4L7XA

Crystal structure of the dido phd finger in complex with h3k4me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dido3 PHD Modulates Cell Differentiation and Division.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, gene regulation
molecule keywords Death-inducer obliterator 1
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l7xA00
3HCSA 4QF2A 2IDAA 1DVPA 5G05B 5TDWA 1WEQA 2L0BA 4FO9A 5LKUA 4FK5A 2M3HA 1WILA 4YATA 5FEYA 2KYUA 2LQ6A 1N87A 5KH7A 3V43A 2F6JA 2KR4A 3DPLR 1FP0A 3HCUA 4LJNA 3I2DA 5H1TA 4WA6A 2YUCA 3N9MA 3O33A 1WESA 1WEUA 1MM2A 3ZPVE 1Z2QA 1Z60A 2AN6A 5FB1A 4YC9A 5B79A 2D8SA 4YABA 2K16A 2VPEA 2XB1A 3N9PA 2VPBA 4R7EA 2L43A 5DINA 2RSDA 3O35A 2DX8A 2JMJA 4WZ3B 5B8DA 3U5NA 3M99A 2M85A 5G04B 3O37A 2EODA 2YHNA 3NG2A 3EB6A 4S3OB 1JM7B 4GB0A 3LQIA 3GL6A 4AUQB 5G0FA 4AYCA 3U5PA 2YURA 4IC2A 4ZDTA 3RPGB 5FERA 3N9NA 3RPGC 3ZNIA 2CSYA 2I50A 3GV4A 1VFYA 4WZ2A 1X4IA 3ASLA 1BORA 1K2FA 5D1MB 1WEVA 2RI7A 4XI1A 3SHBA 2LRIC 3KV6A 1WIMA 2L5UA 3O34A 2ECWA 2UZGA 2K17A 4BHWA 4R8PK 4YADA 2KREA 4YAXA 3L1XA 2KWJA 4YBTA 4LK9A 4YBMA 1HYJA 1G25A 2FSAA 2NAAA 3N9LA 2KU3A 2LV9A 4X3GA 4MSXA 2C2VS 2PNXA 3QZVA 2FUIA 2YQMA 3LQHA 4O64A 4W4UA 5D1LB 2ECJA 4GNEA 3U5MA 2Y1NA 3PUQA 4P5OB 4A0CD 2VPGA 2MNZA 4AVXA 2ECTA 1JM7A 1RMDA 5B75A 1IYMA 1WEOA 1WEMA 3RTRB 3O7AA 4PPEA 3MHHA 2VJFB 5H9MA 1WE9A 4GNDA 1WEPA 3L1ZB 2M6MA 2M1RA 2BAYA 2LXPC 3KQIA 3SOWA 1VD4A 4BBQA 2KGGA 1WFKA 4LADB 5H1UA 1CHCA 5FB0A 3LQJA 2LN0A 1WENA 2JMDA 2VP7A 2CKLA 1X4JA 5LCWB 4AP4A 5B76A 1FBVA 5TBNA 2ZETC 1VYXA 2YQLA 1U6GB 4PTBA 1F62A 2VJEA 4IC3A 3M63A 2E6RA 1WEEA 4V3LC 5DKAA 1X4UA 5C13A 5J3XA 2MD7B 1LDKC 4Q6FA 2MIQA 2H0DA 5TDRA 5AIUA 1E4UA 4B86C 2YSMA 3U5OA 1MM3A 2QJ0A 2VNFA 4V3KC 2YSJA 4MVTA 2ECVA 2G43A 2OXQC 2E6SA 1V87A 1WGMA 2LGGA 4L7XA 5LKTA 2F6NA 2YT5A 2K4DA 2CT2A 4QF3A 2KE1A 4FIPA 4UP5A 5LKXA 2EGPA 3KNVA 5LKZA 2XEUA 3ZVYA 1LDJB 2CKLB 2L75A 5H1VA 3FL2A 2QIZA 2ECGA 2F42A 3C5KA 4F52B 4TKPB 2MNYA 4R2YA 5B77A 3SOUA 2H0DB 3IHPA 2CSZA 2EA6A 3C6WA 2HYED 4WZ0A 2G6QA 3N9QA 1JOCA 5EYAF 4B7YC 5C11A 2LXHC 3PHDA 3SOXA 4AYCB 3DQVR 4A49A 2L80A 2VPDA 2FUUA 2QICA 3VK6A 2YREA 1Z6UA 2VJEB 2C2LA 2LGKA 3M62A 2MT5A 2Y43A 5KH9A 4GNGA 5JG6A 2YW8A 4A4CA 4N3WA 2K1JA 3ZYQA 1XWHA 2LGVA 4UI9B 4L58A 3O70A 4ZUXU 3MHSA 1ZBDB 4C9ZA 2KWOA 2HDPA 4I7BA 3ZVZB 2JMIA 3ZPV1 3HCTA 3HTKC 2MA5A 2MA6A 2LGLA 4FJCA 3T6RA 3KV5A 5B78A 1WEWA 5AITA 4CCGX 2KWNA 5D1KB 2YHOA 2MD8C 3EB5A 2G45A 5KH3A 4YBSA 2JRJA 4I7CA 2ECIA 4A4BA 4LLBA 3PURA 2LDRA 2YU4A 3ZTGA 4ZQLA 4GNFA 3O36A 4I7DA 3LRQA 1T1HA 5I3LA 2ECNA 2Y1MA 4N4FA 4UP0A 2KWKA 5TRBA 4LKAA 1HYIA 3T7LA 2KFTA 5TABA 2MUMA 3N9OA 3L11A 2KIZA 2PUYA 2VJFA 4NN2A 2YYRA 4S3OC 2KGIA 4CA1A
chains in the Genus database with same CATH superfamily
3HCSA 4QF2A 3DDTA 2IDAA 1DVPA 5G05B 5TDWA 1WEQA 3LDYA 2L0BA 4FO9A 5LKUA 4FK5A 2M3HA 1WILA 4YATA 5FEYA 2KYUA 2LQ6A 1N87A 3T9KA 5KH7A 3DWDA 2CRRA 3V43A 2F6JA 2KR4A 3DPLR 1FP0A 3HCUA 4LJNA 3I2DA 5H1TA 4WA6A 2YUCA 3N9MA 3O33A 1WESA 1WEUA 2LAUA 1MM2A 3ZPVE 4Z0OA 2DJAA 1Z2QA 1Z60A 2AN6A 5FB1A 4YC9A 5B79A 4QQ4A 2D8SA 4YABA 3H7HA 3FEHA 2K16A 2L7PA 2VPEA 2XB1A 3LVQE 3N9PA 2VPBA 4R7EA 2L43A 5K3QA 5DINA 2RSDA 3O35A 2DX8A 2JMJA 4WZ3B 5B8DA 3U5NA 3FM8C 3M99A 2XOCA 2M85A 5G04B 3O37A 2EODA 2YHNA 3NG2A 3EB6A 4S3OB 1DCQA 1JM7B 4GB0A 3LQIA 3GL6A 4AUQB 5G0FA 4H9DA 4AYCA 3U5PA 2YURA 4IC2A 4ZDTA 3RPGB 5FERA 3N9NA 3RPGC 3ZNIA 2CSYA 2I50A 3GV4A 1VFYA 4WZ2A 1X4IA 3ASLA 1BORA 1K2FA 2EXUA 5D1MB 1WEVA 2RI7A 4XI1A 3SHBA 2LRIC 3KV6A 1WIMA 2L5UA 3O34A 2ECWA 2UZGA 2K17A 4BHWA 4R8PK 4YADA 2KREA 4YAXA 4O62A 3L1XA 2KWJA 4YBTA 4LK9A 4YBMA 1HYJA 2CSVA 2FSAA 2NAAA 1G25A 3N9LA 2XOZA 2KU3A 2LV9A 4X3GA 4MSXA 2B0OE 2C2VS 2PNXA 3QZVA 2FUIA 2YQMA 3LQHA 4O64A 4W4UA 5D1LB 2ECJA 4GNEA 2EGMA 3U5MA 2Y1NA 3PUQA 4P5OB 4A0CD 2VPGA 5SVIB 2MNZA 4AVXA 2ECTA 1JM7A 1RMDA 5B75A 3O47A 1WEOA 3LVRE 1IYMA 1WEMA 3RTRB 2E61A 3O7AA 4PPEA 3MHHA 2VJFB 5H9MA 2KKXA 1WE9A 4GNDA 1WEPA 3L1ZB 2M6MA 2M1RA 2BAYA 2LXPC 3KQIA 3SOWA 1VD4A 4BBQA 2KGGA 1WFKA 2P57A 4LADB 5H1UA 1CHCA 5FB0A 3LQJA 2LN0A 2OWAA 1WENA 2JMDA 2VP7A 2XP0A 2CKLA 1X4JA 5LCWB 4AP4A 5B76A 1FBVA 3JUEA 5TBNA 2ZETC 2XOYA 1VYXA 2YQLA 1U6GB 4PTBA 1F62A 2VJEA 4IC3A 3Q1DA 3M63A 2E6RA 1WEEA 4V3LC 5DKAA 1X4UA 5C13A 5J3XA 3M7KA 2MD7B 1LDKC 4Q6FA 3KDEC 2M13A 2MIQA 2H0DA 5TDRA 2JUNA 5AIUA 1E4UA 4B86C 2YSMA 3U5OA 1MM3A 2QJ0A 2VNFA 4V3KC 2YSJA 4MVTA 2ECVA 2G43A 2OXQC 2E6SA 1V87A 1WGMA 2LGGA 4L7XA 5LKTA 3FAOA 2F6NA 2YT5A 2K4DA 2CT2A 2YVRA 5SVXA 5SVIA 4QF3A 2KE1A 4FIPA 4UP5A 5LKXA 2EGPA 3KNVA 5LKZA 2XEUA 3ZVYA 1LDJB 2CKLB 2L75A 5H1VA 3FL2A 2QIZA 3SUBA 2ECGA 2F42A 2FFWA 3C5KA 4F52B 4TKPB 2MNYA 4R2YA 5B77A 3SOUA 2H0DB 2DSMA 3FJUB 2CSZA 2EA6A 3IHPA 3C6WA 2HYED 4WZ0A 2JM3A 2G6QA 3N9QA 1JOCA 5EYAF 4B7YC 5C11A 2LXHC 3PHDA 1MBMA 3SOXA 2CONA 4AYCB 3DQVR 4A49A 2L80A 2VPDA 3LJUX 2FUUA 2QICA 3VK6A 2YREA 1Z6UA 2VJEB 2C2LA 2KKYA 2LGKA 3M62A 3E2DA 2MT5A 2Y43A 5KH9A 4GNGA 5JG6A 2YW8A 4A4CA 4N3WA 2K1JA 4OGEA 3ZYQA 1XWHA 2MKEA 2LGVA 4UI9B 4L58A 3O70A 4ZUXU 3MHSA 1ZBDB 4C9ZA 2KWOA 2HDPA 4I7BA 3ZVZB 2JMIA 3ZPV1 3HCTA 3HTKC 2MA5A 2MA6A 2LGLA 4FJCA 3T6RA 3KV5A 5B78A 1WEWA 5AITA 4CCGX 2D8UA 2KWNA 5D1KB 2YHOA 2MD8C 3EB5A 2G45A 5KH3A 4YBSA 2JRJA 4I7CA 2ECIA 4A4BA 4LLBA 3PURA 2LDRA 2YU4A 3ZTGA 4ZQLA 4GNFA 2CRWA 2RR4A 3O36A 4I7DA 3LRQA 2FD4A 4OGCA 3PLWA 1T1HA 5I3LA 5SVYA 2ECNA 3MDBC 2Y1MA 4N4FA 3FANA 4UP0A 2KWKA 5TRBA 4LKAA 1HYIA 3T7LA 2KFTA 4Z0RA 5TABA 4F1PA 2MUMA 3N9OA 3L11A 2KIZA 2PUYA 2VJFA 4NN2A 2YYRA 4S3OC 2KGIA 4CA1A 2IQJA
chains in the Genus database with same CATH topology
3HCSA 4QF2A 2IDAA 1DVPA 5G05B 5TDWA 1WEQA 2L0BA 4FO9A 5LKUA 4FK5A 2M3HA 1WILA 4YATA 5FEYA 2KYUA 2LQ6A 1N87A 5KH7A 3V43A 2F6JA 2KR4A 3DPLR 1FP0A 3HCUA 4LJNA 3I2DA 5H1TA 4WA6A 2YUCA 3N9MA 3O33A 1WESA 1WEUA 1MM2A 3ZPVE 1Z2QA 1Z60A 2AN6A 5FB1A 4YC9A 5B79A 2D8SA 4YABA 2K16A 2VPEA 2XB1A 3N9PA 2VPBA 4R7EA 2L43A 5DINA 2RSDA 3O35A 2DX8A 2JMJA 4WZ3B 5B8DA 3U5NA 3M99A 2M85A 5G04B 3O37A 2EODA 2YHNA 3NG2A 3EB6A 4S3OB 1JM7B 4GB0A 3LQIA 3GL6A 4AUQB 5G0FA 4AYCA 3U5PA 2YURA 4IC2A 4ZDTA 3RPGB 5FERA 3N9NA 3RPGC 3ZNIA 2CSYA 2I50A 3GV4A 1VFYA 4WZ2A 1X4IA 3ASLA 1BORA 1K2FA 5D1MB 1WEVA 2RI7A 4XI1A 3SHBA 2LRIC 3KV6A 1WIMA 2L5UA 3O34A 2ECWA 2UZGA 2K17A 4BHWA 4R8PK 4YADA 2KREA 4YAXA 3L1XA 2KWJA 4YBTA 4LK9A 4YBMA 1HYJA 1G25A 2FSAA 2NAAA 3N9LA 2KU3A 2LV9A 4X3GA 4MSXA 2C2VS 2PNXA 3QZVA 2FUIA 2YQMA 3LQHA 4O64A 4W4UA 5D1LB 2ECJA 4GNEA 3U5MA 2Y1NA 3PUQA 4P5OB 4A0CD 2VPGA 2MNZA 4AVXA 2ECTA 1JM7A 1RMDA 5B75A 1IYMA 1WEOA 1WEMA 3RTRB 3O7AA 4PPEA 3MHHA 2VJFB 5H9MA 1WE9A 4GNDA 1WEPA 3L1ZB 2M6MA 2M1RA 2BAYA 2LXPC 3KQIA 3SOWA 1VD4A 4BBQA 2KGGA 1WFKA 4LADB 5H1UA 1CHCA 5FB0A 3LQJA 2LN0A 1WENA 2JMDA 2VP7A 2CKLA 1X4JA 5LCWB 4AP4A 5B76A 1FBVA 5TBNA 2ZETC 1VYXA 2YQLA 1U6GB 4PTBA 1F62A 2VJEA 4IC3A 3M63A 2E6RA 1WEEA 4V3LC 5DKAA 1X4UA 5C13A 5J3XA 2MD7B 1LDKC 4Q6FA 2MIQA 2H0DA 5TDRA 5AIUA 1E4UA 4B86C 2YSMA 3U5OA 1MM3A 2QJ0A 2VNFA 4V3KC 2YSJA 4MVTA 2ECVA 2G43A 2OXQC 2E6SA 1V87A 1WGMA 2LGGA 4L7XA 5LKTA 2F6NA 2YT5A 2K4DA 2CT2A 4QF3A 2KE1A 4FIPA 4UP5A 5LKXA 2EGPA 3KNVA 5LKZA 2XEUA 3ZVYA 1LDJB 2CKLB 2L75A 5H1VA 3FL2A 2QIZA 2ECGA 2F42A 3C5KA 4F52B 4TKPB 2MNYA 4R2YA 5B77A 3SOUA 2H0DB 3IHPA 2CSZA 2EA6A 3C6WA 2HYED 4WZ0A 2G6QA 3N9QA 1JOCA 5EYAF 4B7YC 5C11A 2LXHC 3PHDA 3SOXA 4AYCB 3DQVR 4A49A 2L80A 2VPDA 2FUUA 2QICA 3VK6A 2YREA 1Z6UA 2VJEB 2C2LA 2LGKA 3M62A 2MT5A 2Y43A 5KH9A 4GNGA 5JG6A 2YW8A 4A4CA 4N3WA 2K1JA 3ZYQA 1XWHA 2LGVA 4UI9B 4L58A 3O70A 4ZUXU 3MHSA 1ZBDB 4C9ZA 2KWOA 2HDPA 4I7BA 3ZVZB 2JMIA 3ZPV1 3HCTA 3HTKC 2MA5A 2MA6A 2LGLA 4FJCA 3T6RA 3KV5A 5B78A 1WEWA 5AITA 4CCGX 2KWNA 5D1KB 2YHOA 2MD8C 3EB5A 2G45A 5KH3A 4YBSA 2JRJA 4I7CA 2ECIA 4A4BA 4LLBA 3PURA 2LDRA 2YU4A 3ZTGA 4ZQLA 4GNFA 3O36A 4I7DA 3LRQA 1T1HA 5I3LA 2ECNA 2Y1MA 4N4FA 4UP0A 2KWKA 5TRBA 4LKAA 1HYIA 3T7LA 2KFTA 5TABA 2MUMA 3N9OA 3L11A 2KIZA 2PUYA 2VJFA 4NN2A 2YYRA 4S3OC 2KGIA 4CA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCS A;  4QF2 A;  2IDA A;  1DVP A;  5G05 B;  5TDW A;  1WEQ A;  2L0B A;  4FO9 A;  5LKU A;  4FK5 A;  2M3H A;  1WIL A;  4YAT A;  5FEY A;  2KYU A;  2LQ6 A;  1N87 A;  5KH7 A;  3V43 A;  2F6J A;  2KR4 A;  3DPL R;  1FP0 A;  3HCU A;  4LJN A;  3I2D A;  5H1T A;  4WA6 A;  2YUC A;  3N9M A;  3O33 A;  1WES A;  1WEU A;  1MM2 A;  3ZPV E;  1Z2Q A;  1Z60 A;  2AN6 A;  5FB1 A;  4YC9 A;  5B79 A;  2D8S A;  4YAB A;  2K16 A;  2VPE A;  2XB1 A;  3N9P A;  2VPB A;  4R7E A;  2L43 A;  5DIN A;  2RSD A;  3O35 A;  2DX8 A;  2JMJ A;  4WZ3 B;  5B8D A;  3U5N A;  3M99 A;  2M85 A;  5G04 B;  3O37 A;  2EOD A;  2YHN A;  3NG2 A;  3EB6 A;  4S3O B;  1JM7 B;  4GB0 A;  3LQI A;  3GL6 A;  4AUQ B;  5G0F A;  4AYC A;  3U5P A;  2YUR A;  4IC2 A;  4ZDT A;  3RPG B;  5FER A;  3N9N A;  3RPG C;  3ZNI A;  2CSY A;  2I50 A;  3GV4 A;  1VFY A;  4WZ2 A;  1X4I A;  3ASL A;  1BOR A;  1K2F A;  5D1M B;  1WEV A;  2RI7 A;  4XI1 A;  3SHB A;  2LRI C;  3KV6 A;  1WIM A;  2L5U A;  3O34 A;  2ECW A;  2UZG A;  2K17 A;  4BHW A;  4R8P K;  4YAD A;  2KRE A;  4YAX A;  3L1X A;  2KWJ A;  4YBT A;  4LK9 A;  4YBM A;  1HYJ A;  1G25 A;  2FSA A;  2NAA A;  3N9L A;  2KU3 A;  2LV9 A;  4X3G A;  4MSX A;  2C2V S;  2PNX A;  3QZV A;  2FUI A;  2YQM A;  3LQH A;  4O64 A;  4W4U A;  5D1L B;  2ECJ A;  4GNE A;  3U5M A;  2Y1N A;  3PUQ A;  4P5O B;  4A0C D;  2VPG A;  2MNZ A;  4AVX A;  2ECT A;  1JM7 A;  1RMD A;  5B75 A;  1IYM A;  1WEO A;  1WEM A;  3RTR B;  3O7A A;  4PPE A;  3MHH A;  2VJF B;  5H9M A;  1WE9 A;  4GND A;  1WEP A;  3L1Z B;  2M6M A;  2M1R A;  2BAY A;  2LXP C;  3KQI A;  3SOW A;  1VD4 A;  4BBQ A;  2KGG A;  1WFK A;  4LAD B;  5H1U A;  1CHC A;  5FB0 A;  3LQJ A;  2LN0 A;  1WEN A;  2JMD A;  2VP7 A;  2CKL A;  1X4J A;  5LCW B;  4AP4 A;  5B76 A;  1FBV A;  5TBN A;  2ZET C;  1VYX A;  2YQL A;  1U6G B;  4PTB A;  1F62 A;  2VJE A;  4IC3 A;  3M63 A;  2E6R A;  1WEE A;  4V3L C;  5DKA A;  1X4U A;  5C13 A;  5J3X A;  2MD7 B;  1LDK C;  4Q6F A;  2MIQ A;  2H0D A;  5TDR A;  5AIU A;  1E4U A;  4B86 C;  2YSM A;  3U5O A;  1MM3 A;  2QJ0 A;  2VNF A;  4V3K C;  2YSJ A;  4MVT A;  2ECV A;  2G43 A;  2OXQ C;  2E6S A;  1V87 A;  1WGM A;  2LGG A;  4L7X A;  5LKT A;  2F6N A;  2YT5 A;  2K4D A;  2CT2 A;  4QF3 A;  2KE1 A;  4FIP A;  4UP5 A;  5LKX A;  2EGP A;  3KNV A;  5LKZ A;  2XEU A;  3ZVY A;  1LDJ B;  2CKL B;  2L75 A;  5H1V A;  3FL2 A;  2QIZ A;  2ECG A;  2F42 A;  3C5K A;  4F52 B;  4TKP B;  2MNY A;  4R2Y A;  5B77 A;  3SOU A;  2H0D B;  3IHP A;  2CSZ A;  2EA6 A;  3C6W A;  2HYE D;  4WZ0 A;  2G6Q A;  3N9Q A;  1JOC A;  5EYA F;  4B7Y C;  5C11 A;  2LXH C;  3PHD A;  3SOX A;  4AYC B;  3DQV R;  4A49 A;  2L80 A;  2VPD A;  2FUU A;  2QIC A;  3VK6 A;  2YRE A;  1Z6U A;  2VJE B;  2C2L A;  2LGK A;  3M62 A;  2MT5 A;  2Y43 A;  5KH9 A;  4GNG A;  5JG6 A;  2YW8 A;  4A4C A;  4N3W A;  2K1J A;  3ZYQ A;  1XWH A;  2LGV A;  4UI9 B;  4L58 A;  3O70 A;  4ZUX U;  3MHS A;  1ZBD B;  4C9Z A;  2KWO A;  2HDP A;  4I7B A;  3ZVZ B;  2JMI A;  3ZPV 1;  3HCT A;  3HTK C;  2MA5 A;  2MA6 A;  2LGL A;  4FJC A;  3T6R A;  3KV5 A;  5B78 A;  1WEW A;  5AIT A;  4CCG X;  2KWN A;  5D1K B;  2YHO A;  2MD8 C;  3EB5 A;  2G45 A;  5KH3 A;  4YBS A;  2JRJ A;  4I7C A;  2ECI A;  4A4B A;  4LLB A;  3PUR A;  2LDR A;  2YU4 A;  3ZTG A;  4ZQL A;  4GNF A;  3O36 A;  4I7D A;  3LRQ A;  1T1H A;  5I3L A;  2ECN A;  2Y1M A;  4N4F A;  4UP0 A;  2KWK A;  5TRB A;  4LKA A;  1HYI A;  3T7L A;  2KFT A;  5TAB A;  2MUM A;  3N9O A;  3L11 A;  2KIZ A;  2PUY A;  2VJF A;  4NN2 A;  2YYR A;  4S3O C;  2KGI A;  4CA1 A; 
#chains in the Genus database with same CATH topology
 3HCS A;  4QF2 A;  3DDT A;  2IDA A;  1DVP A;  5G05 B;  5TDW A;  1WEQ A;  3LDY A;  2L0B A;  4FO9 A;  5LKU A;  4FK5 A;  2M3H A;  1WIL A;  4YAT A;  5FEY A;  2KYU A;  2LQ6 A;  1N87 A;  3T9K A;  5KH7 A;  3DWD A;  2CRR A;  3V43 A;  2F6J A;  2KR4 A;  3DPL R;  1FP0 A;  3HCU A;  4LJN A;  3I2D A;  5H1T A;  4WA6 A;  2YUC A;  3N9M A;  3O33 A;  1WES A;  1WEU A;  2LAU A;  1MM2 A;  3ZPV E;  4Z0O A;  2DJA A;  1Z2Q A;  1Z60 A;  2AN6 A;  5FB1 A;  4YC9 A;  5B79 A;  4QQ4 A;  2D8S A;  4YAB A;  3H7H A;  3FEH A;  2K16 A;  2L7P A;  2VPE A;  2XB1 A;  3LVQ E;  3N9P A;  2VPB A;  4R7E A;  2L43 A;  5K3Q A;  5DIN A;  2RSD A;  3O35 A;  2DX8 A;  2JMJ A;  4WZ3 B;  5B8D A;  3U5N A;  3FM8 C;  3M99 A;  2XOC A;  2M85 A;  5G04 B;  3O37 A;  2EOD A;  2YHN A;  3NG2 A;  3EB6 A;  4S3O B;  1DCQ A;  1JM7 B;  4GB0 A;  3LQI A;  3GL6 A;  4AUQ B;  5G0F A;  4H9D A;  4AYC A;  3U5P A;  2YUR A;  4IC2 A;  4ZDT A;  3RPG B;  5FER A;  3N9N A;  3RPG C;  3ZNI A;  2CSY A;  2I50 A;  3GV4 A;  1VFY A;  4WZ2 A;  1X4I A;  3ASL A;  1BOR A;  1K2F A;  2EXU A;  5D1M B;  1WEV A;  2RI7 A;  4XI1 A;  3SHB A;  2LRI C;  3KV6 A;  1WIM A;  2L5U A;  3O34 A;  2ECW A;  2UZG A;  2K17 A;  4BHW A;  4R8P K;  4YAD A;  2KRE A;  4YAX A;  4O62 A;  3L1X A;  2KWJ A;  4YBT A;  4LK9 A;  4YBM A;  1HYJ A;  2CSV A;  2FSA A;  2NAA A;  1G25 A;  3N9L A;  2XOZ A;  2KU3 A;  2LV9 A;  4X3G A;  4MSX A;  2B0O E;  2C2V S;  2PNX A;  3QZV A;  2FUI A;  2YQM A;  3LQH A;  4O64 A;  4W4U A;  5D1L B;  2ECJ A;  4GNE A;  2EGM A;  3U5M A;  2Y1N A;  3PUQ A;  4P5O B;  4A0C D;  2VPG A;  5SVI B;  2MNZ A;  4AVX A;  2ECT A;  1JM7 A;  1RMD A;  5B75 A;  3O47 A;  1WEO A;  3LVR E;  1IYM A;  1WEM A;  3RTR B;  2E61 A;  3O7A A;  4PPE A;  3MHH A;  2VJF B;  5H9M A;  2KKX A;  1WE9 A;  4GND A;  1WEP A;  3L1Z B;  2M6M A;  2M1R A;  2BAY A;  2LXP C;  3KQI A;  3SOW A;  1VD4 A;  4BBQ A;  2KGG A;  1WFK A;  2P57 A;  4LAD B;  5H1U A;  1CHC A;  5FB0 A;  3LQJ A;  2LN0 A;  2OWA A;  1WEN A;  2JMD A;  2VP7 A;  2XP0 A;  2CKL A;  1X4J A;  5LCW B;  4AP4 A;  5B76 A;  1FBV A;  3JUE A;  5TBN A;  2ZET C;  2XOY A;  1VYX A;  2YQL A;  1U6G B;  4PTB A;  1F62 A;  2VJE A;  4IC3 A;  3Q1D A;  3M63 A;  2E6R A;  1WEE A;  4V3L C;  5DKA A;  1X4U A;  5C13 A;  5J3X A;  3M7K A;  2MD7 B;  1LDK C;  4Q6F A;  3KDE C;  2M13 A;  2MIQ A;  2H0D A;  5TDR A;  2JUN A;  5AIU A;  1E4U A;  4B86 C;  2YSM A;  3U5O A;  1MM3 A;  2QJ0 A;  2VNF A;  4V3K C;  2YSJ A;  4MVT A;  2ECV A;  2G43 A;  2OXQ C;  2E6S A;  1V87 A;  1WGM A;  2LGG A;  4L7X A;  5LKT A;  3FAO A;  2F6N A;  2YT5 A;  2K4D A;  2CT2 A;  2YVR A;  5SVX A;  5SVI A;  4QF3 A;  2KE1 A;  4FIP A;  4UP5 A;  5LKX A;  2EGP A;  3KNV A;  5LKZ A;  2XEU A;  3ZVY A;  1LDJ B;  2CKL B;  2L75 A;  5H1V A;  3FL2 A;  2QIZ A;  3SUB A;  2ECG A;  2F42 A;  2FFW A;  3C5K A;  4F52 B;  4TKP B;  2MNY A;  4R2Y A;  5B77 A;  3SOU A;  2H0D B;  2DSM A;  3FJU B;  2CSZ A;  2EA6 A;  3IHP A;  3C6W A;  2HYE D;  4WZ0 A;  2JM3 A;  2G6Q A;  3N9Q A;  1JOC A;  5EYA F;  4B7Y C;  5C11 A;  2LXH C;  3PHD A;  1MBM A;  3SOX A;  2CON A;  4AYC B;  3DQV R;  4A49 A;  2L80 A;  2VPD A;  3LJU X;  2FUU A;  2QIC A;  3VK6 A;  2YRE A;  1Z6U A;  2VJE B;  2C2L A;  2KKY A;  2LGK A;  3M62 A;  3E2D A;  2MT5 A;  2Y43 A;  5KH9 A;  4GNG A;  5JG6 A;  2YW8 A;  4A4C A;  4N3W A;  2K1J A;  4OGE A;  3ZYQ A;  1XWH A;  2MKE A;  2LGV A;  4UI9 B;  4L58 A;  3O70 A;  4ZUX U;  3MHS A;  1ZBD B;  4C9Z A;  2KWO A;  2HDP A;  4I7B A;  3ZVZ B;  2JMI A;  3ZPV 1;  3HCT A;  3HTK C;  2MA5 A;  2MA6 A;  2LGL A;  4FJC A;  3T6R A;  3KV5 A;  5B78 A;  1WEW A;  5AIT A;  4CCG X;  2D8U A;  2KWN A;  5D1K B;  2YHO A;  2MD8 C;  3EB5 A;  2G45 A;  5KH3 A;  4YBS A;  2JRJ A;  4I7C A;  2ECI A;  4A4B A;  4LLB A;  3PUR A;  2LDR A;  2YU4 A;  3ZTG A;  4ZQL A;  4GNF A;  2CRW A;  2RR4 A;  3O36 A;  4I7D A;  3LRQ A;  2FD4 A;  4OGC A;  3PLW A;  1T1H A;  5I3L A;  5SVY A;  2ECN A;  3MDB C;  2Y1M A;  4N4F A;  3FAN A;  4UP0 A;  2KWK A;  5TRB A;  4LKA A;  1HYI A;  3T7L A;  2KFT A;  4Z0R A;  5TAB A;  4F1P A;  2MUM A;  3N9O A;  3L11 A;  2KIZ A;  2PUY A;  2VJF A;  4NN2 A;  2YYR A;  4S3O C;  2KGI A;  4CA1 A;  2IQJ A; 
#chains in the Genus database with same CATH homology
 3HCS A;  4QF2 A;  2IDA A;  1DVP A;  5G05 B;  5TDW A;  1WEQ A;  2L0B A;  4FO9 A;  5LKU A;  4FK5 A;  2M3H A;  1WIL A;  4YAT A;  5FEY A;  2KYU A;  2LQ6 A;  1N87 A;  5KH7 A;  3V43 A;  2F6J A;  2KR4 A;  3DPL R;  1FP0 A;  3HCU A;  4LJN A;  3I2D A;  5H1T A;  4WA6 A;  2YUC A;  3N9M A;  3O33 A;  1WES A;  1WEU A;  1MM2 A;  3ZPV E;  1Z2Q A;  1Z60 A;  2AN6 A;  5FB1 A;  4YC9 A;  5B79 A;  2D8S A;  4YAB A;  2K16 A;  2VPE A;  2XB1 A;  3N9P A;  2VPB A;  4R7E A;  2L43 A;  5DIN A;  2RSD A;  3O35 A;  2DX8 A;  2JMJ A;  4WZ3 B;  5B8D A;  3U5N A;  3M99 A;  2M85 A;  5G04 B;  3O37 A;  2EOD A;  2YHN A;  3NG2 A;  3EB6 A;  4S3O B;  1JM7 B;  4GB0 A;  3LQI A;  3GL6 A;  4AUQ B;  5G0F A;  4AYC A;  3U5P A;  2YUR A;  4IC2 A;  4ZDT A;  3RPG B;  5FER A;  3N9N A;  3RPG C;  3ZNI A;  2CSY A;  2I50 A;  3GV4 A;  1VFY A;  4WZ2 A;  1X4I A;  3ASL A;  1BOR A;  1K2F A;  5D1M B;  1WEV A;  2RI7 A;  4XI1 A;  3SHB A;  2LRI C;  3KV6 A;  1WIM A;  2L5U A;  3O34 A;  2ECW A;  2UZG A;  2K17 A;  4BHW A;  4R8P K;  4YAD A;  2KRE A;  4YAX A;  3L1X A;  2KWJ A;  4YBT A;  4LK9 A;  4YBM A;  1HYJ A;  1G25 A;  2FSA A;  2NAA A;  3N9L A;  2KU3 A;  2LV9 A;  4X3G A;  4MSX A;  2C2V S;  2PNX A;  3QZV A;  2FUI A;  2YQM A;  3LQH A;  4O64 A;  4W4U A;  5D1L B;  2ECJ A;  4GNE A;  3U5M A;  2Y1N A;  3PUQ A;  4P5O B;  4A0C D;  2VPG A;  2MNZ A;  4AVX A;  2ECT A;  1JM7 A;  1RMD A;  5B75 A;  1IYM A;  1WEO A;  1WEM A;  3RTR B;  3O7A A;  4PPE A;  3MHH A;  2VJF B;  5H9M A;  1WE9 A;  4GND A;  1WEP A;  3L1Z B;  2M6M A;  2M1R A;  2BAY A;  2LXP C;  3KQI A;  3SOW A;  1VD4 A;  4BBQ A;  2KGG A;  1WFK A;  4LAD B;  5H1U A;  1CHC A;  5FB0 A;  3LQJ A;  2LN0 A;  1WEN A;  2JMD A;  2VP7 A;  2CKL A;  1X4J A;  5LCW B;  4AP4 A;  5B76 A;  1FBV A;  5TBN A;  2ZET C;  1VYX A;  2YQL A;  1U6G B;  4PTB A;  1F62 A;  2VJE A;  4IC3 A;  3M63 A;  2E6R A;  1WEE A;  4V3L C;  5DKA A;  1X4U A;  5C13 A;  5J3X A;  2MD7 B;  1LDK C;  4Q6F A;  2MIQ A;  2H0D A;  5TDR A;  5AIU A;  1E4U A;  4B86 C;  2YSM A;  3U5O A;  1MM3 A;  2QJ0 A;  2VNF A;  4V3K C;  2YSJ A;  4MVT A;  2ECV A;  2G43 A;  2OXQ C;  2E6S A;  1V87 A;  1WGM A;  2LGG A;  4L7X A;  5LKT A;  2F6N A;  2YT5 A;  2K4D A;  2CT2 A;  4QF3 A;  2KE1 A;  4FIP A;  4UP5 A;  5LKX A;  2EGP A;  3KNV A;  5LKZ A;  2XEU A;  3ZVY A;  1LDJ B;  2CKL B;  2L75 A;  5H1V A;  3FL2 A;  2QIZ A;  2ECG A;  2F42 A;  3C5K A;  4F52 B;  4TKP B;  2MNY A;  4R2Y A;  5B77 A;  3SOU A;  2H0D B;  3IHP A;  2CSZ A;  2EA6 A;  3C6W A;  2HYE D;  4WZ0 A;  2G6Q A;  3N9Q A;  1JOC A;  5EYA F;  4B7Y C;  5C11 A;  2LXH C;  3PHD A;  3SOX A;  4AYC B;  3DQV R;  4A49 A;  2L80 A;  2VPD A;  2FUU A;  2QIC A;  3VK6 A;  2YRE A;  1Z6U A;  2VJE B;  2C2L A;  2LGK A;  3M62 A;  2MT5 A;  2Y43 A;  5KH9 A;  4GNG A;  5JG6 A;  2YW8 A;  4A4C A;  4N3W A;  2K1J A;  3ZYQ A;  1XWH A;  2LGV A;  4UI9 B;  4L58 A;  3O70 A;  4ZUX U;  3MHS A;  1ZBD B;  4C9Z A;  2KWO A;  2HDP A;  4I7B A;  3ZVZ B;  2JMI A;  3ZPV 1;  3HCT A;  3HTK C;  2MA5 A;  2MA6 A;  2LGL A;  4FJC A;  3T6R A;  3KV5 A;  5B78 A;  1WEW A;  5AIT A;  4CCG X;  2KWN A;  5D1K B;  2YHO A;  2MD8 C;  3EB5 A;  2G45 A;  5KH3 A;  4YBS A;  2JRJ A;  4I7C A;  2ECI A;  4A4B A;  4LLB A;  3PUR A;  2LDR A;  2YU4 A;  3ZTG A;  4ZQL A;  4GNF A;  3O36 A;  4I7D A;  3LRQ A;  1T1H A;  5I3L A;  2ECN A;  2Y1M A;  4N4F A;  4UP0 A;  2KWK A;  5TRB A;  4LKA A;  1HYI A;  3T7L A;  2KFT A;  5TAB A;  2MUM A;  3N9O A;  3L11 A;  2KIZ A;  2PUY A;  2VJF A;  4NN2 A;  2YYR A;  4S3O C;  2KGI A;  4CA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...