4L7XA

Crystal structure of the dido phd finger in complex with h3k4me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-inducer obliterator 1
publication title Dido3 PHD Modulates Cell Differentiation and Division.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, gene regulation
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l7xA00
1WEQA 2ECVA 1HYJA 1FBVA 4I7CA 3FL2A 4AP4A 4BBQA 4QF3A 4MSXA 4I7BA 3RTRB 3M99A 2ECJA 2G43A 2YW8A 2BAYA 2HYED 4AYCA 5FERA 5AIUA 2DX8A 5DINA 2E6RA 3PUQA 2K17A 3O35A 1WIMA 3O7AA 5TRBA 2F42A 2LXPC 1X4JA 1BORA 2F6JA 1WEWA 2L0BA 2KWJA 5D1LB 5D1MB 5KH9A 2LXHC 4IC3A 5FB0A 2VJFB 2YURA 2C2VS 3KNVA 5J3XA 5B77A 4CA1A 2D8SA 3U5MA 2IDAA 2VP7A 4F52B 1T1HA 3LQJA 1DVPA 3DQVR 4GNGA 4UP0A 5G0FA 4R2YA 2XEUA 5B8DA 4V3KC 1K2FA 2QJ0A 5D1KB 2MA5A 2YSJA 4N4FA 2KGGA 2LDRA 2KREA 4AVXA 1U6GB 4AUQB 2VJEA 1MM3A 4FJCA 5H1TA 3N9OA 3C6WA 4TKPB 2E6SA 5KH3A 4ZQLA 2L75A 4WZ0A 3N9MA 1VFYA 2KGIA 1WEOA 2YT5A 2YQMA 3KV5A 2KU3A 2MUMA 4P5OB 3HTKC 2LGGA 4NN2A 2ECGA 1WGMA 2KWNA 2ECNA 5C11A 5LKUA 4S3OB 4YATA 3N9PA 2QIZA 1WE9A 2K4DA 2FSAA 2NAAA 2M85A 4WA6A 2MNYA 1CHCA 3ZPVE 4WZ2A 2RI7A 4R7EA 5C13A 2KWKA 3ZNIA 4Q6FA 4GNEA 1RMDA 2ZETC 4LKAA 4QF2A 4A4BA 2KWOA 3O36A 1N87A 3U5PA 4S3OC 2L80A 2VPGA 2CKLA 2K16A 1IYMA 3O34A 2XB1A 2L43A 1E4UA 2YU4A 5G05B 5LCWB 4LADB 4WZ3B 2YUCA 5LKTA 2EGPA 3IHPA 4UP5A 4CCGX 4YAXA 2LGVA 1ZBDB 2LV9A 4FO9A 2LGKA 4O64A 4YC9A 4YBSA 4FK5A 2YHNA 2M6MA 3ZTGA 3GV4A 3EB6A 3DPLR 5G04B 4GB0A 1Z2QA 2VNFA 4ZUXU 1WEPA 4B86C 2YYRA 3V43A 5B76A 3GL6A 2YHOA 3ZPV1 5H1VA 1XWHA 3C5KA 4C9ZA 5LKXA 2C2LA 2JMDA 2FUIA 2Y1MA 3HCUA 2CSYA 4LLBA 3NG2A 4N3WA 2MD8C 4IC2A 2G45A 2EODA 2G6QA 2LQ6A 2CKLB 4MVTA 3QZVA 3KQIA 1LDJB 2LRIC 4AYCB 2I50A 2H0DA 1WEUA 3O33A 4PTBA 2RSDA 3HCSA 3U5OA 3ZYQA 1HYIA 5JG6A 4LK9A 4A49A 2K1JA 2KYUA 3ZVYA 2LN0A 5EYAF 2KFTA 2JMJA 1Z6UA 2L5UA 2VPDA 4GNFA 3KV6A 3U5NA 2JRJA 2M1RA 2MNZA 5TBNA 5KH7A 4BHWA 4YBMA 2ECTA 5AITA 3LQIA 1G25A 5TDRA 1WESA 2MT5A 1FP0A 4PPEA 2VJEB 2MD7B 3PURA 4XI1A 4R8PK 2OXQC 1MM2A 2QICA 5TDWA 5B79A 3M63A 2FUUA 2KIZA 2Y43A 1Z60A 3MHHA 1X4IA 5FB1A 3SHBA 2M3HA 2YREA 3LRQA 4V3LC 2H0DB 3MHSA 2EA6A 3VK6A 1JM7A 5H9MA 1LDKC 2ECIA 5H1UA 3HCTA 5B78A 4A4CA 1JOCA 2UZGA 2Y1NA 2PNXA 5I3LA 4LJNA 5TABA 3ZVZB 3I2DA 2VPBA 3RPGB 4B7YC 3L1XA 1WILA 3EB5A 4FIPA 2LGLA 2YSMA 4GNDA 2PUYA 2MIQA 3O70A 3L11A 2MA6A 2CT2A 2VPEA 3SOXA 2CSZA 4L58A 3SOWA 3T6RA 4W4UA 3LQHA 1WENA 1WFKA 1VD4A 1WEMA 4L7XA 2AN6A 3M62A 2ECWA 2HDPA 3RPGC 5B75A 3L1ZB 2VJFA 3N9NA 5FEYA 4ZDTA 2JMIA 3T7LA 3N9QA 4UI9B 2KR4A 1F62A 4A0CD 5LKZA 4YBTA 1WEEA 3SOUA 4X3GA 3O37A 3PHDA 1X4UA 2YQLA 2F6NA 3N9LA 1WEVA 1VYXA 3ASLA 1JM7B 1V87A 4YADA 4I7DA 4YABA 2KE1A 5DKAA
chains in the Genus database with same CATH superfamily
1WEQA 2ECVA 1HYJA 1FBVA 4I7CA 3FL2A 3Q1DA 4AP4A 4BBQA 4QF3A 4MSXA 4I7BA 3RTRB 3M99A 2ECJA 2G43A 2YW8A 2BAYA 2HYED 4AYCA 2XOYA 5FERA 5AIUA 2DX8A 5DINA 2E6RA 3PUQA 2K17A 3O35A 1WIMA 3O7AA 5TRBA 2F42A 2LXPC 1X4JA 2DSMA 1BORA 2F6JA 1WEWA 2L0BA 2KWJA 5D1LB 5D1MB 5KH9A 2LXHC 4IC3A 5FB0A 2VJFB 2YURA 2C2VS 3KNVA 5J3XA 5B77A 4CA1A 2D8SA 3U5MA 2IDAA 2VP7A 4F52B 1T1HA 3LQJA 1DVPA 3DQVR 4GNGA 4UP0A 5G0FA 4R2YA 2XEUA 5B8DA 4V3KC 1K2FA 2QJ0A 5D1KB 2MA5A 2YSJA 4N4FA 2KGGA 2LDRA 2KREA 4AVXA 1U6GB 4AUQB 2VJEA 1MM3A 4FJCA 5H1TA 2KE1A 3N9OA 3C6WA 4QQ4A 4TKPB 2E6SA 5KH3A 4ZQLA 2MKEA 2L75A 4WZ0A 3N9MA 1VFYA 5SVIB 2KGIA 1WEOA 2YT5A 3MDBC 2YQMA 3KV5A 2KU3A 2MUMA 4P5OB 3HTKC 2LGGA 4NN2A 2ECGA 1WGMA 2KWNA 2ECNA 5C11A 5LKUA 4S3OB 4YATA 3N9PA 2QIZA 1WE9A 2K4DA 2FSAA 2NAAA 2M85A 4WA6A 2MNYA 1CHCA 3ZPVE 4WZ2A 2RI7A 4R7EA 5C13A 2KWKA 3ZNIA 4Q6FA 4GNEA 1RMDA 2ZETC 4LKAA 4QF2A 4A4BA 2KWOA 3O36A 1N87A 3U5PA 4S3OC 2L80A 2VPGA 2CKLA 2K16A 1IYMA 3O34A 2XB1A 2L43A 2XOCA 1E4UA 2YU4A 5G05B 5LCWB 4LADB 4WZ3B 2YUCA 3DDTA 5LKTA 2EGPA 3IHPA 4H9DA 4CCGX 4UP5A 4YAXA 3SUBA 2LGVA 1ZBDB 2LV9A 4FO9A 2LGKA 4O64A 5K3QA 2CSVA 4YC9A 4YBSA 4FK5A 2YHNA 2M6MA 3KDEC 3ZTGA 3GV4A 3EB6A 3DPLR 2EXUA 5G04B 4Z0OA 4GB0A 5SVXA 2XP0A 1Z2QA 2VNFA 4ZUXU 1WEPA 2M13A 4B86C 2YYRA 3V43A 5B76A 2JUNA 3GL6A 2YHOA 3ZPV1 5H1VA 1XWHA 3C5KA 4C9ZA 5LKXA 2C2LA 2JMDA 2FUIA 2Y1MA 3T9KA 3O47A 3HCUA 2CSYA 4LLBA 3NG2A 4N3WA 2MD8C 4IC2A 2G45A 2XOZA 2EODA 2G6QA 2D8UA 2LQ6A 2CKLB 4MVTA 3QZVA 3KQIA 1LDJB 2LRIC 4AYCB 2I50A 2H0DA 2CRRA 3LVQE 3FM8C 1WEUA 2CRWA 3O33A 4PTBA 2RSDA 3HCSA 3U5OA 3ZYQA 1HYIA 5JG6A 4LK9A 2FD4A 4A49A 2K1JA 2KYUA 3ZVYA 2LN0A 5EYAF 2KFTA 2JMJA 1Z6UA 2L5UA 2VPDA 4GNFA 3KV6A 3U5NA 2JRJA 2LAUA 2OWAA 2M1RA 2MNZA 5TBNA 5KH7A 4BHWA 4YBMA 2P57A 3FANA 2ECTA 5AITA 3LQIA 1G25A 5TDRA 1WESA 2MT5A 1FP0A 4PPEA 2VJEB 2MD7B 3PURA 4XI1A 4R8PK 5SVIA 5SVYA 2OXQC 1MM2A 2QICA 5TDWA 5B79A 3M63A 2FUUA 2KIZA 1DCQA 3LVRE 2Y43A 2CONA 1Z60A 3MHHA 1X4IA 5FB1A 3SHBA 2M3HA 2YREA 3LRQA 4V3LC 2H0DB 3MHSA 1MBMA 2EA6A 3VK6A 1JM7A 5H9MA 1LDKC 2ECIA 5H1UA 2YVRA 3HCTA 2DJAA 5B78A 2JM3A 4O62A 4A4CA 1JOCA 2UZGA 2Y1NA 2IQJA 2PNXA 5I3LA 4LJNA 5TABA 3ZVZB 3I2DA 2VPBA 2RR4A 3RPGB 4B7YC 2FFWA 3L1XA 1WILA 3EB5A 4FIPA 2LGLA 2YSMA 4GNDA 2PUYA 2MIQA 3O70A 3L11A 2MA6A 2CT2A 2VPEA 3SOXA 2CSZA 3LJUX 4L58A 3SOWA 3T6RA 4OGCA 3LQHA 4W4UA 1WENA 3DWDA 1WFKA 1VD4A 3FJUB 1WEMA 4L7XA 2AN6A 3M62A 2ECWA 2HDPA 3RPGC 5B75A 4OGEA 3L1ZB 2VJFA 3N9NA 3JUEA 5FEYA 3E2DA 2EGMA 4ZDTA 3M7KA 2KKXA 2JMIA 3T7LA 3N9QA 4UI9B 2KR4A 1F62A 4A0CD 5LKZA 4YBTA 1WEEA 3SOUA 3H7HA 4X3GA 3O37A 3PHDA 1X4UA 3FEHA 2YQLA 3LDYA 2F6NA 3FAOA 3N9LA 3PLWA 2B0OE 2E61A 1WEVA 2L7PA 1VYXA 4Z0RA 3ASLA 1JM7B 1V87A 4YADA 4I7DA 4YABA 4F1PA 2KKYA 5DKAA
chains in the Genus database with same CATH topology
1WEQA 2ECVA 1HYJA 1FBVA 4I7CA 3FL2A 4AP4A 4BBQA 4QF3A 4MSXA 4I7BA 3RTRB 3M99A 2ECJA 2G43A 2YW8A 2BAYA 2HYED 4AYCA 5FERA 5AIUA 2DX8A 5DINA 2E6RA 3PUQA 2K17A 3O35A 1WIMA 3O7AA 5TRBA 2F42A 2LXPC 1X4JA 1BORA 2F6JA 1WEWA 2L0BA 2KWJA 5D1LB 5D1MB 5KH9A 2LXHC 4IC3A 5FB0A 2VJFB 2YURA 2C2VS 3KNVA 5J3XA 5B77A 4CA1A 2D8SA 3U5MA 2IDAA 2VP7A 4F52B 1T1HA 3LQJA 1DVPA 3DQVR 4GNGA 4UP0A 5G0FA 4R2YA 2XEUA 5B8DA 4V3KC 1K2FA 2QJ0A 5D1KB 2MA5A 2YSJA 4N4FA 2KGGA 2LDRA 2KREA 4AVXA 1U6GB 4AUQB 2VJEA 1MM3A 4FJCA 5H1TA 3N9OA 3C6WA 4TKPB 2E6SA 5KH3A 4ZQLA 2L75A 4WZ0A 3N9MA 1VFYA 2KGIA 1WEOA 2YT5A 2YQMA 3KV5A 2KU3A 2MUMA 4P5OB 3HTKC 2LGGA 4NN2A 2ECGA 1WGMA 2KWNA 2ECNA 5C11A 5LKUA 4S3OB 4YATA 3N9PA 2QIZA 1WE9A 2K4DA 2FSAA 2NAAA 2M85A 4WA6A 2MNYA 1CHCA 3ZPVE 4WZ2A 2RI7A 4R7EA 5C13A 2KWKA 3ZNIA 4Q6FA 4GNEA 1RMDA 2ZETC 4LKAA 4QF2A 4A4BA 2KWOA 3O36A 1N87A 3U5PA 4S3OC 2L80A 2VPGA 2CKLA 2K16A 1IYMA 3O34A 2XB1A 2L43A 1E4UA 2YU4A 5G05B 5LCWB 4LADB 4WZ3B 2YUCA 5LKTA 2EGPA 3IHPA 4UP5A 4CCGX 4YAXA 2LGVA 1ZBDB 2LV9A 4FO9A 2LGKA 4O64A 4YC9A 4YBSA 4FK5A 2YHNA 2M6MA 3ZTGA 3GV4A 3EB6A 3DPLR 5G04B 4GB0A 1Z2QA 2VNFA 4ZUXU 1WEPA 4B86C 2YYRA 3V43A 5B76A 3GL6A 2YHOA 3ZPV1 5H1VA 1XWHA 3C5KA 4C9ZA 5LKXA 2C2LA 2JMDA 2FUIA 2Y1MA 3HCUA 2CSYA 4LLBA 3NG2A 4N3WA 2MD8C 4IC2A 2G45A 2EODA 2G6QA 2LQ6A 2CKLB 4MVTA 3QZVA 3KQIA 1LDJB 2LRIC 4AYCB 2I50A 2H0DA 1WEUA 3O33A 4PTBA 2RSDA 3HCSA 3U5OA 3ZYQA 1HYIA 5JG6A 4LK9A 4A49A 2K1JA 2KYUA 3ZVYA 2LN0A 5EYAF 2KFTA 2JMJA 1Z6UA 2L5UA 2VPDA 4GNFA 3KV6A 3U5NA 2JRJA 2M1RA 2MNZA 5TBNA 5KH7A 4BHWA 4YBMA 2ECTA 5AITA 3LQIA 1G25A 5TDRA 1WESA 2MT5A 1FP0A 4PPEA 2VJEB 2MD7B 3PURA 4XI1A 4R8PK 2OXQC 1MM2A 2QICA 5TDWA 5B79A 3M63A 2FUUA 2KIZA 2Y43A 1Z60A 3MHHA 1X4IA 5FB1A 3SHBA 2M3HA 2YREA 3LRQA 4V3LC 2H0DB 3MHSA 2EA6A 3VK6A 1JM7A 5H9MA 1LDKC 2ECIA 5H1UA 3HCTA 5B78A 4A4CA 1JOCA 2UZGA 2Y1NA 2PNXA 5I3LA 4LJNA 5TABA 3ZVZB 3I2DA 2VPBA 3RPGB 4B7YC 3L1XA 1WILA 3EB5A 4FIPA 2LGLA 2YSMA 4GNDA 2PUYA 2MIQA 3O70A 3L11A 2MA6A 2CT2A 2VPEA 3SOXA 2CSZA 4L58A 3SOWA 3T6RA 4W4UA 3LQHA 1WENA 1WFKA 1VD4A 1WEMA 4L7XA 2AN6A 3M62A 2ECWA 2HDPA 3RPGC 5B75A 3L1ZB 2VJFA 3N9NA 5FEYA 4ZDTA 2JMIA 3T7LA 3N9QA 4UI9B 2KR4A 1F62A 4A0CD 5LKZA 4YBTA 1WEEA 3SOUA 4X3GA 3O37A 3PHDA 1X4UA 2YQLA 2F6NA 3N9LA 1WEVA 1VYXA 3ASLA 1JM7B 1V87A 4YADA 4I7DA 4YABA 2KE1A 5DKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEQ A;  2ECV A;  1HYJ A;  1FBV A;  4I7C A;  3FL2 A;  4AP4 A;  4BBQ A;  4QF3 A;  4MSX A;  4I7B A;  3RTR B;  3M99 A;  2ECJ A;  2G43 A;  2YW8 A;  2BAY A;  2HYE D;  4AYC A;  5FER A;  5AIU A;  2DX8 A;  5DIN A;  2E6R A;  3PUQ A;  2K17 A;  3O35 A;  1WIM A;  3O7A A;  5TRB A;  2F42 A;  2LXP C;  1X4J A;  1BOR A;  2F6J A;  1WEW A;  2L0B A;  2KWJ A;  5D1L B;  5D1M B;  5KH9 A;  2LXH C;  4IC3 A;  5FB0 A;  2VJF B;  2YUR A;  2C2V S;  3KNV A;  5J3X A;  5B77 A;  4CA1 A;  2D8S A;  3U5M A;  2IDA A;  2VP7 A;  4F52 B;  1T1H A;  3LQJ A;  1DVP A;  3DQV R;  4GNG A;  4UP0 A;  5G0F A;  4R2Y A;  2XEU A;  5B8D A;  4V3K C;  1K2F A;  2QJ0 A;  5D1K B;  2MA5 A;  2YSJ A;  4N4F A;  2KGG A;  2LDR A;  2KRE A;  4AVX A;  1U6G B;  4AUQ B;  2VJE A;  1MM3 A;  4FJC A;  5H1T A;  3N9O A;  3C6W A;  4TKP B;  2E6S A;  5KH3 A;  4ZQL A;  2L75 A;  4WZ0 A;  3N9M A;  1VFY A;  2KGI A;  1WEO A;  2YT5 A;  2YQM A;  3KV5 A;  2KU3 A;  2MUM A;  4P5O B;  3HTK C;  2LGG A;  4NN2 A;  2ECG A;  1WGM A;  2KWN A;  2ECN A;  5C11 A;  5LKU A;  4S3O B;  4YAT A;  3N9P A;  2QIZ A;  1WE9 A;  2K4D A;  2FSA A;  2NAA A;  2M85 A;  4WA6 A;  2MNY A;  1CHC A;  3ZPV E;  4WZ2 A;  2RI7 A;  4R7E A;  5C13 A;  2KWK A;  3ZNI A;  4Q6F A;  4GNE A;  1RMD A;  2ZET C;  4LKA A;  4QF2 A;  4A4B A;  2KWO A;  3O36 A;  1N87 A;  3U5P A;  4S3O C;  2L80 A;  2VPG A;  2CKL A;  2K16 A;  1IYM A;  3O34 A;  2XB1 A;  2L43 A;  1E4U A;  2YU4 A;  5G05 B;  5LCW B;  4LAD B;  4WZ3 B;  2YUC A;  5LKT A;  2EGP A;  3IHP A;  4UP5 A;  4CCG X;  4YAX A;  2LGV A;  1ZBD B;  2LV9 A;  4FO9 A;  2LGK A;  4O64 A;  4YC9 A;  4YBS A;  4FK5 A;  2YHN A;  2M6M A;  3ZTG A;  3GV4 A;  3EB6 A;  3DPL R;  5G04 B;  4GB0 A;  1Z2Q A;  2VNF A;  4ZUX U;  1WEP A;  4B86 C;  2YYR A;  3V43 A;  5B76 A;  3GL6 A;  2YHO A;  3ZPV 1;  5H1V A;  1XWH A;  3C5K A;  4C9Z A;  5LKX A;  2C2L A;  2JMD A;  2FUI A;  2Y1M A;  3HCU A;  2CSY A;  4LLB A;  3NG2 A;  4N3W A;  2MD8 C;  4IC2 A;  2G45 A;  2EOD A;  2G6Q A;  2LQ6 A;  2CKL B;  4MVT A;  3QZV A;  3KQI A;  1LDJ B;  2LRI C;  4AYC B;  2I50 A;  2H0D A;  1WEU A;  3O33 A;  4PTB A;  2RSD A;  3HCS A;  3U5O A;  3ZYQ A;  1HYI A;  5JG6 A;  4LK9 A;  4A49 A;  2K1J A;  2KYU A;  3ZVY A;  2LN0 A;  5EYA F;  2KFT A;  2JMJ A;  1Z6U A;  2L5U A;  2VPD A;  4GNF A;  3KV6 A;  3U5N A;  2JRJ A;  2M1R A;  2MNZ A;  5TBN A;  5KH7 A;  4BHW A;  4YBM A;  2ECT A;  5AIT A;  3LQI A;  1G25 A;  5TDR A;  1WES A;  2MT5 A;  1FP0 A;  4PPE A;  2VJE B;  2MD7 B;  3PUR A;  4XI1 A;  4R8P K;  2OXQ C;  1MM2 A;  2QIC A;  5TDW A;  5B79 A;  3M63 A;  2FUU A;  2KIZ A;  2Y43 A;  1Z60 A;  3MHH A;  1X4I A;  5FB1 A;  3SHB A;  2M3H A;  2YRE A;  3LRQ A;  4V3L C;  2H0D B;  3MHS A;  2EA6 A;  3VK6 A;  1JM7 A;  5H9M A;  1LDK C;  2ECI A;  5H1U A;  3HCT A;  5B78 A;  4A4C A;  1JOC A;  2UZG A;  2Y1N A;  2PNX A;  5I3L A;  4LJN A;  5TAB A;  3ZVZ B;  3I2D A;  2VPB A;  3RPG B;  4B7Y C;  3L1X A;  1WIL A;  3EB5 A;  4FIP A;  2LGL A;  2YSM A;  4GND A;  2PUY A;  2MIQ A;  3O70 A;  3L11 A;  2MA6 A;  2CT2 A;  2VPE A;  3SOX A;  2CSZ A;  4L58 A;  3SOW A;  3T6R A;  4W4U A;  3LQH A;  1WEN A;  1WFK A;  1VD4 A;  1WEM A;  4L7X A;  2AN6 A;  3M62 A;  2ECW A;  2HDP A;  3RPG C;  5B75 A;  3L1Z B;  2VJF A;  3N9N A;  5FEY A;  4ZDT A;  2JMI A;  3T7L A;  3N9Q A;  4UI9 B;  2KR4 A;  1F62 A;  4A0C D;  5LKZ A;  4YBT A;  1WEE A;  3SOU A;  4X3G A;  3O37 A;  3PHD A;  1X4U A;  2YQL A;  2F6N A;  3N9L A;  1WEV A;  1VYX A;  3ASL A;  1JM7 B;  1V87 A;  4YAD A;  4I7D A;  4YAB A;  2KE1 A;  5DKA A; 
#chains in the Genus database with same CATH topology
 1WEQ A;  2ECV A;  1HYJ A;  1FBV A;  4I7C A;  3FL2 A;  3Q1D A;  4AP4 A;  4BBQ A;  4QF3 A;  4MSX A;  4I7B A;  3RTR B;  3M99 A;  2ECJ A;  2G43 A;  2YW8 A;  2BAY A;  2HYE D;  4AYC A;  2XOY A;  5FER A;  5AIU A;  2DX8 A;  5DIN A;  2E6R A;  3PUQ A;  2K17 A;  3O35 A;  1WIM A;  3O7A A;  5TRB A;  2F42 A;  2LXP C;  1X4J A;  2DSM A;  1BOR A;  2F6J A;  1WEW A;  2L0B A;  2KWJ A;  5D1L B;  5D1M B;  5KH9 A;  2LXH C;  4IC3 A;  5FB0 A;  2VJF B;  2YUR A;  2C2V S;  3KNV A;  5J3X A;  5B77 A;  4CA1 A;  2D8S A;  3U5M A;  2IDA A;  2VP7 A;  4F52 B;  1T1H A;  3LQJ A;  1DVP A;  3DQV R;  4GNG A;  4UP0 A;  5G0F A;  4R2Y A;  2XEU A;  5B8D A;  4V3K C;  1K2F A;  2QJ0 A;  5D1K B;  2MA5 A;  2YSJ A;  4N4F A;  2KGG A;  2LDR A;  2KRE A;  4AVX A;  1U6G B;  4AUQ B;  2VJE A;  1MM3 A;  4FJC A;  5H1T A;  2KE1 A;  3N9O A;  3C6W A;  4QQ4 A;  4TKP B;  2E6S A;  5KH3 A;  4ZQL A;  2MKE A;  2L75 A;  4WZ0 A;  3N9M A;  1VFY A;  5SVI B;  2KGI A;  1WEO A;  2YT5 A;  3MDB C;  2YQM A;  3KV5 A;  2KU3 A;  2MUM A;  4P5O B;  3HTK C;  2LGG A;  4NN2 A;  2ECG A;  1WGM A;  2KWN A;  2ECN A;  5C11 A;  5LKU A;  4S3O B;  4YAT A;  3N9P A;  2QIZ A;  1WE9 A;  2K4D A;  2FSA A;  2NAA A;  2M85 A;  4WA6 A;  2MNY A;  1CHC A;  3ZPV E;  4WZ2 A;  2RI7 A;  4R7E A;  5C13 A;  2KWK A;  3ZNI A;  4Q6F A;  4GNE A;  1RMD A;  2ZET C;  4LKA A;  4QF2 A;  4A4B A;  2KWO A;  3O36 A;  1N87 A;  3U5P A;  4S3O C;  2L80 A;  2VPG A;  2CKL A;  2K16 A;  1IYM A;  3O34 A;  2XB1 A;  2L43 A;  2XOC A;  1E4U A;  2YU4 A;  5G05 B;  5LCW B;  4LAD B;  4WZ3 B;  2YUC A;  3DDT A;  5LKT A;  2EGP A;  3IHP A;  4H9D A;  4CCG X;  4UP5 A;  4YAX A;  3SUB A;  2LGV A;  1ZBD B;  2LV9 A;  4FO9 A;  2LGK A;  4O64 A;  5K3Q A;  2CSV A;  4YC9 A;  4YBS A;  4FK5 A;  2YHN A;  2M6M A;  3KDE C;  3ZTG A;  3GV4 A;  3EB6 A;  3DPL R;  2EXU A;  5G04 B;  4Z0O A;  4GB0 A;  5SVX A;  2XP0 A;  1Z2Q A;  2VNF A;  4ZUX U;  1WEP A;  2M13 A;  4B86 C;  2YYR A;  3V43 A;  5B76 A;  2JUN A;  3GL6 A;  2YHO A;  3ZPV 1;  5H1V A;  1XWH A;  3C5K A;  4C9Z A;  5LKX A;  2C2L A;  2JMD A;  2FUI A;  2Y1M A;  3T9K A;  3O47 A;  3HCU A;  2CSY A;  4LLB A;  3NG2 A;  4N3W A;  2MD8 C;  4IC2 A;  2G45 A;  2XOZ A;  2EOD A;  2G6Q A;  2D8U A;  2LQ6 A;  2CKL B;  4MVT A;  3QZV A;  3KQI A;  1LDJ B;  2LRI C;  4AYC B;  2I50 A;  2H0D A;  2CRR A;  3LVQ E;  3FM8 C;  1WEU A;  2CRW A;  3O33 A;  4PTB A;  2RSD A;  3HCS A;  3U5O A;  3ZYQ A;  1HYI A;  5JG6 A;  4LK9 A;  2FD4 A;  4A49 A;  2K1J A;  2KYU A;  3ZVY A;  2LN0 A;  5EYA F;  2KFT A;  2JMJ A;  1Z6U A;  2L5U A;  2VPD A;  4GNF A;  3KV6 A;  3U5N A;  2JRJ A;  2LAU A;  2OWA A;  2M1R A;  2MNZ A;  5TBN A;  5KH7 A;  4BHW A;  4YBM A;  2P57 A;  3FAN A;  2ECT A;  5AIT A;  3LQI A;  1G25 A;  5TDR A;  1WES A;  2MT5 A;  1FP0 A;  4PPE A;  2VJE B;  2MD7 B;  3PUR A;  4XI1 A;  4R8P K;  5SVI A;  5SVY A;  2OXQ C;  1MM2 A;  2QIC A;  5TDW A;  5B79 A;  3M63 A;  2FUU A;  2KIZ A;  1DCQ A;  3LVR E;  2Y43 A;  2CON A;  1Z60 A;  3MHH A;  1X4I A;  5FB1 A;  3SHB A;  2M3H A;  2YRE A;  3LRQ A;  4V3L C;  2H0D B;  3MHS A;  1MBM A;  2EA6 A;  3VK6 A;  1JM7 A;  5H9M A;  1LDK C;  2ECI A;  5H1U A;  2YVR A;  3HCT A;  2DJA A;  5B78 A;  2JM3 A;  4O62 A;  4A4C A;  1JOC A;  2UZG A;  2Y1N A;  2IQJ A;  2PNX A;  5I3L A;  4LJN A;  5TAB A;  3ZVZ B;  3I2D A;  2VPB A;  2RR4 A;  3RPG B;  4B7Y C;  2FFW A;  3L1X A;  1WIL A;  3EB5 A;  4FIP A;  2LGL A;  2YSM A;  4GND A;  2PUY A;  2MIQ A;  3O70 A;  3L11 A;  2MA6 A;  2CT2 A;  2VPE A;  3SOX A;  2CSZ A;  3LJU X;  4L58 A;  3SOW A;  3T6R A;  4OGC A;  3LQH A;  4W4U A;  1WEN A;  3DWD A;  1WFK A;  1VD4 A;  3FJU B;  1WEM A;  4L7X A;  2AN6 A;  3M62 A;  2ECW A;  2HDP A;  3RPG C;  5B75 A;  4OGE A;  3L1Z B;  2VJF A;  3N9N A;  3JUE A;  5FEY A;  3E2D A;  2EGM A;  4ZDT A;  3M7K A;  2KKX A;  2JMI A;  3T7L A;  3N9Q A;  4UI9 B;  2KR4 A;  1F62 A;  4A0C D;  5LKZ A;  4YBT A;  1WEE A;  3SOU A;  3H7H A;  4X3G A;  3O37 A;  3PHD A;  1X4U A;  3FEH A;  2YQL A;  3LDY A;  2F6N A;  3FAO A;  3N9L A;  3PLW A;  2B0O E;  2E61 A;  1WEV A;  2L7P A;  1VYX A;  4Z0R A;  3ASL A;  1JM7 B;  1V87 A;  4YAD A;  4I7D A;  4YAB A;  4F1P A;  2KKY A;  5DKA A; 
#chains in the Genus database with same CATH homology
 1WEQ A;  2ECV A;  1HYJ A;  1FBV A;  4I7C A;  3FL2 A;  4AP4 A;  4BBQ A;  4QF3 A;  4MSX A;  4I7B A;  3RTR B;  3M99 A;  2ECJ A;  2G43 A;  2YW8 A;  2BAY A;  2HYE D;  4AYC A;  5FER A;  5AIU A;  2DX8 A;  5DIN A;  2E6R A;  3PUQ A;  2K17 A;  3O35 A;  1WIM A;  3O7A A;  5TRB A;  2F42 A;  2LXP C;  1X4J A;  1BOR A;  2F6J A;  1WEW A;  2L0B A;  2KWJ A;  5D1L B;  5D1M B;  5KH9 A;  2LXH C;  4IC3 A;  5FB0 A;  2VJF B;  2YUR A;  2C2V S;  3KNV A;  5J3X A;  5B77 A;  4CA1 A;  2D8S A;  3U5M A;  2IDA A;  2VP7 A;  4F52 B;  1T1H A;  3LQJ A;  1DVP A;  3DQV R;  4GNG A;  4UP0 A;  5G0F A;  4R2Y A;  2XEU A;  5B8D A;  4V3K C;  1K2F A;  2QJ0 A;  5D1K B;  2MA5 A;  2YSJ A;  4N4F A;  2KGG A;  2LDR A;  2KRE A;  4AVX A;  1U6G B;  4AUQ B;  2VJE A;  1MM3 A;  4FJC A;  5H1T A;  3N9O A;  3C6W A;  4TKP B;  2E6S A;  5KH3 A;  4ZQL A;  2L75 A;  4WZ0 A;  3N9M A;  1VFY A;  2KGI A;  1WEO A;  2YT5 A;  2YQM A;  3KV5 A;  2KU3 A;  2MUM A;  4P5O B;  3HTK C;  2LGG A;  4NN2 A;  2ECG A;  1WGM A;  2KWN A;  2ECN A;  5C11 A;  5LKU A;  4S3O B;  4YAT A;  3N9P A;  2QIZ A;  1WE9 A;  2K4D A;  2FSA A;  2NAA A;  2M85 A;  4WA6 A;  2MNY A;  1CHC A;  3ZPV E;  4WZ2 A;  2RI7 A;  4R7E A;  5C13 A;  2KWK A;  3ZNI A;  4Q6F A;  4GNE A;  1RMD A;  2ZET C;  4LKA A;  4QF2 A;  4A4B A;  2KWO A;  3O36 A;  1N87 A;  3U5P A;  4S3O C;  2L80 A;  2VPG A;  2CKL A;  2K16 A;  1IYM A;  3O34 A;  2XB1 A;  2L43 A;  1E4U A;  2YU4 A;  5G05 B;  5LCW B;  4LAD B;  4WZ3 B;  2YUC A;  5LKT A;  2EGP A;  3IHP A;  4UP5 A;  4CCG X;  4YAX A;  2LGV A;  1ZBD B;  2LV9 A;  4FO9 A;  2LGK A;  4O64 A;  4YC9 A;  4YBS A;  4FK5 A;  2YHN A;  2M6M A;  3ZTG A;  3GV4 A;  3EB6 A;  3DPL R;  5G04 B;  4GB0 A;  1Z2Q A;  2VNF A;  4ZUX U;  1WEP A;  4B86 C;  2YYR A;  3V43 A;  5B76 A;  3GL6 A;  2YHO A;  3ZPV 1;  5H1V A;  1XWH A;  3C5K A;  4C9Z A;  5LKX A;  2C2L A;  2JMD A;  2FUI A;  2Y1M A;  3HCU A;  2CSY A;  4LLB A;  3NG2 A;  4N3W A;  2MD8 C;  4IC2 A;  2G45 A;  2EOD A;  2G6Q A;  2LQ6 A;  2CKL B;  4MVT A;  3QZV A;  3KQI A;  1LDJ B;  2LRI C;  4AYC B;  2I50 A;  2H0D A;  1WEU A;  3O33 A;  4PTB A;  2RSD A;  3HCS A;  3U5O A;  3ZYQ A;  1HYI A;  5JG6 A;  4LK9 A;  4A49 A;  2K1J A;  2KYU A;  3ZVY A;  2LN0 A;  5EYA F;  2KFT A;  2JMJ A;  1Z6U A;  2L5U A;  2VPD A;  4GNF A;  3KV6 A;  3U5N A;  2JRJ A;  2M1R A;  2MNZ A;  5TBN A;  5KH7 A;  4BHW A;  4YBM A;  2ECT A;  5AIT A;  3LQI A;  1G25 A;  5TDR A;  1WES A;  2MT5 A;  1FP0 A;  4PPE A;  2VJE B;  2MD7 B;  3PUR A;  4XI1 A;  4R8P K;  2OXQ C;  1MM2 A;  2QIC A;  5TDW A;  5B79 A;  3M63 A;  2FUU A;  2KIZ A;  2Y43 A;  1Z60 A;  3MHH A;  1X4I A;  5FB1 A;  3SHB A;  2M3H A;  2YRE A;  3LRQ A;  4V3L C;  2H0D B;  3MHS A;  2EA6 A;  3VK6 A;  1JM7 A;  5H9M A;  1LDK C;  2ECI A;  5H1U A;  3HCT A;  5B78 A;  4A4C A;  1JOC A;  2UZG A;  2Y1N A;  2PNX A;  5I3L A;  4LJN A;  5TAB A;  3ZVZ B;  3I2D A;  2VPB A;  3RPG B;  4B7Y C;  3L1X A;  1WIL A;  3EB5 A;  4FIP A;  2LGL A;  2YSM A;  4GND A;  2PUY A;  2MIQ A;  3O70 A;  3L11 A;  2MA6 A;  2CT2 A;  2VPE A;  3SOX A;  2CSZ A;  4L58 A;  3SOW A;  3T6R A;  4W4U A;  3LQH A;  1WEN A;  1WFK A;  1VD4 A;  1WEM A;  4L7X A;  2AN6 A;  3M62 A;  2ECW A;  2HDP A;  3RPG C;  5B75 A;  3L1Z B;  2VJF A;  3N9N A;  5FEY A;  4ZDT A;  2JMI A;  3T7L A;  3N9Q A;  4UI9 B;  2KR4 A;  1F62 A;  4A0C D;  5LKZ A;  4YBT A;  1WEE A;  3SOU A;  4X3G A;  3O37 A;  3PHD A;  1X4U A;  2YQL A;  2F6N A;  3N9L A;  1WEV A;  1VYX A;  3ASL A;  1JM7 B;  1V87 A;  4YAD A;  4I7D A;  4YAB A;  2KE1 A;  5DKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...