YUR A;  1HYJ A;  5H1V A;  3HCS A;  3M62 A;  3PUR A;  3HCU A;  1IYM A;  2ECW A;  4UP5 A;  3O34 A;  5LCW B;  3N9L A;  4P5O B;  2QIC A;  2FUU A;  3LQJ A;  2KU3 A;  3LRQ A;  4A0C D;  3I2D A;  1VFY A;  1RMD A;  4LAD B;  4S3O C;  2MT5 A;  4R2Y A;  4QF2 A;  3NG2 A;  2G6Q A;  3T6R A;  3ZVZ B;  5EYA F;  2YYR A;  3ZPV 1;  2XB1 A;  2CT2 A;  5B78 A;  1DVP A;  5B8D A;  4B86 C;  2JMD A;  2LN0 A;  3U5M A;  2YW8 A;  3PUQ A;  5LKT A;  2KRE A;  2IDA A;  2K17 A;  2G45 A;  2K4D A;  3EB6 A;  3EB5 A;  1WES A;  1U6G B;  2KWK A;  4C9Z A;  4YBM A;  4V3L C;  5B75 A;  2M1R A;  5KH3 A;  2KWN A;  2KIZ A;  3L11 A;  3SOW A;  2KGI A;  2Y1M A;  3GL6 A;  4WZ3 B;  2KYU A;  2ECV A;  5DKA A;  2LQ6 A;  4GB0 A;  1LDJ B;  4FIP A;  4YBS A;  2BAY A;  3L1X A;  3M99 A;  3VK6 A;  2ECG A;  5G04 B;  2K16 A;  3O37 A;  3U5O A;  5KH7 A;  2YQL A;  2CSZ A;  4L58 A;  4NN2 A;  2LXP C;  3L1Z B;  2LGL A;  5LKU A;  5LKX A;  2QJ0 A;  2MD8 C;  2VJE A;  2YHO A;  1FP0 A;  4YBT A;  4R8P K;  2G43 A;  2E6S A;  3ZNI A;  4WZ0 A;  2L80 A;  3KQI A;  1MM2 A;  2YQM A;  1WEN A;  5FEY A;  1CHC A;  4A49 A;  2L43 A;  2F42 A;  2AN6 A;  2VJE B;  2JRJ A;  4LJN A;  1WEO A;  3ZYQ A;  2K1J A;  1XWH A;  4GND A;  2H0D A;  5D1L B;  2MUM A;  3HTK C;  4W4U A;  2QIZ A;  1WFK A;  5H1U A;  5D1M B;  5H9M A;  2LGG A;  3O7A A;  4N3W A;  2KGG A;  3KV5 A;  3U5N A;  1WEV A;  1T1H A;  3C5K A;  3SOX A;  4MVT A;  1WIL A;  1BOR A;  4BBQ A;  2C2L A;  4IC3 A;  2H0D B;  2LXH C;  2YSJ A;  3T7L A;  1JM7 B;  4GNG A;  1WEW A;  4YAT A;  4LLB A;  5G05 B;  3N9P A;  5B79 A;  5JG6 A;  4AVX A;  3DQV R;  2JMJ A;  2L5U A;  3DPL R;  4BHW A;  2L75 A;  5TRB A;  4N4F A;  5AIU A;  1X4J A;  4WZ2 A;  1F62 A;  3U5P A;  4GNF A;  4I7D A;  2OXQ C;  4UP0 A;  2PNX A;  4XI1 A;  4PPE A;  5TDW A;  2EOD A;  1Z60 A;  2D8S A;  4FK5 A;  5B77 A;  2EA6 A;  1ZBD B;  2C2V S;  1E4U A;  2YRE A;  4O64 A;  2KR4 A;  3MHS A;  4YC9 A;  3PHD A;  3KNV A;  1Z2Q A;  3MHH A;  2YU4 A;  2UZG A;  2ECJ A;  2ECI A;  4CA1 A;  2E6R A;  1N87 A;  2MA5 A;  3ZPV E;  4LK9 A;  4AUQ B;  1MM3 A;  2MNZ A;  3HCT A;  4YAD A;  2MNY A;  2M6M A;  4UI9 B;  3N9Q A;  3RPG B;  4I7C A;  3KV6 A;  4WA6 A;  1X4I A;  4QF3 A;  2RSD A;  2MD7 B;  5FB1 A;  3ZVY A;  2CSY A;  3ZTG A;  4I7B A;  2YHN A;  1WE9 A;  2F6N A;  3O36 A;  5H1T A;  3N9O A;  1X4U A;  2M3H A;  2YSM A;  4FJC A;  2NAA A;  1WEU A;  3N9M A;  1JM7 A;  2LRI C;  3QZV A;  2FSA A;  4PTB A;  4MSX A;  2VP7 A;  2DX8 A;  1HYI A;  4A4C A;  1LDK C;  3N9N A;  4CCG X;  2ZET C;  4AYC A;  4ZDT A;  2YUC A;  1WEE A;  4YAX A;  1K2F A;  4Q6F A;  2VPD A;  4TKP B;  2HDP A;  2F6J A;  3ASL A;  3LQH A;  3V43 A;  4L7X A;  4IC2 A;  4S3O B;  2FUI A;  5TAB A;  2VPG A;  2VJF A;  2CKL A;  2KWO A;  4GNE A;  5DIN A;  2ECT A;  3SHB A;  4A4B A;  4AYC B;  2L0B A;  2KE1 A;  3O70 A;  1JOC A;  5C11 A;  2MIQ A;  2VNF A;  5AIT A;  5TDR A;  5B76 A;  4F52 B;  3IHP A;  2LGV A;  3C6W A;  2ECN A;  1VYX A;  4LKA A;  2VJF B;  4YAB A;  1FBV A;  2CKL B;  2HYE D;  1WEM A;  2XEU A;  2VPB A;  5D1K B;  1VD4 A;  2KFT A;  5LKZ A;  3LQI A;  2JMI A;  5FER A; 
#chains in the Genus database with same CATH topology
 4H9D A;  3SOU A;  3FM8 C;  1WIM A;  5C13 A;  3M63 A;  4R7E A;  4V3K C;  5KH9 A;  5J3X A;  2I50 A;  4FO9 A;  1G25 A;  3FL2 A;  4ZUX U;  2M85 A;  2LV9 A;  2EGP A;  3RPG C;  2MA6 A;  2PUY A;  3LVR E;  4X3G A;  3O33 A;  5SVI A;  2YT5 A;  4AP4 A;  1WEP A;  3FAN A;  3RTR B;  2LDR A;  2XOC A;  3GV4 A;  1Z6U A;  5I3L A;  1WGM A;  4QQ4 A;  2VPE A;  3O35 A;  2RI7 A;  4B7Y C;  5TBN A;  2LGK A;  1WEQ A;  5G0F A;  2Y1N A;  2Y43 A;  2KWJ A;  5FB0 A;  1V87 A;  4ZQL A;  2CRW A;  5SVI B;  2YUR A;  1HYJ A;  5H1V A;  3HCS A;  3M62 A;  2JM3 A;  3PUR A;  3HCU A;  1IYM A;  2ECW A;  4UP5 A;  3O34 A;  5LCW B;  3N9L A;  4P5O B;  2QIC A;  4Z0R A;  2FUU A;  3LQJ A;  2KU3 A;  3LRQ A;  1MBM A;  4A0C D;  3I2D A;  1VFY A;  1RMD A;  4F1P A;  4LAD B;  4S3O C;  2MT5 A;  4R2Y A;  2RR4 A;  4QF2 A;  3NG2 A;  4O62 A;  2IQJ A;  2G6Q A;  5K3Q A;  3T6R A;  3ZVZ B;  5EYA F;  2YYR A;  3ZPV 1;  2XB1 A;  2CT2 A;  5B78 A;  1DVP A;  2D8U A;  5B8D A;  4B86 C;  2JMD A;  3LDY A;  2LN0 A;  3U5M A;  2YW8 A;  3PUQ A;  5LKT A;  2KRE A;  2IDA A;  2K17 A;  2G45 A;  2K4D A;  3EB6 A;  3EB5 A;  1WES A;  1U6G B;  2KWK A;  4C9Z A;  4YBM A;  4V3L C;  5B75 A;  2M1R A;  5KH3 A;  2KWN A;  2CON A;  2KIZ A;  3L11 A;  3SOW A;  2KGI A;  2Y1M A;  3GL6 A;  4WZ3 B;  3FJU B;  2KYU A;  2ECV A;  2JUN A;  5DKA A;  2LQ6 A;  4GB0 A;  1LDJ B;  4FIP A;  4YBS A;  2L7P A;  2BAY A;  3L1X A;  3M99 A;  3VK6 A;  2ECG A;  5G04 B;  2K16 A;  3O37 A;  3U5O A;  3FEH A;  2YQL A;  2CSZ A;  5KH7 A;  4L58 A;  4NN2 A;  2LXP C;  3L1Z B;  2DJA A;  2LGL A;  5LKU A;  5LKX A;  2QJ0 A;  2MD8 C;  2VJE A;  2MKE A;  2YHO A;  1FP0 A;  4YBT A;  4R8P K;  2G43 A;  2E6S A;  3Q1D A;  3ZNI A;  4WZ0 A;  2L80 A;  3KQI A;  2EGM A;  2M13 A;  1MM2 A;  2YQM A;  1WEN A;  5FEY A;  1CHC A;  4A49 A;  2L43 A;  2F42 A;  2AN6 A;  2VJE B;  2JRJ A;  4LJN A;  1WEO A;  3ZYQ A;  2K1J A;  1XWH A;  4GND A;  2H0D A;  5D1L B;  3SUB A;  2MUM A;  3HTK C;  4W4U A;  2QIZ A;  1WFK A;  5H1U A;  5D1M B;  5H9M A;  2LGG A;  3O7A A;  4N3W A;  2KGG A;  4OGE A;  3KV5 A;  3U5N A;  1WEV A;  1T1H A;  3C5K A;  3SOX A;  4MVT A;  3E2D A;  1WIL A;  1BOR A;  2XOZ A;  4BBQ A;  2C2L A;  4IC3 A;  2H0D B;  2LXH C;  2YSJ A;  3T7L A;  2KKX A;  1JM7 B;  2KKY A;  4GNG A;  1WEW A;  4YAT A;  4LLB A;  5G05 B;  3N9P A;  5B79 A;  5JG6 A;  4AVX A;  3DQV R;  2JMJ A;  2L5U A;  3DPL R;  3FAO A;  3M7K A;  4BHW A;  2L75 A;  5TRB A;  4N4F A;  2B0O E;  5AIU A;  1X4J A;  4WZ2 A;  1F62 A;  3U5P A;  4GNF A;  3LVQ E;  4I7D A;  2OXQ C;  2FD4 A;  4UP0 A;  2PNX A;  4XI1 A;  4PPE A;  5TDW A;  2EOD A;  1Z60 A;  2XP0 A;  2D8S A;  3T9K A;  3PLW A;  4FK5 A;  3O47 A;  5B77 A;  2EA6 A;  1ZBD B;  2C2V S;  1DCQ A;  1E4U A;  2YRE A;  4O64 A;  2KR4 A;  3MHS A;  4YC9 A;  3PHD A;  3KNV A;  1Z2Q A;  3MHH A;  2YU4 A;  2UZG A;  2ECJ A;  2ECI A;  4CA1 A;  2E6R A;  1N87 A;  2CSV A;  2MA5 A;  3ZPV E;  2LAU A;  4LK9 A;  4AUQ B;  3LJU X;  1MM3 A;  2MNZ A;  3HCT A;  4YAD A;  2MNY A;  2M6M A;  4UI9 B;  3N9Q A;  3RPG B;  2OWA A;  4I7C A;  3KV6 A;  4WA6 A;  1X4I A;  4QF3 A;  2RSD A;  2MD7 B;  3KDE C;  5FB1 A;  3ZVY A;  2CSY A;  3ZTG A;  3JUE A;  4I7B A;  2YHN A;  1WE9 A;  2F6N A;  3O36 A;  5H1T A;  3N9O A;  1X4U A;  2M3H A;  2CRR A;  2P57 A;  2YSM A;  4FJC A;  2NAA A;  1WEU A;  3N9M A;  1JM7 A;  2LRI C;  3QZV A;  2FSA A;  2EXU A;  3MDB C;  4PTB A;  4MSX A;  2VP7 A;  2DX8 A;  1HYI A;  4A4C A;  1LDK C;  3N9N A;  4CCG X;  2ZET C;  4AYC A;  4ZDT A;  2YUC A;  2DSM A;  1WEE A;  4YAX A;  1K2F A;  4Q6F A;  3DWD A;  2E61 A;  2VPD A;  4TKP B;  5SVX A;  2YVR A;  2HDP A;  2F6J A;  3DDT A;  3ASL A;  3LQH A;  3V43 A;  4L7X A;  4IC2 A;  4S3O B;  2FUI A;  5TAB A;  2VPG A;  2VJF A;  2CKL A;  2KWO A;  4GNE A;  5DIN A;  2ECT A;  3SHB A;  4A4B A;  4AYC B;  2L0B A;  2KE1 A;  3H7H A;  3O70 A;  1JOC A;  5C11 A;  2MIQ A;  4Z0O A;  2VNF A;  5AIT A;  2XOY A;  5TDR A;  5SVY A;  5B76 A;  4F52 B;  3IHP A;  2LGV A;  3C6W A;  2ECN A;  2FFW A;  1VYX A;  4LKA A;  2VJF B;  4YAB A;  1FBV A;  2CKL B;  2HYE D;  1WEM A;  2XEU A;  2VPB A;  4OGC A;  5D1K B;  1VD4 A;  2KFT A;  5LKZ A;  3LQI A;  2JMI A;  5FER A; 
#chains in the Genus database with same CATH homology
 3SOU A;  1WIM A;  5C13 A;  3M63 A;  4R7E A;  4V3K C;  5KH9 A;  5J3X A;  2I50 A;  4FO9 A;  1G25 A;  3FL2 A;  4ZUX U;  2M85 A;  2LV9 A;  2EGP A;  3RPG C;  2MA6 A;  2PUY A;  4X3G A;  3O33 A;  2YT5 A;  4AP4 A;  1WEP A;  3RTR B;  2LDR A;  3GV4 A;  1Z6U A;  5I3L A;  1WGM A;  2VPE A;  2RI7 A;  3O35 A;  4B7Y C;  5TBN A;  2LGK A;  1WEQ A;  5G0F A;  2Y1N A;  2Y43 A;  2KWJ A;  5FB0 A;  1V87 A;  4ZQL A;  2YUR A;  1HYJ A;  5H1V A;  3HCS A;  3M62 A;  3PUR A;  3HCU A;  1IYM A;  2ECW A;  4UP5 A;  3O34 A;  5LCW B;  3N9L A;  4P5O B;  2QIC A;  2FUU A;  3LQJ A;  2KU3 A;  3LRQ A;  4A0C D;  3I2D A;  1VFY A;  1RMD A;  4LAD B;  4S3O C;  2MT5 A;  4R2Y A;  4QF2 A;  3NG2 A;  2G6Q A;  3T6R A;  3ZVZ B;  5EYA F;  2YYR A;  3ZPV 1;  2XB1 A;  2CT2 A;  5B78 A;  1DVP A;  5B8D A;  4B86 C;  2JMD A;  2LN0 A;  3U5M A;  2YW8 A;  3PUQ A;  5LKT A;  2KRE A;  2IDA A;  2K17 A;  2G45 A;  2K4D A;  3EB6 A;  3EB5 A;  1WES A;  1U6G B;  2KWK A;  4C9Z A;  4YBM A;  4V3L C;  5B75 A;  2M1R A;  5KH3 A;  2KWN A;  2KIZ A;  3L11 A;  3SOW A;  2KGI A;  2Y1M A;  3GL6 A;  4WZ3 B;  2KYU A;  2ECV A;  5DKA A;  2LQ6 A;  4GB0 A;  1LDJ B;  4FIP A;  4YBS A;  2BAY A;  3L1X A;  3M99 A;  3VK6 A;  2ECG A;  5G04 B;  2K16 A;  3O37 A;  3U5O A;  5KH7 A;  2YQL A;  2CSZ A;  4L58 A;  4NN2 A;  2LXP C;  3L1Z B;  2LGL A;  5LKU A;  5LKX A;  2QJ0 A;  2MD8 C;  2VJE A;  2YHO A;  1FP0 A;  4YBT A;  4R8P K;  2G43 A;  2E6S A;  3ZNI A;  4WZ0 A;  2L80 A;  3KQI A;  1MM2 A;  2YQM A;  1WEN A;  5FEY A;  1CHC A;  4A49 A;  2L43 A;  2F42 A;  2AN6 A;  2VJE B;  2JRJ A;  4LJN A;  1WEO A;  3ZYQ A;  2K1J A;  1XWH A;  4GND A;  2H0D A;  5D1L B;  2MUM A;  3HTK C;  4W4U A;  2QIZ A;  1WFK A;  5H1U A;  5D1M B;  5H9M A;  2LGG A;  3O7A A;  4N3W A;  2KGG A;  3KV5 A;  3U5N A;  1WEV A;  1T1H A;  3C5K A;  3SOX A;  4MVT A;  1WIL A;  1BOR A;  4BBQ A;  2C2L A;  4IC3 A;  2H0D B;  2LXH C;  2YSJ A;  3T7L A;  1JM7 B;  4GNG A;  1WEW A;  4YAT A;  4LLB A;  5G05 B;  3N9P A;  5B79 A;  5JG6 A;  4AVX A;  3DQV R;  2JMJ A;  2L5U A;  3DPL R;  4BHW A;  2L75 A;  5TRB A;  4N4F A;  5AIU A;  1X4J A;  4WZ2 A;  1F62 A;  3U5P A;  4GNF A;  4I7D A;  2OXQ C;  4UP0 A;  2PNX A;  4XI1 A;  4PPE A;  5TDW A;  2EOD A;  1Z60 A;  2D8S A;  4FK5 A;  5B77 A;  2EA6 A;  1ZBD B;  2C2V S;  1E4U A;  2YRE A;  4O64 A;  2KR4 A;  3MHS A;  4YC9 A;  3PHD A;  3KNV A;  1Z2Q A;  3MHH A;  2YU4 A;  2UZG A;  2ECJ A;  2ECI A;  4CA1 A;  2E6R A;  1N87 A;  2MA5 A;  3ZPV E;  4LK9 A;  4AUQ B;  1MM3 A;  2MNZ A;  3HCT A;  4YAD A;  2MNY A;  2M6M A;  4UI9 B;  3N9Q A;  3RPG B;  4I7C A;  3KV6 A;  4WA6 A;  1X4I A;  4QF3 A;  2RSD A;  2MD7 B;  5FB1 A;  3ZVY A;  2CSY A;  3ZTG A;  4I7B A;  2YHN A;  1WE9 A;  2F6N A;  3O36 A;  5H1T A;  3N9O A;  1X4U A;  2M3H A;  2YSM A;  4FJC A;  2NAA A;  1WEU A;  3N9M A;  1JM7 A;  2LRI C;  3QZV A;  2FSA A;  4PTB A;  4MSX A;  2VP7 A;  2DX8 A;  1HYI A;  4A4C A;  1LDK C;  3N9N A;  4CCG X;  2ZET C;  4AYC A;  4ZDT A;  2YUC A;  1WEE A;  4YAX A;  1K2F A;  4Q6F A;  2VPD A;  4TKP B;  2HDP A;  2F6J A;  3ASL A;  3LQH A;  3V43 A;  4L7X A;  4IC2 A;  4S3O B;  2FUI A;  5TAB A;  2VPG A;  2VJF A;  2CKL A;  2KWO A;  4GNE A;  5DIN A;  2ECT A;  3SHB A;  4A4B A;  4AYC B;  2L0B A;  2KE1 A;  3O70 A;  1JOC A;  5C11 A;  2MIQ A;  2VNF A;  5AIT A;  5TDR A;  5B76 A;  4F52 B;  3IHP A;  2LGV A;  3C6W A;  2ECN A;  1VYX A;  4LKA A;  2VJF B;  4YAB A;  1FBV A;  2CKL B;  2HYE D;  1WEM A;  2XEU A;  2VPB A;  5D1K B;  1VD4 A;  2KFT A;  5LKZ A;  3LQI A;  2JMI A;  5FER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...