4L7XA

Crystal structure of the dido phd finger in complex with h3k4me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-inducer obliterator 1
publication title Dido3 PHD Modulates Cell Differentiation and Division.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, gene regulation
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l7xA00
3O35A 2KYUA 3O33A 4F52B 2ECIA 1FBVA 3HCUA 2L5UA 3IHPA 2C2LA 2F6NA 2M85A 1Z2QA 2YURA 3U5OA 2YSJA 2ECGA 2D8SA 3MHSA 4PPEA 2CSZA 2VJFA 4YBMA 3RPGC 3NG2A 2M1RA 1XWHA 2KWJA 5H9MA 3ZVYA 3GL6A 2KWKA 2M3HA 2XEUA 2KU3A 4CCGX 5FEYA 2PNXA 5H1TA 3EB5A 2G43A 3O37A 4R8PK 2ECNA 2VJEA 4CA1A 2ECWA 2VPDA 3HCTA 1WEVA 2ECTA 2LGKA 3N9NA 4O64A 2KIZA 4LKAA 5C11A 2VPBA 4ZUXU 4AYCB 4R2YA 3SHBA 3U5NA 5FB1A 5G0FA 4A0CD 2LDRA 2VJEB 4YATA 5KH3A 3N9MA 2YUCA 2MNZA 4R7EA 2FUIA 2LGLA 3U5PA 5LCWB 2KREA 4UP5A 1FP0A 2LN0A 4L58A 5TDRA 1Z60A 1DVPA 2EA6A 2UZGA 2MA5A 2Y1NA 4V3LC 2BAYA 2XB1A 4AP4A 2ECJA 4ZQLA 2I50A 5FERA 3T6RA 2F42A 4IC3A 5B78A 1N87A 4FJCA 3KV6A 5LKUA 4GNDA 2NAAA 2ZETC 5TDWA 2MIQA 3SOXA 5DINA 1HYJA 2E6SA 2DX8A 3C5KA 3LRQA 2VPGA 5B79A 2PUYA 4AUQB 2MUMA 4MVTA 4MSXA 3RTRB 2IDAA 2G6QA 2AN6A 1WEWA 5TRBA 3LQHA 1WEPA 3ZTGA 4S3OB 4LJNA 3GV4A 3KNVA 3M63A 2LXPC 2L80A 2LQ6A 4QF2A 2YT5A 2EODA 1F62A 4LADB 5EYAF 2KGIA 1WILA 4FK5A 1V87A 3PURA 3O70A 2E6RA 3ZPV1 5H1UA 2ECVA 2MA6A 4S3OC 3ASLA 2LRIC 2LGGA 1WEMA 4UI9B 2VJFB 5B75A 1WESA 2K1JA 2JMJA 4XI1A 2CKLA 2MNYA 2KE1A 1X4UA 1HYIA 5TABA 1LDKC 5C13A 2FUUA 2YHOA 3KQIA 1MM2A 3L1XA 3M99A 3L1ZB 5JG6A 3N9LA 4P5OB 2L0BA 1WEQA 3ZVZB 1Z6UA 3O34A 1CHCA 2EGPA 3L11A 4I7BA 2HYED 2M6MA 3ZPVE 2L75A 2LV9A 4W4UA 1WIMA 2MD7B 4X3GA 2KWOA 1WFKA 3PHDA 2LGVA 5D1LB 5B76A 4YBTA 3DQVR 4NN2A 3M62A 4QF3A 2KWNA 2JMDA 1JOCA 4GNEA 2RSDA 2YQLA 2G45A 4Q6FA 4B86C 3V43A 2LXHC 3N9OA 2K17A 4AVXA 5B8DA 2K16A 4FIPA 3HCSA 4TKPB 4N3WA 2YU4A 2QICA 4GNGA 5LKXA 4V3KC 1T1HA 1WEOA 2YHNA 4L7XA 4WZ0A 3DPLR 4BHWA 2MT5A 3O36A 4YBSA 3QZVA 3RPGB 1VD4A 1JM7A 2Y43A 5H1VA 2YW8A 2QIZA 1WEEA 1X4JA 3ZNIA 2VP7A 2K4DA 4GB0A 2KFTA 4A49A 1VFYA 4I7CA 3N9QA 2YSMA 2YQMA 3N9PA 2F6JA 4I7DA 5LKTA 1JM7B 4FO9A 4YAXA 2YREA 1MM3A 2VNFA 5D1MB 3PUQA 2C2VS 4IC2A 1WGMA 3SOUA 3KV5A 2VPEA 5KH9A 2Y1MA 1WENA 3LQIA 4YADA 4WA6A 1VYXA 2FSAA 5G04B 1LDJB 3O7AA 2CSYA 4ZDTA 3HTKC 3MHHA 3FL2A 5B77A 4BBQA 2L43A 2CKLB 2OXQC 2MD8C 2HDPA 3SOWA 3VK6A 4A4CA 1WE9A 3LQJA 4LLBA 5LKZA 1U6GB 3EB6A 1RMDA 2H0DA 3T7LA 4B7YC 2JRJA 5J3XA 2YYRA 2KR4A 5I3LA 4WZ2A 3C6WA 4YC9A 4AYCA 1G25A 3I2DA 1ZBDB 1X4IA 2JMIA 2RI7A 1BORA 5AITA 4UP0A 4A4BA 2KGGA 2CT2A 4C9ZA 5TBNA 4PTBA 1E4UA 4N4FA 5DKAA 2H0DB 5KH7A 1WEUA 5AIUA 4LK9A 4YABA 2QJ0A 1K2FA 5G05B 4GNFA 1IYMA 3U5MA 3ZYQA 4WZ3B 5FB0A 5D1KB
chains in the Genus database with same CATH superfamily
3O35A 2KYUA 3O33A 4F52B 2XOCA 2ECIA 3E2DA 1FBVA 3HCUA 2L5UA 3IHPA 2C2LA 2L7PA 3DWDA 2F6NA 2M85A 1Z2QA 2YURA 3U5OA 2P57A 2YSJA 2ECGA 2D8SA 2CRWA 3M7KA 3MHSA 4PPEA 2CSZA 2VJFA 4YBMA 3RPGC 3NG2A 2M1RA 1XWHA 2KWJA 5H9MA 2M13A 3ZVYA 3GL6A 2KWKA 2M3HA 2XEUA 2KU3A 4CCGX 5FEYA 2PNXA 5H1TA 3EB5A 2G43A 3O37A 4R8PK 2ECNA 2VJEA 4CA1A 2ECWA 2VPDA 3HCTA 1WEVA 2EXUA 2ECTA 2LGKA 3N9NA 4O64A 2KIZA 4LKAA 5C11A 2VPBA 4ZUXU 4AYCB 4R2YA 3SHBA 3U5NA 5FB1A 5G0FA 4A0CD 2JUNA 4Z0OA 2LDRA 2VJEB 4YATA 5KH3A 3N9MA 2YUCA 2MNZA 4R7EA 2FUIA 2LGLA 3U5PA 5LCWB 2KREA 4UP5A 1FP0A 2LN0A 4L58A 5TDRA 1Z60A 1DVPA 2EA6A 2UZGA 2MA5A 2Y1NA 4V3LC 2BAYA 2XB1A 4AP4A 3PLWA 5SVXA 2ECJA 2B0OE 4ZQLA 2I50A 5FERA 3T6RA 2F42A 4IC3A 5B78A 1N87A 4FJCA 3KV6A 5LKUA 4GNDA 2NAAA 3H7HA 2ZETC 5TDWA 2MIQA 3SOXA 5DINA 1HYJA 2E6SA 2DX8A 3C5KA 3LRQA 2VPGA 5B79A 2PUYA 4AUQB 2MUMA 4MVTA 4MSXA 1MBMA 3RTRB 2IQJA 2IDAA 2G6QA 2AN6A 1WEWA 5TRBA 3FANA 3LQHA 1WEPA 4F1PA 3ZTGA 4H9DA 4S3OB 4O62A 4LJNA 3GV4A 3KNVA 3M63A 2LXPC 2L80A 2LQ6A 3DDTA 4QF2A 2YT5A 5SVIA 2EODA 1F62A 4LADB 5EYAF 2KGIA 1WILA 4FK5A 1V87A 3PURA 3O70A 2E6RA 3ZPV1 3LDYA 5H1UA 2ECVA 2MA6A 4S3OC 3ASLA 2LRIC 2LGGA 3FEHA 1WEMA 2OWAA 2LAUA 2VJFB 4UI9B 5B75A 1WESA 2D8UA 2K1JA 2JMJA 4XI1A 2CKLA 2MNYA 2KE1A 1X4UA 1HYIA 5TABA 1LDKC 5C13A 2FUUA 2XP0A 2YHOA 3KQIA 1MM2A 3L1XA 3M99A 3L1ZB 5JG6A 3N9LA 4P5OB 2L0BA 1WEQA 3ZVZB 1Z6UA 3O34A 1CHCA 4Z0RA 3FM8C 2EGPA 3L11A 4I7BA 2CSVA 2HYED 2M6MA 3ZPVE 2L75A 2LV9A 4W4UA 2CRRA 1WIMA 2MD7B 4X3GA 2KWOA 2JM3A 3MDBC 1WFKA 3PHDA 2LGVA 2CONA 5D1LB 5B76A 4YBTA 3DQVR 4NN2A 3M62A 4QF3A 3LJUX 2KWNA 2JMDA 1JOCA 4GNEA 2RSDA 2YQLA 2G45A 3T9KA 4Q6FA 3KDEC 2DSMA 4B86C 3V43A 2LXHC 3N9OA 2K17A 4AVXA 5B8DA 2FD4A 2K16A 2RR4A 3LVRE 3HCSA 4FIPA 3SUBA 4N3WA 4TKPB 3FJUB 2YU4A 1DCQA 2QICA 4GNGA 5LKXA 3LVQE 4OGEA 1T1HA 4V3KC 1WEOA 4QQ4A 2YHNA 4L7XA 4WZ0A 3JUEA 3DPLR 4BHWA 2MT5A 3O36A 4YBSA 3QZVA 3RPGB 1VD4A 1JM7A 2EGMA 2Y43A 5SVYA 5H1VA 2YW8A 2QIZA 3FAOA 1WEEA 2XOYA 1X4JA 3ZNIA 2VP7A 2K4DA 4GB0A 2KFTA 2XOZA 4A49A 2DJAA 1VFYA 4I7CA 3N9QA 2YSMA 2YQMA 3N9PA 2F6JA 4I7DA 5LKTA 1JM7B 4FO9A 4YAXA 2YREA 1MM3A 2VNFA 5D1MB 5SVIB 3PUQA 2C2VS 4IC2A 1WGMA 3SOUA 3KV5A 2VPEA 5KH9A 2Y1MA 1WENA 3LQIA 4YADA 4WA6A 2E61A 5K3QA 1VYXA 2FSAA 2YVRA 5G04B 1LDJB 3O7AA 2CSYA 3ZYQA 4ZDTA 3HTKC 3MHHA 3FL2A 5B77A 4BBQA 2L43A 2CKLB 2OXQC 2MD8C 2HDPA 3SOWA 3VK6A 4A4CA 1WE9A 3LQJA 4LLBA 5LKZA 1U6GB 3EB6A 1RMDA 2H0DA 3T7LA 4B7YC 2FFWA 2JRJA 2MKEA 5J3XA 2YYRA 2KR4A 5I3LA 4WZ2A 3C6WA 4YC9A 4AYCA 1G25A 3I2DA 1ZBDB 4OGCA 1X4IA 2JMIA 2RI7A 1BORA 5AITA 4UP0A 4A4BA 2KGGA 3O47A 2CT2A 3Q1DA 2KKXA 4C9ZA 5TBNA 4PTBA 1E4UA 4N4FA 5DKAA 2H0DB 5KH7A 1WEUA 5AIUA 4LK9A 4YABA 2QJ0A 1K2FA 5G05B 4GNFA 1IYMA 3U5MA 2KKYA 4WZ3B 5FB0A 5D1KB
chains in the Genus database with same CATH topology
3O35A 2KYUA 3O33A 4F52B 2ECIA 1FBVA 3HCUA 2L5UA 3IHPA 2C2LA 2F6NA 2M85A 1Z2QA 2YURA 3U5OA 2YSJA 2ECGA 2D8SA 3MHSA 4PPEA 2CSZA 2VJFA 4YBMA 3RPGC 3NG2A 2M1RA 1XWHA 2KWJA 5H9MA 3ZVYA 3GL6A 2KWKA 2M3HA 2XEUA 2KU3A 4CCGX 5FEYA 2PNXA 5H1TA 3EB5A 2G43A 3O37A 4R8PK 2ECNA 2VJEA 4CA1A 2ECWA 2VPDA 3HCTA 1WEVA 2ECTA 2LGKA 3N9NA 4O64A 2KIZA 4LKAA 5C11A 2VPBA 4ZUXU 4AYCB 4R2YA 3SHBA 3U5NA 5FB1A 5G0FA 4A0CD 2LDRA 2VJEB 4YATA 5KH3A 3N9MA 2YUCA 2MNZA 4R7EA 2FUIA 2LGLA 3U5PA 5LCWB 2KREA 4UP5A 1FP0A 2LN0A 4L58A 5TDRA 1Z60A 1DVPA 2EA6A 2UZGA 2MA5A 2Y1NA 4V3LC 2BAYA 2XB1A 4AP4A 2ECJA 4ZQLA 2I50A 5FERA 3T6RA 2F42A 4IC3A 5B78A 1N87A 4FJCA 3KV6A 5LKUA 4GNDA 2NAAA 2ZETC 5TDWA 2MIQA 3SOXA 5DINA 1HYJA 2E6SA 2DX8A 3C5KA 3LRQA 2VPGA 5B79A 2PUYA 4AUQB 2MUMA 4MVTA 4MSXA 3RTRB 2IDAA 2G6QA 2AN6A 1WEWA 5TRBA 3LQHA 1WEPA 3ZTGA 4S3OB 4LJNA 3GV4A 3KNVA 3M63A 2LXPC 2L80A 2LQ6A 4QF2A 2YT5A 2EODA 1F62A 4LADB 5EYAF 2KGIA 1WILA 4FK5A 1V87A 3PURA 3O70A 2E6RA 3ZPV1 5H1UA 2ECVA 2MA6A 4S3OC 3ASLA 2LRIC 2LGGA 1WEMA 4UI9B 2VJFB 5B75A 1WESA 2K1JA 2JMJA 4XI1A 2CKLA 2MNYA 2KE1A 1X4UA 1HYIA 5TABA 1LDKC 5C13A 2FUUA 2YHOA 3KQIA 1MM2A 3L1XA 3M99A 3L1ZB 5JG6A 3N9LA 4P5OB 2L0BA 1WEQA 3ZVZB 1Z6UA 3O34A 1CHCA 2EGPA 3L11A 4I7BA 2HYED 2M6MA 3ZPVE 2L75A 2LV9A 4W4UA 1WIMA 2MD7B 4X3GA 2KWOA 1WFKA 3PHDA 2LGVA 5D1LB 5B76A 4YBTA 3DQVR 4NN2A 3M62A 4QF3A 2KWNA 2JMDA 1JOCA 4GNEA 2RSDA 2YQLA 2G45A 4Q6FA 4B86C 3V43A 2LXHC 3N9OA 2K17A 4AVXA 5B8DA 2K16A 4FIPA 3HCSA 4TKPB 4N3WA 2YU4A 2QICA 4GNGA 5LKXA 4V3KC 1T1HA 1WEOA 2YHNA 4L7XA 4WZ0A 3DPLR 4BHWA 2MT5A 3O36A 4YBSA 3QZVA 3RPGB 1VD4A 1JM7A 2Y43A 5H1VA 2YW8A 2QIZA 1WEEA 1X4JA 3ZNIA 2VP7A 2K4DA 4GB0A 2KFTA 4A49A 1VFYA 4I7CA 3N9QA 2YSMA 2YQMA 3N9PA 2F6JA 4I7DA 5LKTA 1JM7B 4FO9A 4YAXA 2YREA 1MM3A 2VNFA 5D1MB 3PUQA 2C2VS 4IC2A 1WGMA 3SOUA 3KV5A 2VPEA 5KH9A 2Y1MA 1WENA 3LQIA 4YADA 4WA6A 1VYXA 2FSAA 5G04B 1LDJB 3O7AA 2CSYA 4ZDTA 3HTKC 3MHHA 3FL2A 5B77A 4BBQA 2L43A 2CKLB 2OXQC 2MD8C 2HDPA 3SOWA 3VK6A 4A4CA 1WE9A 3LQJA 4LLBA 5LKZA 1U6GB 3EB6A 1RMDA 2H0DA 3T7LA 4B7YC 2JRJA 5J3XA 2YYRA 2KR4A 5I3LA 4WZ2A 3C6WA 4YC9A 4AYCA 1G25A 3I2DA 1ZBDB 1X4IA 2JMIA 2RI7A 1BORA 5AITA 4UP0A 4A4BA 2KGGA 2CT2A 4C9ZA 5TBNA 4PTBA 1E4UA 4N4FA 5DKAA 2H0DB 5KH7A 1WEUA 5AIUA 4LK9A 4YABA 2QJ0A 1K2FA 5G05B 4GNFA 1IYMA 3U5MA 3ZYQA 4WZ3B 5FB0A 5D1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O35 A;  2KYU A;  3O33 A;  4F52 B;  2ECI A;  1FBV A;  3HCU A;  2L5U A;  3IHP A;  2C2L A;  2F6N A;  2M85 A;  1Z2Q A;  2YUR A;  3U5O A;  2YSJ A;  2ECG A;  2D8S A;  3MHS A;  4PPE A;  2CSZ A;  2VJF A;  4YBM A;  3RPG C;  3NG2 A;  2M1R A;  1XWH A;  2KWJ A;  5H9M A;  3ZVY A;  3GL6 A;  2KWK A;  2M3H A;  2XEU A;  2KU3 A;  4CCG X;  5FEY A;  2PNX A;  5H1T A;  3EB5 A;  2G43 A;  3O37 A;  4R8P K;  2ECN A;  2VJE A;  4CA1 A;  2ECW A;  2VPD A;  3HCT A;  1WEV A;  2ECT A;  2LGK A;  3N9N A;  4O64 A;  2KIZ A;  4LKA A;  5C11 A;  2VPB A;  4ZUX U;  4AYC B;  4R2Y A;  3SHB A;  3U5N A;  5FB1 A;  5G0F A;  4A0C D;  2LDR A;  2VJE B;  4YAT A;  5KH3 A;  3N9M A;  2YUC A;  2MNZ A;  4R7E A;  2FUI A;  2LGL A;  3U5P A;  5LCW B;  2KRE A;  4UP5 A;  1FP0 A;  2LN0 A;  4L58 A;  5TDR A;  1Z60 A;  1DVP A;  2EA6 A;  2UZG A;  2MA5 A;  2Y1N A;  4V3L C;  2BAY A;  2XB1 A;  4AP4 A;  2ECJ A;  4ZQL A;  2I50 A;  5FER A;  3T6R A;  2F42 A;  4IC3 A;  5B78 A;  1N87 A;  4FJC A;  3KV6 A;  5LKU A;  4GND A;  2NAA A;  2ZET C;  5TDW A;  2MIQ A;  3SOX A;  5DIN A;  1HYJ A;  2E6S A;  2DX8 A;  3C5K A;  3LRQ A;  2VPG A;  5B79 A;  2PUY A;  4AUQ B;  2MUM A;  4MVT A;  4MSX A;  3RTR B;  2IDA A;  2G6Q A;  2AN6 A;  1WEW A;  5TRB A;  3LQH A;  1WEP A;  3ZTG A;  4S3O B;  4LJN A;  3GV4 A;  3KNV A;  3M63 A;  2LXP C;  2L80 A;  2LQ6 A;  4QF2 A;  2YT5 A;  2EOD A;  1F62 A;  4LAD B;  5EYA F;  2KGI A;  1WIL A;  4FK5 A;  1V87 A;  3PUR A;  3O70 A;  2E6R A;  3ZPV 1;  5H1U A;  2ECV A;  2MA6 A;  4S3O C;  3ASL A;  2LRI C;  2LGG A;  1WEM A;  4UI9 B;  2VJF B;  5B75 A;  1WES A;  2K1J A;  2JMJ A;  4XI1 A;  2CKL A;  2MNY A;  2KE1 A;  1X4U A;  1HYI A;  5TAB A;  1LDK C;  5C13 A;  2FUU A;  2YHO A;  3KQI A;  1MM2 A;  3L1X A;  3M99 A;  3L1Z B;  5JG6 A;  3N9L A;  4P5O B;  2L0B A;  1WEQ A;  3ZVZ B;  1Z6U A;  3O34 A;  1CHC A;  2EGP A;  3L11 A;  4I7B A;  2HYE D;  2M6M A;  3ZPV E;  2L75 A;  2LV9 A;  4W4U A;  1WIM A;  2MD7 B;  4X3G A;  2KWO A;  1WFK A;  3PHD A;  2LGV A;  5D1L B;  5B76 A;  4YBT A;  3DQV R;  4NN2 A;  3M62 A;  4QF3 A;  2KWN A;  2JMD A;  1JOC A;  4GNE A;  2RSD A;  2YQL A;  2G45 A;  4Q6F A;  4B86 C;  3V43 A;  2LXH C;  3N9O A;  2K17 A;  4AVX A;  5B8D A;  2K16 A;  4FIP A;  3HCS A;  4TKP B;  4N3W A;  2YU4 A;  2QIC A;  4GNG A;  5LKX A;  4V3K C;  1T1H A;  1WEO A;  2YHN A;  4L7X A;  4WZ0 A;  3DPL R;  4BHW A;  2MT5 A;  3O36 A;  4YBS A;  3QZV A;  3RPG B;  1VD4 A;  1JM7 A;  2Y43 A;  5H1V A;  2YW8 A;  2QIZ A;  1WEE A;  1X4J A;  3ZNI A;  2VP7 A;  2K4D A;  4GB0 A;  2KFT A;  4A49 A;  1VFY A;  4I7C A;  3N9Q A;  2YSM A;  2YQM A;  3N9P A;  2F6J A;  4I7D A;  5LKT A;  1JM7 B;  4FO9 A;  4YAX A;  2YRE A;  1MM3 A;  2VNF A;  5D1M B;  3PUQ A;  2C2V S;  4IC2 A;  1WGM A;  3SOU A;  3KV5 A;  2VPE A;  5KH9 A;  2Y1M A;  1WEN A;  3LQI A;  4YAD A;  4WA6 A;  1VYX A;  2FSA A;  5G04 B;  1LDJ B;  3O7A A;  2CSY A;  4ZDT A;  3HTK C;  3MHH A;  3FL2 A;  5B77 A;  4BBQ A;  2L43 A;  2CKL B;  2OXQ C;  2MD8 C;  2HDP A;  3SOW A;  3VK6 A;  4A4C A;  1WE9 A;  3LQJ A;  4LLB A;  5LKZ A;  1U6G B;  3EB6 A;  1RMD A;  2H0D A;  3T7L A;  4B7Y C;  2JRJ A;  5J3X A;  2YYR A;  2KR4 A;  5I3L A;  4WZ2 A;  3C6W A;  4YC9 A;  4AYC A;  1G25 A;  3I2D A;  1ZBD B;  1X4I A;  2JMI A;  2RI7 A;  1BOR A;  5AIT A;  4UP0 A;  4A4B A;  2KGG A;  2CT2 A;  4C9Z A;  5TBN A;  4PTB A;  1E4U A;  4N4F A;  5DKA A;  2H0D B;  5KH7 A;  1WEU A;  5AIU A;  4LK9 A;  4YAB A;  2QJ0 A;  1K2F A;  5G05 B;  4GNF A;  1IYM A;  3U5M A;  3ZYQ A;  4WZ3 B;  5FB0 A;  5D1K B; 
#chains in the Genus database with same CATH topology
 3O35 A;  2KYU A;  3O33 A;  4F52 B;  2XOC A;  2ECI A;  3E2D A;  1FBV A;  3HCU A;  2L5U A;  3IHP A;  2C2L A;  2L7P A;  3DWD A;  2F6N A;  2M85 A;  1Z2Q A;  2YUR A;  3U5O A;  2P57 A;  2YSJ A;  2ECG A;  2D8S A;  2CRW A;  3M7K A;  3MHS A;  4PPE A;  2CSZ A;  2VJF A;  4YBM A;  3RPG C;  3NG2 A;  2M1R A;  1XWH A;  2KWJ A;  5H9M A;  2M13 A;  3ZVY A;  3GL6 A;  2KWK A;  2M3H A;  2XEU A;  2KU3 A;  4CCG X;  5FEY A;  2PNX A;  5H1T A;  3EB5 A;  2G43 A;  3O37 A;  4R8P K;  2ECN A;  2VJE A;  4CA1 A;  2ECW A;  2VPD A;  3HCT A;  1WEV A;  2EXU A;  2ECT A;  2LGK A;  3N9N A;  4O64 A;  2KIZ A;  4LKA A;  5C11 A;  2VPB A;  4ZUX U;  4AYC B;  4R2Y A;  3SHB A;  3U5N A;  5FB1 A;  5G0F A;  4A0C D;  2JUN A;  4Z0O A;  2LDR A;  2VJE B;  4YAT A;  5KH3 A;  3N9M A;  2YUC A;  2MNZ A;  4R7E A;  2FUI A;  2LGL A;  3U5P A;  5LCW B;  2KRE A;  4UP5 A;  1FP0 A;  2LN0 A;  4L58 A;  5TDR A;  1Z60 A;  1DVP A;  2EA6 A;  2UZG A;  2MA5 A;  2Y1N A;  4V3L C;  2BAY A;  2XB1 A;  4AP4 A;  3PLW A;  5SVX A;  2ECJ A;  2B0O E;  4ZQL A;  2I50 A;  5FER A;  3T6R A;  2F42 A;  4IC3 A;  5B78 A;  1N87 A;  4FJC A;  3KV6 A;  5LKU A;  4GND A;  2NAA A;  3H7H A;  2ZET C;  5TDW A;  2MIQ A;  3SOX A;  5DIN A;  1HYJ A;  2E6S A;  2DX8 A;  3C5K A;  3LRQ A;  2VPG A;  5B79 A;  2PUY A;  4AUQ B;  2MUM A;  4MVT A;  4MSX A;  1MBM A;  3RTR B;  2IQJ A;  2IDA A;  2G6Q A;  2AN6 A;  1WEW A;  5TRB A;  3FAN A;  3LQH A;  1WEP A;  4F1P A;  3ZTG A;  4H9D A;  4S3O B;  4O62 A;  4LJN A;  3GV4 A;  3KNV A;  3M63 A;  2LXP C;  2L80 A;  2LQ6 A;  3DDT A;  4QF2 A;  2YT5 A;  5SVI A;  2EOD A;  1F62 A;  4LAD B;  5EYA F;  2KGI A;  1WIL A;  4FK5 A;  1V87 A;  3PUR A;  3O70 A;  2E6R A;  3ZPV 1;  3LDY A;  5H1U A;  2ECV A;  2MA6 A;  4S3O C;  3ASL A;  2LRI C;  2LGG A;  3FEH A;  1WEM A;  2OWA A;  2LAU A;  2VJF B;  4UI9 B;  5B75 A;  1WES A;  2D8U A;  2K1J A;  2JMJ A;  4XI1 A;  2CKL A;  2MNY A;  2KE1 A;  1X4U A;  1HYI A;  5TAB A;  1LDK C;  5C13 A;  2FUU A;  2XP0 A;  2YHO A;  3KQI A;  1MM2 A;  3L1X A;  3M99 A;  3L1Z B;  5JG6 A;  3N9L A;  4P5O B;  2L0B A;  1WEQ A;  3ZVZ B;  1Z6U A;  3O34 A;  1CHC A;  4Z0R A;  3FM8 C;  2EGP A;  3L11 A;  4I7B A;  2CSV A;  2HYE D;  2M6M A;  3ZPV E;  2L75 A;  2LV9 A;  4W4U A;  2CRR A;  1WIM A;  2MD7 B;  4X3G A;  2KWO A;  2JM3 A;  3MDB C;  1WFK A;  3PHD A;  2LGV A;  2CON A;  5D1L B;  5B76 A;  4YBT A;  3DQV R;  4NN2 A;  3M62 A;  4QF3 A;  3LJU X;  2KWN A;  2JMD A;  1JOC A;  4GNE A;  2RSD A;  2YQL A;  2G45 A;  3T9K A;  4Q6F A;  3KDE C;  2DSM A;  4B86 C;  3V43 A;  2LXH C;  3N9O A;  2K17 A;  4AVX A;  5B8D A;  2FD4 A;  2K16 A;  2RR4 A;  3LVR E;  3HCS A;  4FIP A;  3SUB A;  4N3W A;  4TKP B;  3FJU B;  2YU4 A;  1DCQ A;  2QIC A;  4GNG A;  5LKX A;  3LVQ E;  4OGE A;  1T1H A;  4V3K C;  1WEO A;  4QQ4 A;  2YHN A;  4L7X A;  4WZ0 A;  3JUE A;  3DPL R;  4BHW A;  2MT5 A;  3O36 A;  4YBS A;  3QZV A;  3RPG B;  1VD4 A;  1JM7 A;  2EGM A;  2Y43 A;  5SVY A;  5H1V A;  2YW8 A;  2QIZ A;  3FAO A;  1WEE A;  2XOY A;  1X4J A;  3ZNI A;  2VP7 A;  2K4D A;  4GB0 A;  2KFT A;  2XOZ A;  4A49 A;  2DJA A;  1VFY A;  4I7C A;  3N9Q A;  2YSM A;  2YQM A;  3N9P A;  2F6J A;  4I7D A;  5LKT A;  1JM7 B;  4FO9 A;  4YAX A;  2YRE A;  1MM3 A;  2VNF A;  5D1M B;  5SVI B;  3PUQ A;  2C2V S;  4IC2 A;  1WGM A;  3SOU A;  3KV5 A;  2VPE A;  5KH9 A;  2Y1M A;  1WEN A;  3LQI A;  4YAD A;  4WA6 A;  2E61 A;  5K3Q A;  1VYX A;  2FSA A;  2YVR A;  5G04 B;  1LDJ B;  3O7A A;  2CSY A;  3ZYQ A;  4ZDT A;  3HTK C;  3MHH A;  3FL2 A;  5B77 A;  4BBQ A;  2L43 A;  2CKL B;  2OXQ C;  2MD8 C;  2HDP A;  3SOW A;  3VK6 A;  4A4C A;  1WE9 A;  3LQJ A;  4LLB A;  5LKZ A;  1U6G B;  3EB6 A;  1RMD A;  2H0D A;  3T7L A;  4B7Y C;  2FFW A;  2JRJ A;  2MKE A;  5J3X A;  2YYR A;  2KR4 A;  5I3L A;  4WZ2 A;  3C6W A;  4YC9 A;  4AYC A;  1G25 A;  3I2D A;  1ZBD B;  4OGC A;  1X4I A;  2JMI A;  2RI7 A;  1BOR A;  5AIT A;  4UP0 A;  4A4B A;  2KGG A;  3O47 A;  2CT2 A;  3Q1D A;  2KKX A;  4C9Z A;  5TBN A;  4PTB A;  1E4U A;  4N4F A;  5DKA A;  2H0D B;  5KH7 A;  1WEU A;  5AIU A;  4LK9 A;  4YAB A;  2QJ0 A;  1K2F A;  5G05 B;  4GNF A;  1IYM A;  3U5M A;  2KKY A;  4WZ3 B;  5FB0 A;  5D1K B; 
#chains in the Genus database with same CATH homology
 3O35 A;  2KYU A;  3O33 A;  4F52 B;  2ECI A;  1FBV A;  3HCU A;  2L5U A;  3IHP A;  2C2L A;  2F6N A;  2M85 A;  1Z2Q A;  2YUR A;  3U5O A;  2YSJ A;  2ECG A;  2D8S A;  3MHS A;  4PPE A;  2CSZ A;  2VJF A;  4YBM A;  3RPG C;  3NG2 A;  2M1R A;  1XWH A;  2KWJ A;  5H9M A;  3ZVY A;  3GL6 A;  2KWK A;  2M3H A;  2XEU A;  2KU3 A;  4CCG X;  5FEY A;  2PNX A;  5H1T A;  3EB5 A;  2G43 A;  3O37 A;  4R8P K;  2ECN A;  2VJE A;  4CA1 A;  2ECW A;  2VPD A;  3HCT A;  1WEV A;  2ECT A;  2LGK A;  3N9N A;  4O64 A;  2KIZ A;  4LKA A;  5C11 A;  2VPB A;  4ZUX U;  4AYC B;  4R2Y A;  3SHB A;  3U5N A;  5FB1 A;  5G0F A;  4A0C D;  2LDR A;  2VJE B;  4YAT A;  5KH3 A;  3N9M A;  2YUC A;  2MNZ A;  4R7E A;  2FUI A;  2LGL A;  3U5P A;  5LCW B;  2KRE A;  4UP5 A;  1FP0 A;  2LN0 A;  4L58 A;  5TDR A;  1Z60 A;  1DVP A;  2EA6 A;  2UZG A;  2MA5 A;  2Y1N A;  4V3L C;  2BAY A;  2XB1 A;  4AP4 A;  2ECJ A;  4ZQL A;  2I50 A;  5FER A;  3T6R A;  2F42 A;  4IC3 A;  5B78 A;  1N87 A;  4FJC A;  3KV6 A;  5LKU A;  4GND A;  2NAA A;  2ZET C;  5TDW A;  2MIQ A;  3SOX A;  5DIN A;  1HYJ A;  2E6S A;  2DX8 A;  3C5K A;  3LRQ A;  2VPG A;  5B79 A;  2PUY A;  4AUQ B;  2MUM A;  4MVT A;  4MSX A;  3RTR B;  2IDA A;  2G6Q A;  2AN6 A;  1WEW A;  5TRB A;  3LQH A;  1WEP A;  3ZTG A;  4S3O B;  4LJN A;  3GV4 A;  3KNV A;  3M63 A;  2LXP C;  2L80 A;  2LQ6 A;  4QF2 A;  2YT5 A;  2EOD A;  1F62 A;  4LAD B;  5EYA F;  2KGI A;  1WIL A;  4FK5 A;  1V87 A;  3PUR A;  3O70 A;  2E6R A;  3ZPV 1;  5H1U A;  2ECV A;  2MA6 A;  4S3O C;  3ASL A;  2LRI C;  2LGG A;  1WEM A;  4UI9 B;  2VJF B;  5B75 A;  1WES A;  2K1J A;  2JMJ A;  4XI1 A;  2CKL A;  2MNY A;  2KE1 A;  1X4U A;  1HYI A;  5TAB A;  1LDK C;  5C13 A;  2FUU A;  2YHO A;  3KQI A;  1MM2 A;  3L1X A;  3M99 A;  3L1Z B;  5JG6 A;  3N9L A;  4P5O B;  2L0B A;  1WEQ A;  3ZVZ B;  1Z6U A;  3O34 A;  1CHC A;  2EGP A;  3L11 A;  4I7B A;  2HYE D;  2M6M A;  3ZPV E;  2L75 A;  2LV9 A;  4W4U A;  1WIM A;  2MD7 B;  4X3G A;  2KWO A;  1WFK A;  3PHD A;  2LGV A;  5D1L B;  5B76 A;  4YBT A;  3DQV R;  4NN2 A;  3M62 A;  4QF3 A;  2KWN A;  2JMD A;  1JOC A;  4GNE A;  2RSD A;  2YQL A;  2G45 A;  4Q6F A;  4B86 C;  3V43 A;  2LXH C;  3N9O A;  2K17 A;  4AVX A;  5B8D A;  2K16 A;  4FIP A;  3HCS A;  4TKP B;  4N3W A;  2YU4 A;  2QIC A;  4GNG A;  5LKX A;  4V3K C;  1T1H A;  1WEO A;  2YHN A;  4L7X A;  4WZ0 A;  3DPL R;  4BHW A;  2MT5 A;  3O36 A;  4YBS A;  3QZV A;  3RPG B;  1VD4 A;  1JM7 A;  2Y43 A;  5H1V A;  2YW8 A;  2QIZ A;  1WEE A;  1X4J A;  3ZNI A;  2VP7 A;  2K4D A;  4GB0 A;  2KFT A;  4A49 A;  1VFY A;  4I7C A;  3N9Q A;  2YSM A;  2YQM A;  3N9P A;  2F6J A;  4I7D A;  5LKT A;  1JM7 B;  4FO9 A;  4YAX A;  2YRE A;  1MM3 A;  2VNF A;  5D1M B;  3PUQ A;  2C2V S;  4IC2 A;  1WGM A;  3SOU A;  3KV5 A;  2VPE A;  5KH9 A;  2Y1M A;  1WEN A;  3LQI A;  4YAD A;  4WA6 A;  1VYX A;  2FSA A;  5G04 B;  1LDJ B;  3O7A A;  2CSY A;  4ZDT A;  3HTK C;  3MHH A;  3FL2 A;  5B77 A;  4BBQ A;  2L43 A;  2CKL B;  2OXQ C;  2MD8 C;  2HDP A;  3SOW A;  3VK6 A;  4A4C A;  1WE9 A;  3LQJ A;  4LLB A;  5LKZ A;  1U6G B;  3EB6 A;  1RMD A;  2H0D A;  3T7L A;  4B7Y C;  2JRJ A;  5J3X A;  2YYR A;  2KR4 A;  5I3L A;  4WZ2 A;  3C6W A;  4YC9 A;  4AYC A;  1G25 A;  3I2D A;  1ZBD B;  1X4I A;  2JMI A;  2RI7 A;  1BOR A;  5AIT A;  4UP0 A;  4A4B A;  2KGG A;  2CT2 A;  4C9Z A;  5TBN A;  4PTB A;  1E4U A;  4N4F A;  5DKA A;  2H0D B;  5KH7 A;  1WEU A;  5AIU A;  4LK9 A;  4YAB A;  2QJ0 A;  1K2F A;  5G05 B;  4GNF A;  1IYM A;  3U5M A;  3ZYQ A;  4WZ3 B;  5FB0 A;  5D1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...