2FUUA

Nmr solution structure of the phd domain from the human bptf in complex with h3(1-15)k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fuuA00
4LK9A 1CHCA 2KWJA 2ECWA 3HCUA 3N9PA 4X3GA 5TRBA 5TDRA 2JMDA 4L7XA 2M3HA 1VD4A 4GNGA 2LDRA 2XB1A 5G04B 4AYCB 2UZGA 1MM3A 2VP7A 5D1LB 3ZPVE 2ECGA 2LGGA 2YU4A 2K16A 2MD8C 2KFTA 1FBVA 5KH9A 3N9MA 2LQ6A 3L11A 2KGIA 2MNYA 2F42A 2QICA 5DINA 3C5KA 3EB5A 4I7BA 1XWHA 4GNEA 1WEQA 5G05B 3PURA 3N9OA 3M63A 3I2DA 2VJEB 4A4BA 5LKUA 1MM2A 2KR4A 4F52B 4GNFA 1WEEA 3NG2A 2RI7A 3KV5A 5AITA 2MUMA 3SHBA 1WEOA 2KWOA 1WFKA 2VNFA 4CCGX 1HYIA 3ZYQA 2E6RA 3PUQA 2EA6A 2HDPA 1X4UA 3M62A 2PUYA 4PTBA 4NN2A 2I50A 2CKLA 2MD7B 2M6MA 3VK6A 2CSZA 3T7LA 3DPLR 3HCTA 2LXPC 1V87A 3N9QA 1JM7A 4WZ2A 5FB0A 2MNZA 3GL6A 3SOUA 2F6NA 2VPEA 3KQIA 3O70A 1Z6UA 5KH7A 1WGMA 2FUUA 4YBTA 2FUIA 4Q6FA 1LDJB 2DX8A 3O33A 2H0DA 5B78A 4R8PK 4LJNA 2Y1NA 2CSYA 4MVTA 1U6GB 4LADB 4W4UA 4YAXA 5H1VA 5JG6A 4AVXA 3LRQA 4PPEA 2LRIC 1WEUA 3RPGB 5FEYA 2CT2A 3RPGC 2JRJA 3DQVR 4QF3A 3EB6A 4AUQB 1WIMA 2ECIA 5B76A 4S3OB 2L80A 2JMJA 4P5OB 4S3OC 1WILA 3O36A 4O64A 2KU3A 4FJCA 3MHHA 5KH3A 4LKAA 5FERA 2EODA 2YSMA 2M85A 3U5NA 4WZ3B 5LKXA 2VPBA 1WE9A 1Z60A 4YABA 2YSJA 3KNVA 2LV9A 1WEWA 3L1XA 4BHWA 4AYCA 4I7CA 1G25A 4R7EA 2YT5A 4UP0A 5LKZA 1WESA 1WEPA 3ZVZB 4GNDA 3T6RA 3KV6A 2LGLA 4C9ZA 2QJ0A 2CKLB 2ZETC 3ASLA 2KWKA 2YREA 2VJFA 3N9NA 2YHNA 2AN6A 2LGVA 4YADA 3V43A 4N3WA 2YUCA 1K2FA 3LQJA 4L58A 4FO9A 2MT5A 4YATA 4YBMA 2G43A 4A49A 2KGGA 3LQIA 3L1ZB 2H0DB 2Y1MA 4IC2A 3LQHA 3FL2A 2LN0A 3U5MA 4QF2A 2YQLA 3HTKC 5H9MA 1VYXA 2IDAA 4WZ0A 1IYMA 4YC9A 3M99A 2YURA 4AP4A 4I7DA 5B8DA 4XI1A 1T1HA 4ZDTA 5B79A 2KREA 2K17A 2C2LA 3ZTGA 1LDKC 2G6QA 2NAAA 4V3LC 3MHSA 5D1KB 4YBSA 2M1RA 2VPDA 3GV4A 5J3XA 5C11A 4UI9B 4B86C 2K1JA 4A0CD 1F62A 2YW8A 5B75A 5H1UA 2KWNA 2PNXA 3U5PA 5D1MB 4TKPB 1VFYA 4N4FA 5H1TA 4ZQLA 2MA5A 4WA6A 5TDWA 3PHDA 3IHPA 4BBQA 1Z2QA 4B7YC 3C6WA 1N87A 1WEVA 3HCSA 2LXHC 3SOWA 2ECVA 2VJFB 3O37A 3N9LA 3O7AA 1X4IA 2YHOA 2OXQC 3O34A 2BAYA 2XEUA 2L43A 1RMDA 4IC3A 2KYUA 2ECNA 1HYJA 2MIQA 2L75A 3ZVYA 2JMIA 2KIZA 3SOXA 3U5OA 1JM7B 5EYAF 1ZBDB 2YQMA 4CA1A 4R2YA 4MSXA 4ZUXU 1DVPA 5TBNA 2VPGA 4UP5A 2HYED 5G0FA 4V3KC 1E4UA 2VJEA 3ZNIA 2D8SA 2ECTA 5I3LA 2F6JA 3RTRB 5LKTA 2MA6A 2YYRA 5LCWB 5B77A 5AIUA 4FIPA 5TABA 2ECJA 2K4DA 2L0BA 4FK5A 3ZPV1 2Y43A 3QZVA 2E6SA 2FSAA 1X4JA 3O35A 2L5UA 1BORA 1WENA 1JOCA 4GB0A 2RSDA 2C2VS 2QIZA 5FB1A 1FP0A 5C13A 2LGKA 4LLBA 5DKAA 2EGPA 4A4CA 2G45A 2KE1A 1WEMA
chains in the Genus database with same CATH superfamily
4LK9A 5SVXA 1CHCA 4Z0OA 2KWJA 2ECWA 3HCUA 3N9PA 4X3GA 5TRBA 5TDRA 4Z0RA 2JMDA 4L7XA 2M3HA 1VD4A 4GNGA 2LDRA 2XB1A 5G04B 4AYCB 2JUNA 2UZGA 5SVIB 1MM3A 2VP7A 5D1LB 3ZPVE 2ECGA 2LGGA 3JUEA 2YU4A 2K16A 4O62A 2MKEA 2MD8C 2KFTA 1FBVA 5KH9A 3N9MA 1DCQA 3MDBC 2LQ6A 3L11A 2KGIA 2MNYA 2F42A 2QICA 5DINA 3C5KA 3EB5A 4I7BA 1XWHA 3E2DA 4GNEA 1WEQA 5G05B 3PURA 3N9OA 3M63A 3I2DA 2VJEB 4A4BA 2D8UA 5LKUA 1MM2A 2KR4A 4F52B 4GNFA 1WEEA 3NG2A 2OWAA 2RI7A 3KV5A 5AITA 2MUMA 3SHBA 1WEOA 2KWOA 1WFKA 2VNFA 4CCGX 1HYIA 3ZYQA 2KKXA 2E6RA 3PUQA 2XP0A 2EA6A 2CRWA 2HDPA 1X4UA 3M62A 4PTBA 2PUYA 4NN2A 2B0OE 2EXUA 2I50A 3FEHA 3SUBA 2CKLA 2MD7B 2M6MA 3VK6A 2CSZA 3T7LA 3DPLR 3HCTA 2LXPC 1V87A 3N9QA 1JM7A 4WZ2A 5FB0A 2MNZA 3GL6A 3SOUA 2F6NA 2VPEA 3KQIA 3DWDA 3O70A 1Z6UA 5KH7A 1WGMA 3KDEC 2FUUA 4YBTA 2FUIA 4Q6FA 1LDJB 2DX8A 3O33A 2H0DA 5B78A 4R8PK 4LJNA 2CSVA 2Y1NA 2CSYA 4MVTA 1U6GB 4LADB 4W4UA 3O47A 4YAXA 5H1VA 5JG6A 4AVXA 3LRQA 4PPEA 2LRIC 1WEUA 3RPGB 5FEYA 2P57A 2CT2A 2XOCA 3RPGC 2JRJA 3DQVR 4QF3A 3EB6A 4AUQB 1WIMA 2ECIA 5B76A 4S3OB 3LDYA 2L80A 2JMJA 4P5OB 4S3OC 1WILA 5K3QA 3O36A 4O64A 2KU3A 4FJCA 3MHHA 3FJUB 5KH3A 4LKAA 3LVRE 5FERA 3H7HA 2EODA 2YSMA 2M85A 3U5NA 4WZ3B 5LKXA 2VPBA 1WE9A 1Z60A 4YABA 2YSJA 3KNVA 2LV9A 1WEWA 3L1XA 4BHWA 4AYCA 4I7CA 1G25A 4R7EA 2YT5A 4UP0A 5LKZA 5SVYA 1WESA 2JM3A 1WEPA 3ZVZB 4GNDA 3T6RA 2KKYA 3KV6A 2FFWA 3FAOA 2LGLA 4C9ZA 2QJ0A 2CKLB 2DSMA 2ZETC 3ASLA 3FM8C 2FD4A 2KWKA 2YREA 2VJFA 3N9NA 2YHNA 2AN6A 2EGMA 2LGVA 4YADA 3V43A 4N3WA 4OGEA 2YUCA 4F1PA 1K2FA 3LQJA 2LAUA 4L58A 4FO9A 2MT5A 4YATA 4YBMA 2G43A 4A49A 2KGGA 3LQIA 3L1ZB 2H0DB 2CONA 2Y1MA 4IC2A 2L7PA 3LQHA 3FL2A 2LN0A 3U5MA 4QF2A 3M7KA 2YQLA 3HTKC 5H9MA 1VYXA 2IDAA 4WZ0A 1IYMA 2XOZA 3M99A 2YURA 4YC9A 4AP4A 4I7DA 5B8DA 4XI1A 1T1HA 4ZDTA 5B79A 2KREA 2K17A 2C2LA 2M13A 3ZTGA 1LDKC 2G6QA 2NAAA 4V3LC 3MHSA 5D1KB 4YBSA 2M1RA 2VPDA 3GV4A 5J3XA 5C11A 4UI9B 4B86C 2K1JA 4A0CD 1F62A 2YW8A 5B75A 3PLWA 2E61A 5H1UA 2KWNA 2PNXA 3U5PA 5D1MB 4TKPB 1VFYA 1WEMA 4N4FA 5H1TA 4ZQLA 2MA5A 4WA6A 5TDWA 3FANA 3PHDA 3IHPA 4BBQA 1Z2QA 4B7YC 3C6WA 1N87A 1WEVA 3HCSA 2LXHC 3T9KA 2CRRA 3SOWA 2ECVA 2VJFB 5SVIA 3O37A 3N9LA 3O7AA 1X4IA 3LJUX 2YHOA 2OXQC 3O34A 2BAYA 2XEUA 2L43A 1RMDA 4IC3A 2KYUA 2ECNA 1HYJA 2MIQA 2L75A 3ZVYA 2JMIA 2KIZA 3SOXA 4OGCA 3U5OA 1JM7B 5EYAF 1ZBDB 2YQMA 4CA1A 4R2YA 4MSXA 4ZUXU 1DVPA 5TBNA 2VPGA 4UP5A 2HYED 5G0FA 4V3KC 2IQJA 1E4UA 2VJEA 3ZNIA 2D8SA 4H9DA 2DJAA 2ECTA 5I3LA 2F6JA 3RTRB 5LKTA 2MA6A 2YYRA 5LCWB 5B77A 5AIUA 3LVQE 4FIPA 5TABA 2ECJA 2K4DA 2L0BA 4FK5A 3ZPV1 2Y43A 4QQ4A 3QZVA 2E6SA 2FSAA 1X4JA 3O35A 2L5UA 1BORA 1WENA 1JOCA 2YVRA 2RR4A 4GB0A 2RSDA 2C2VS 2XOYA 2QIZA 1MBMA 5FB1A 1FP0A 5C13A 2LGKA 4LLBA 5DKAA 2EGPA 4A4CA 2G45A 2KE1A 3DDTA 3Q1DA
chains in the Genus database with same CATH topology
4LK9A 1CHCA 2KWJA 2ECWA 3HCUA 3N9PA 4X3GA 5TRBA 5TDRA 2JMDA 4L7XA 2M3HA 1VD4A 4GNGA 2LDRA 2XB1A 5G04B 4AYCB 2UZGA 1MM3A 2VP7A 5D1LB 3ZPVE 2ECGA 2LGGA 2YU4A 2K16A 2MD8C 2KFTA 1FBVA 5KH9A 3N9MA 2LQ6A 3L11A 2KGIA 2MNYA 2F42A 2QICA 5DINA 3C5KA 3EB5A 4I7BA 1XWHA 4GNEA 1WEQA 5G05B 3PURA 3N9OA 3M63A 3I2DA 2VJEB 4A4BA 5LKUA 1MM2A 2KR4A 4F52B 4GNFA 1WEEA 3NG2A 2RI7A 3KV5A 5AITA 2MUMA 3SHBA 1WEOA 2KWOA 1WFKA 2VNFA 4CCGX 1HYIA 3ZYQA 2E6RA 3PUQA 2EA6A 2HDPA 1X4UA 3M62A 2PUYA 4PTBA 4NN2A 2I50A 2CKLA 2MD7B 2M6MA 3VK6A 2CSZA 3T7LA 3DPLR 3HCTA 2LXPC 1V87A 3N9QA 1JM7A 4WZ2A 5FB0A 2MNZA 3GL6A 3SOUA 2F6NA 2VPEA 3KQIA 3O70A 1Z6UA 5KH7A 1WGMA 2FUUA 4YBTA 2FUIA 4Q6FA 1LDJB 2DX8A 3O33A 2H0DA 5B78A 4R8PK 4LJNA 2Y1NA 2CSYA 4MVTA 1U6GB 4LADB 4W4UA 4YAXA 5H1VA 5JG6A 4AVXA 3LRQA 4PPEA 2LRIC 1WEUA 3RPGB 5FEYA 2CT2A 3RPGC 2JRJA 3DQVR 4QF3A 3EB6A 4AUQB 1WIMA 2ECIA 5B76A 4S3OB 2L80A 2JMJA 4P5OB 4S3OC 1WILA 3O36A 4O64A 2KU3A 4FJCA 3MHHA 5KH3A 4LKAA 5FERA 2EODA 2YSMA 2M85A 3U5NA 4WZ3B 5LKXA 2VPBA 1WE9A 1Z60A 4YABA 2YSJA 3KNVA 2LV9A 1WEWA 3L1XA 4BHWA 4AYCA 4I7CA 1G25A 4R7EA 2YT5A 4UP0A 5LKZA 1WESA 1WEPA 3ZVZB 4GNDA 3T6RA 3KV6A 2LGLA 4C9ZA 2QJ0A 2CKLB 2ZETC 3ASLA 2KWKA 2YREA 2VJFA 3N9NA 2YHNA 2AN6A 2LGVA 4YADA 3V43A 4N3WA 2YUCA 1K2FA 3LQJA 4L58A 4FO9A 2MT5A 4YATA 4YBMA 2G43A 4A49A 2KGGA 3LQIA 3L1ZB 2H0DB 2Y1MA 4IC2A 3LQHA 3FL2A 2LN0A 3U5MA 4QF2A 2YQLA 3HTKC 5H9MA 1VYXA 2IDAA 4WZ0A 1IYMA 4YC9A 3M99A 2YURA 4AP4A 4I7DA 5B8DA 4XI1A 1T1HA 4ZDTA 5B79A 2KREA 2K17A 2C2LA 3ZTGA 1LDKC 2G6QA 2NAAA 4V3LC 3MHSA 5D1KB 4YBSA 2M1RA 2VPDA 3GV4A 5J3XA 5C11A 4UI9B 4B86C 2K1JA 4A0CD 1F62A 2YW8A 5B75A 5H1UA 2KWNA 2PNXA 3U5PA 5D1MB 4TKPB 1VFYA 4N4FA 5H1TA 4ZQLA 2MA5A 4WA6A 5TDWA 3PHDA 3IHPA 4BBQA 1Z2QA 4B7YC 3C6WA 1N87A 1WEVA 3HCSA 2LXHC 3SOWA 2ECVA 2VJFB 3O37A 3N9LA 3O7AA 1X4IA 2YHOA 2OXQC 3O34A 2BAYA 2XEUA 2L43A 1RMDA 4IC3A 2KYUA 2ECNA 1HYJA 2MIQA 2L75A 3ZVYA 2JMIA 2KIZA 3SOXA 3U5OA 1JM7B 5EYAF 1ZBDB 2YQMA 4CA1A 4R2YA 4MSXA 4ZUXU 1DVPA 5TBNA 2VPGA 4UP5A 2HYED 5G0FA 4V3KC 1E4UA 2VJEA 3ZNIA 2D8SA 2ECTA 5I3LA 2F6JA 3RTRB 5LKTA 2MA6A 2YYRA 5LCWB 5B77A 5AIUA 4FIPA 5TABA 2ECJA 2K4DA 2L0BA 4FK5A 3ZPV1 2Y43A 3QZVA 2E6SA 2FSAA 1X4JA 3O35A 2L5UA 1BORA 1WENA 1JOCA 4GB0A 2RSDA 2C2VS 2QIZA 5FB1A 1FP0A 5C13A 2LGKA 4LLBA 5DKAA 2EGPA 4A4CA 2G45A 2KE1A 1WEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK9 A;  1CHC A;  2KWJ A;  2ECW A;  3HCU A;  3N9P A;  4X3G A;  5TRB A;  5TDR A;  2JMD A;  4L7X A;  2M3H A;  1VD4 A;  4GNG A;  2LDR A;  2XB1 A;  5G04 B;  4AYC B;  2UZG A;  1MM3 A;  2VP7 A;  5D1L B;  3ZPV E;  2ECG A;  2LGG A;  2YU4 A;  2K16 A;  2MD8 C;  2KFT A;  1FBV A;  5KH9 A;  3N9M A;  2LQ6 A;  3L11 A;  2KGI A;  2MNY A;  2F42 A;  2QIC A;  5DIN A;  3C5K A;  3EB5 A;  4I7B A;  1XWH A;  4GNE A;  1WEQ A;  5G05 B;  3PUR A;  3N9O A;  3M63 A;  3I2D A;  2VJE B;  4A4B A;  5LKU A;  1MM2 A;  2KR4 A;  4F52 B;  4GNF A;  1WEE A;  3NG2 A;  2RI7 A;  3KV5 A;  5AIT A;  2MUM A;  3SHB A;  1WEO A;  2KWO A;  1WFK A;  2VNF A;  4CCG X;  1HYI A;  3ZYQ A;  2E6R A;  3PUQ A;  2EA6 A;  2HDP A;  1X4U A;  3M62 A;  2PUY A;  4PTB A;  4NN2 A;  2I50 A;  2CKL A;  2MD7 B;  2M6M A;  3VK6 A;  2CSZ A;  3T7L A;  3DPL R;  3HCT A;  2LXP C;  1V87 A;  3N9Q A;  1JM7 A;  4WZ2 A;  5FB0 A;  2MNZ A;  3GL6 A;  3SOU A;  2F6N A;  2VPE A;  3KQI A;  3O70 A;  1Z6U A;  5KH7 A;  1WGM A;  2FUU A;  4YBT A;  2FUI A;  4Q6F A;  1LDJ B;  2DX8 A;  3O33 A;  2H0D A;  5B78 A;  4R8P K;  4LJN A;  2Y1N A;  2CSY A;  4MVT A;  1U6G B;  4LAD B;  4W4U A;  4YAX A;  5H1V A;  5JG6 A;  4AVX A;  3LRQ A;  4PPE A;  2LRI C;  1WEU A;  3RPG B;  5FEY A;  2CT2 A;  3RPG C;  2JRJ A;  3DQV R;  4QF3 A;  3EB6 A;  4AUQ B;  1WIM A;  2ECI A;  5B76 A;  4S3O B;  2L80 A;  2JMJ A;  4P5O B;  4S3O C;  1WIL A;  3O36 A;  4O64 A;  2KU3 A;  4FJC A;  3MHH A;  5KH3 A;  4LKA A;  5FER A;  2EOD A;  2YSM A;  2M85 A;  3U5N A;  4WZ3 B;  5LKX A;  2VPB A;  1WE9 A;  1Z60 A;  4YAB A;  2YSJ A;  3KNV A;  2LV9 A;  1WEW A;  3L1X A;  4BHW A;  4AYC A;  4I7C A;  1G25 A;  4R7E A;  2YT5 A;  4UP0 A;  5LKZ A;  1WES A;  1WEP A;  3ZVZ B;  4GND A;  3T6R A;  3KV6 A;  2LGL A;  4C9Z A;  2QJ0 A;  2CKL B;  2ZET C;  3ASL A;  2KWK A;  2YRE A;  2VJF A;  3N9N A;  2YHN A;  2AN6 A;  2LGV A;  4YAD A;  3V43 A;  4N3W A;  2YUC A;  1K2F A;  3LQJ A;  4L58 A;  4FO9 A;  2MT5 A;  4YAT A;  4YBM A;  2G43 A;  4A49 A;  2KGG A;  3LQI A;  3L1Z B;  2H0D B;  2Y1M A;  4IC2 A;  3LQH A;  3FL2 A;  2LN0 A;  3U5M A;  4QF2 A;  2YQL A;  3HTK C;  5H9M A;  1VYX A;  2IDA A;  4WZ0 A;  1IYM A;  4YC9 A;  3M99 A;  2YUR A;  4AP4 A;  4I7D A;  5B8D A;  4XI1 A;  1T1H A;  4ZDT A;  5B79 A;  2KRE A;  2K17 A;  2C2L A;  3ZTG A;  1LDK C;  2G6Q A;  2NAA A;  4V3L C;  3MHS A;  5D1K B;  4YBS A;  2M1R A;  2VPD A;  3GV4 A;  5J3X A;  5C11 A;  4UI9 B;  4B86 C;  2K1J A;  4A0C D;  1F62 A;  2YW8 A;  5B75 A;  5H1U A;  2KWN A;  2PNX A;  3U5P A;  5D1M B;  4TKP B;  1VFY A;  4N4F A;  5H1T A;  4ZQL A;  2MA5 A;  4WA6 A;  5TDW A;  3PHD A;  3IHP A;  4BBQ A;  1Z2Q A;  4B7Y C;  3C6W A;  1N87 A;  1WEV A;  3HCS A;  2LXH C;  3SOW A;  2ECV A;  2VJF B;  3O37 A;  3N9L A;  3O7A A;  1X4I A;  2YHO A;  2OXQ C;  3O34 A;  2BAY A;  2XEU A;  2L43 A;  1RMD A;  4IC3 A;  2KYU A;  2ECN A;  1HYJ A;  2MIQ A;  2L75 A;  3ZVY A;  2JMI A;  2KIZ A;  3SOX A;  3U5O A;  1JM7 B;  5EYA F;  1ZBD B;  2YQM A;  4CA1 A;  4R2Y A;  4MSX A;  4ZUX U;  1DVP A;  5TBN A;  2VPG A;  4UP5 A;  2HYE D;  5G0F A;  4V3K C;  1E4U A;  2VJE A;  3ZNI A;  2D8S A;  2ECT A;  5I3L A;  2F6J A;  3RTR B;  5LKT A;  2MA6 A;  2YYR A;  5LCW B;  5B77 A;  5AIU A;  4FIP A;  5TAB A;  2ECJ A;  2K4D A;  2L0B A;  4FK5 A;  3ZPV 1;  2Y43 A;  3QZV A;  2E6S A;  2FSA A;  1X4J A;  3O35 A;  2L5U A;  1BOR A;  1WEN A;  1JOC A;  4GB0 A;  2RSD A;  2C2V S;  2QIZ A;  5FB1 A;  1FP0 A;  5C13 A;  2LGK A;  4LLB A;  5DKA A;  2EGP A;  4A4C A;  2G45 A;  2KE1 A;  1WEM A; 
#chains in the Genus database with same CATH topology
 4LK9 A;  5SVX A;  1CHC A;  4Z0O A;  2KWJ A;  2ECW A;  3HCU A;  3N9P A;  4X3G A;  5TRB A;  5TDR A;  4Z0R A;  2JMD A;  4L7X A;  2M3H A;  1VD4 A;  4GNG A;  2LDR A;  2XB1 A;  5G04 B;  4AYC B;  2JUN A;  2UZG A;  5SVI B;  1MM3 A;  2VP7 A;  5D1L B;  3ZPV E;  2ECG A;  2LGG A;  3JUE A;  2YU4 A;  2K16 A;  4O62 A;  2MKE A;  2MD8 C;  2KFT A;  1FBV A;  5KH9 A;  3N9M A;  1DCQ A;  3MDB C;  2LQ6 A;  3L11 A;  2KGI A;  2MNY A;  2F42 A;  2QIC A;  5DIN A;  3C5K A;  3EB5 A;  4I7B A;  1XWH A;  3E2D A;  4GNE A;  1WEQ A;  5G05 B;  3PUR A;  3N9O A;  3M63 A;  3I2D A;  2VJE B;  4A4B A;  2D8U A;  5LKU A;  1MM2 A;  2KR4 A;  4F52 B;  4GNF A;  1WEE A;  3NG2 A;  2OWA A;  2RI7 A;  3KV5 A;  5AIT A;  2MUM A;  3SHB A;  1WEO A;  2KWO A;  1WFK A;  2VNF A;  4CCG X;  1HYI A;  3ZYQ A;  2KKX A;  2E6R A;  3PUQ A;  2XP0 A;  2EA6 A;  2CRW A;  2HDP A;  1X4U A;  3M62 A;  4PTB A;  2PUY A;  4NN2 A;  2B0O E;  2EXU A;  2I50 A;  3FEH A;  3SUB A;  2CKL A;  2MD7 B;  2M6M A;  3VK6 A;  2CSZ A;  3T7L A;  3DPL R;  3HCT A;  2LXP C;  1V87 A;  3N9Q A;  1JM7 A;  4WZ2 A;  5FB0 A;  2MNZ A;  3GL6 A;  3SOU A;  2F6N A;  2VPE A;  3KQI A;  3DWD A;  3O70 A;  1Z6U A;  5KH7 A;  1WGM A;  3KDE C;  2FUU A;  4YBT A;  2FUI A;  4Q6F A;  1LDJ B;  2DX8 A;  3O33 A;  2H0D A;  5B78 A;  4R8P K;  4LJN A;  2CSV A;  2Y1N A;  2CSY A;  4MVT A;  1U6G B;  4LAD B;  4W4U A;  3O47 A;  4YAX A;  5H1V A;  5JG6 A;  4AVX A;  3LRQ A;  4PPE A;  2LRI C;  1WEU A;  3RPG B;  5FEY A;  2P57 A;  2CT2 A;  2XOC A;  3RPG C;  2JRJ A;  3DQV R;  4QF3 A;  3EB6 A;  4AUQ B;  1WIM A;  2ECI A;  5B76 A;  4S3O B;  3LDY A;  2L80 A;  2JMJ A;  4P5O B;  4S3O C;  1WIL A;  5K3Q A;  3O36 A;  4O64 A;  2KU3 A;  4FJC A;  3MHH A;  3FJU B;  5KH3 A;  4LKA A;  3LVR E;  5FER A;  3H7H A;  2EOD A;  2YSM A;  2M85 A;  3U5N A;  4WZ3 B;  5LKX A;  2VPB A;  1WE9 A;  1Z60 A;  4YAB A;  2YSJ A;  3KNV A;  2LV9 A;  1WEW A;  3L1X A;  4BHW A;  4AYC A;  4I7C A;  1G25 A;  4R7E A;  2YT5 A;  4UP0 A;  5LKZ A;  5SVY A;  1WES A;  2JM3 A;  1WEP A;  3ZVZ B;  4GND A;  3T6R A;  2KKY A;  3KV6 A;  2FFW A;  3FAO A;  2LGL A;  4C9Z A;  2QJ0 A;  2CKL B;  2DSM A;  2ZET C;  3ASL A;  3FM8 C;  2FD4 A;  2KWK A;  2YRE A;  2VJF A;  3N9N A;  2YHN A;  2AN6 A;  2EGM A;  2LGV A;  4YAD A;  3V43 A;  4N3W A;  4OGE A;  2YUC A;  4F1P A;  1K2F A;  3LQJ A;  2LAU A;  4L58 A;  4FO9 A;  2MT5 A;  4YAT A;  4YBM A;  2G43 A;  4A49 A;  2KGG A;  3LQI A;  3L1Z B;  2H0D B;  2CON A;  2Y1M A;  4IC2 A;  2L7P A;  3LQH A;  3FL2 A;  2LN0 A;  3U5M A;  4QF2 A;  3M7K A;  2YQL A;  3HTK C;  5H9M A;  1VYX A;  2IDA A;  4WZ0 A;  1IYM A;  2XOZ A;  3M99 A;  2YUR A;  4YC9 A;  4AP4 A;  4I7D A;  5B8D A;  4XI1 A;  1T1H A;  4ZDT A;  5B79 A;  2KRE A;  2K17 A;  2C2L A;  2M13 A;  3ZTG A;  1LDK C;  2G6Q A;  2NAA A;  4V3L C;  3MHS A;  5D1K B;  4YBS A;  2M1R A;  2VPD A;  3GV4 A;  5J3X A;  5C11 A;  4UI9 B;  4B86 C;  2K1J A;  4A0C D;  1F62 A;  2YW8 A;  5B75 A;  3PLW A;  2E61 A;  5H1U A;  2KWN A;  2PNX A;  3U5P A;  5D1M B;  4TKP B;  1VFY A;  1WEM A;  4N4F A;  5H1T A;  4ZQL A;  2MA5 A;  4WA6 A;  5TDW A;  3FAN A;  3PHD A;  3IHP A;  4BBQ A;  1Z2Q A;  4B7Y C;  3C6W A;  1N87 A;  1WEV A;  3HCS A;  2LXH C;  3T9K A;  2CRR A;  3SOW A;  2ECV A;  2VJF B;  5SVI A;  3O37 A;  3N9L A;  3O7A A;  1X4I A;  3LJU X;  2YHO A;  2OXQ C;  3O34 A;  2BAY A;  2XEU A;  2L43 A;  1RMD A;  4IC3 A;  2KYU A;  2ECN A;  1HYJ A;  2MIQ A;  2L75 A;  3ZVY A;  2JMI A;  2KIZ A;  3SOX A;  4OGC A;  3U5O A;  1JM7 B;  5EYA F;  1ZBD B;  2YQM A;  4CA1 A;  4R2Y A;  4MSX A;  4ZUX U;  1DVP A;  5TBN A;  2VPG A;  4UP5 A;  2HYE D;  5G0F A;  4V3K C;  2IQJ A;  1E4U A;  2VJE A;  3ZNI A;  2D8S A;  4H9D A;  2DJA A;  2ECT A;  5I3L A;  2F6J A;  3RTR B;  5LKT A;  2MA6 A;  2YYR A;  5LCW B;  5B77 A;  5AIU A;  3LVQ E;  4FIP A;  5TAB A;  2ECJ A;  2K4D A;  2L0B A;  4FK5 A;  3ZPV 1;  2Y43 A;  4QQ4 A;  3QZV A;  2E6S A;  2FSA A;  1X4J A;  3O35 A;  2L5U A;  1BOR A;  1WEN A;  1JOC A;  2YVR A;  2RR4 A;  4GB0 A;  2RSD A;  2C2V S;  2XOY A;  2QIZ A;  1MBM A;  5FB1 A;  1FP0 A;  5C13 A;  2LGK A;  4LLB A;  5DKA A;  2EGP A;  4A4C A;  2G45 A;  2KE1 A;  3DDT A;  3Q1D A; 
#chains in the Genus database with same CATH homology
 4LK9 A;  1CHC A;  2KWJ A;  2ECW A;  3HCU A;  3N9P A;  4X3G A;  5TRB A;  5TDR A;  2JMD A;  4L7X A;  2M3H A;  1VD4 A;  4GNG A;  2LDR A;  2XB1 A;  5G04 B;  4AYC B;  2UZG A;  1MM3 A;  2VP7 A;  5D1L B;  3ZPV E;  2ECG A;  2LGG A;  2YU4 A;  2K16 A;  2MD8 C;  2KFT A;  1FBV A;  5KH9 A;  3N9M A;  2LQ6 A;  3L11 A;  2KGI A;  2MNY A;  2F42 A;  2QIC A;  5DIN A;  3C5K A;  3EB5 A;  4I7B A;  1XWH A;  4GNE A;  1WEQ A;  5G05 B;  3PUR A;  3N9O A;  3M63 A;  3I2D A;  2VJE B;  4A4B A;  5LKU A;  1MM2 A;  2KR4 A;  4F52 B;  4GNF A;  1WEE A;  3NG2 A;  2RI7 A;  3KV5 A;  5AIT A;  2MUM A;  3SHB A;  1WEO A;  2KWO A;  1WFK A;  2VNF A;  4CCG X;  1HYI A;  3ZYQ A;  2E6R A;  3PUQ A;  2EA6 A;  2HDP A;  1X4U A;  3M62 A;  2PUY A;  4PTB A;  4NN2 A;  2I50 A;  2CKL A;  2MD7 B;  2M6M A;  3VK6 A;  2CSZ A;  3T7L A;  3DPL R;  3HCT A;  2LXP C;  1V87 A;  3N9Q A;  1JM7 A;  4WZ2 A;  5FB0 A;  2MNZ A;  3GL6 A;  3SOU A;  2F6N A;  2VPE A;  3KQI A;  3O70 A;  1Z6U A;  5KH7 A;  1WGM A;  2FUU A;  4YBT A;  2FUI A;  4Q6F A;  1LDJ B;  2DX8 A;  3O33 A;  2H0D A;  5B78 A;  4R8P K;  4LJN A;  2Y1N A;  2CSY A;  4MVT A;  1U6G B;  4LAD B;  4W4U A;  4YAX A;  5H1V A;  5JG6 A;  4AVX A;  3LRQ A;  4PPE A;  2LRI C;  1WEU A;  3RPG B;  5FEY A;  2CT2 A;  3RPG C;  2JRJ A;  3DQV R;  4QF3 A;  3EB6 A;  4AUQ B;  1WIM A;  2ECI A;  5B76 A;  4S3O B;  2L80 A;  2JMJ A;  4P5O B;  4S3O C;  1WIL A;  3O36 A;  4O64 A;  2KU3 A;  4FJC A;  3MHH A;  5KH3 A;  4LKA A;  5FER A;  2EOD A;  2YSM A;  2M85 A;  3U5N A;  4WZ3 B;  5LKX A;  2VPB A;  1WE9 A;  1Z60 A;  4YAB A;  2YSJ A;  3KNV A;  2LV9 A;  1WEW A;  3L1X A;  4BHW A;  4AYC A;  4I7C A;  1G25 A;  4R7E A;  2YT5 A;  4UP0 A;  5LKZ A;  1WES A;  1WEP A;  3ZVZ B;  4GND A;  3T6R A;  3KV6 A;  2LGL A;  4C9Z A;  2QJ0 A;  2CKL B;  2ZET C;  3ASL A;  2KWK A;  2YRE A;  2VJF A;  3N9N A;  2YHN A;  2AN6 A;  2LGV A;  4YAD A;  3V43 A;  4N3W A;  2YUC A;  1K2F A;  3LQJ A;  4L58 A;  4FO9 A;  2MT5 A;  4YAT A;  4YBM A;  2G43 A;  4A49 A;  2KGG A;  3LQI A;  3L1Z B;  2H0D B;  2Y1M A;  4IC2 A;  3LQH A;  3FL2 A;  2LN0 A;  3U5M A;  4QF2 A;  2YQL A;  3HTK C;  5H9M A;  1VYX A;  2IDA A;  4WZ0 A;  1IYM A;  4YC9 A;  3M99 A;  2YUR A;  4AP4 A;  4I7D A;  5B8D A;  4XI1 A;  1T1H A;  4ZDT A;  5B79 A;  2KRE A;  2K17 A;  2C2L A;  3ZTG A;  1LDK C;  2G6Q A;  2NAA A;  4V3L C;  3MHS A;  5D1K B;  4YBS A;  2M1R A;  2VPD A;  3GV4 A;  5J3X A;  5C11 A;  4UI9 B;  4B86 C;  2K1J A;  4A0C D;  1F62 A;  2YW8 A;  5B75 A;  5H1U A;  2KWN A;  2PNX A;  3U5P A;  5D1M B;  4TKP B;  1VFY A;  4N4F A;  5H1T A;  4ZQL A;  2MA5 A;  4WA6 A;  5TDW A;  3PHD A;  3IHP A;  4BBQ A;  1Z2Q A;  4B7Y C;  3C6W A;  1N87 A;  1WEV A;  3HCS A;  2LXH C;  3SOW A;  2ECV A;  2VJF B;  3O37 A;  3N9L A;  3O7A A;  1X4I A;  2YHO A;  2OXQ C;  3O34 A;  2BAY A;  2XEU A;  2L43 A;  1RMD A;  4IC3 A;  2KYU A;  2ECN A;  1HYJ A;  2MIQ A;  2L75 A;  3ZVY A;  2JMI A;  2KIZ A;  3SOX A;  3U5O A;  1JM7 B;  5EYA F;  1ZBD B;  2YQM A;  4CA1 A;  4R2Y A;  4MSX A;  4ZUX U;  1DVP A;  5TBN A;  2VPG A;  4UP5 A;  2HYE D;  5G0F A;  4V3K C;  1E4U A;  2VJE A;  3ZNI A;  2D8S A;  2ECT A;  5I3L A;  2F6J A;  3RTR B;  5LKT A;  2MA6 A;  2YYR A;  5LCW B;  5B77 A;  5AIU A;  4FIP A;  5TAB A;  2ECJ A;  2K4D A;  2L0B A;  4FK5 A;  3ZPV 1;  2Y43 A;  3QZV A;  2E6S A;  2FSA A;  1X4J A;  3O35 A;  2L5U A;  1BOR A;  1WEN A;  1JOC A;  4GB0 A;  2RSD A;  2C2V S;  2QIZ A;  5FB1 A;  1FP0 A;  5C13 A;  2LGK A;  4LLB A;  5DKA A;  2EGP A;  4A4C A;  2G45 A;  2KE1 A;  1WEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...