4L7XA

Crystal structure of the dido phd finger in complex with h3k4me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dido3 PHD Modulates Cell Differentiation and Division.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, gene regulation
molecule keywords Death-inducer obliterator 1
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l7xA00
3ASLA 2L43A 2ECVA 2ECTA 5LKZA 2KWOA 5LKXA 2QJ0A 1Z6UA 4GNFA 3T6RA 1IYMA 2MA5A 3C6WA 1X4UA 1WEEA 4I7CA 1HYJA 4V3LC 4FIPA 3GL6A 3LQHA 2VJFB 3LQJA 3KV5A 3N9MA 1WEWA 4MSXA 1BORA 1XWHA 4C9ZA 4A4BA 2L80A 4N3WA 1WEPA 3N9OA 3M99A 4PPEA 4YABA 3IHPA 2ECIA 2LQ6A 3L1ZB 1X4IA 2M3HA 5H1TA 4V3KC 3ZPVE 4AYCA 3PUQA 2M85A 1WEMA 5H9MA 4R2YA 4YADA 1FBVA 4ZUXU 4O64A 2YQLA 3U5MA 2ECWA 4YBSA 5LKUA 5LKTA 5KH9A 5D1KB 3V43A 4I7DA 4N4FA 4IC3A 2KWJA 3HCTA 5AITA 2C2VS 5EYAF 2YSJA 1Z2QA 2MIQA 5B79A 2JRJA 4F52B 2M1RA 1ZBDB 2KREA 1FP0A 1WEQA 2CT2A 2EGPA 3MHHA 2VPGA 2ECGA 2KYUA 2D8SA 4A0CD 4GNGA 2C2LA 3PURA 1WEUA 1CHCA 2LGGA 1VD4A 2CKLA 4TKPB 5B78A 2VPEA 1VYXA 2BAYA 2EODA 2CSZA 3U5OA 3N9QA 5TBNA 1Z60A 2LDRA 3SOUA 2YW8A 3C5KA 2KU3A 5C13A 4WZ0A 2VJEB 2Y43A 4XI1A 1JM7A 2MT5A 2UZGA 4BBQA 3ZNIA 3U5NA 1JOCA 1MM2A 1WENA 5B76A 4YC9A 2AN6A 2H0DA 4BHWA 3M62A 4FK5A 3O35A 5G0FA 2OXQC 2YREA 2MNYA 4LK9A 3LRQA 1N87A 5FB1A 2KFTA 2KGGA 2KWKA 4UP0A 1WE9A 1WILA 2ECJA 2LRIC 3U5PA 2K16A 3I2DA 2Y1NA 2LGKA 4S3OC 5B8DA 4R7EA 3RPGC 5B77A 4PTBA 1DVPA 1G25A 3GV4A 3O36A 3SHBA 4AYCB 3L11A 3DQVR 4P5OB 2YHOA 2E6SA 2VPDA 2KWNA 1LDKC 2PUYA 4CCGX 2JMJA 4UP5A 5G05B 4NN2A 3N9LA 2XB1A 2QICA 3DPLR 3EB6A 4YBTA 3ZVYA 5C11A 2YSMA 4I7BA 2Y1MA 2JMIA 1U6GB 1WEVA 2YURA 1WFKA 5B75A 3T7LA 4AUQB 3O33A 1T1HA 4QF3A 3L1XA 4UI9B 2KGIA 4ZQLA 2LXPC 1X4JA 4YAXA 2ZETC 4L58A 2K17A 1WEOA 4IC2A 1F62A 2KE1A 1MM3A 4Q6FA 2MNZA 3N9NA 4B86C 5KH7A 2K4DA 5J3XA 2I50A 4QF2A 2QIZA 3ZYQA 3O37A 2NAAA 5JG6A 3O7AA 3ZPV1 5H1UA 2L75A 3O70A 1HYIA 2FUUA 3O34A 2YYRA 4WA6A 2XEUA 4GB0A 1V87A 3KNVA 4X3GA 2G43A 2HDPA 3ZVZB 5TABA 3LQIA 2LXHC 2LGVA 4B7YC 2ECNA 5FEYA 5DKAA 4WZ3B 3RTRB 2PNXA 2IDAA 2VJFA 2G45A 2KIZA 5D1MB 2MA6A 3QZVA 4YATA 3FL2A 4LLBA 4CA1A 2LGLA 1RMDA 5H1VA 3M63A 2HYED 1VFYA 2KR4A 4S3OB 5KH3A 4GNEA 1K2FA 3HCSA 4FJCA 2F6NA 5I3LA 2L0BA 4A4CA 2DX8A 3NG2A 3HCUA 5TRBA 3VK6A 5FB0A 2E6RA 4ZDTA 2VNFA 4A49A 3RPGB 3KQIA 3PHDA 2LV9A 2M6MA 2VPBA 2FSAA 4FO9A 2YHNA 3KV6A 2EA6A 2RSDA 2G6QA 5TDWA 4WZ2A 2MD8C 3EB5A 1WESA 4R8PK 4LKAA 2F42A 2F6JA 4GNDA 4W4UA 5G04B 5AIUA 2MD7B 2VP7A 5FERA 1LDJB 3MHSA 4LADB 2VJEA 2YQMA 2CSYA 2K1JA 2YT5A 1JM7B 2YU4A 5TDRA 4YBMA 3SOXA 2YUCA 3HTKC 2CKLB 2H0DB 1WIMA 4AP4A 5LCWB 2JMDA 4MVTA 1WGMA 4L7XA 3ZTGA 4LJNA 2FUIA 5D1LB 2MUMA 3N9PA 3SOWA 2LN0A 4AVXA 1E4UA 2L5UA 2RI7A 5DINA
chains in the Genus database with same CATH superfamily
2FFWA 3ASLA 2L43A 2ECVA 2ECTA 5LKZA 2KWOA 5LKXA 2B0OE 2QJ0A 1Z6UA 4GNFA 3T6RA 1IYMA 4O62A 2MA5A 3C6WA 1X4UA 1WEEA 4I7CA 1HYJA 4V3LC 2XP0A 4FIPA 3GL6A 3LQHA 2VJFB 3LQJA 2EGMA 3KV5A 3N9MA 1WEWA 4MSXA 1BORA 1XWHA 4C9ZA 4A4BA 2L80A 4N3WA 3PLWA 1WEPA 3N9OA 3M99A 4PPEA 4YABA 2YVRA 3IHPA 2MKEA 2ECIA 2JUNA 3L1ZB 2LQ6A 1X4IA 2M3HA 5H1TA 2FD4A 4V3KC 3ZPVE 4AYCA 3PUQA 2JM3A 2M85A 3FAOA 1WEMA 2LAUA 5H9MA 3Q1DA 4R2YA 4YADA 1FBVA 4ZUXU 4O64A 2YQLA 3U5MA 2ECWA 4YBSA 2DSMA 5LKUA 5LKTA 5KH9A 5D1KB 3V43A 4I7DA 4N4FA 4IC3A 2KWJA 3HCTA 5AITA 2C2VS 5EYAF 2YSJA 1Z2QA 2MIQA 5B79A 2JRJA 4F52B 2M1RA 1ZBDB 2KREA 3DDTA 1FP0A 1WEQA 1DCQA 2CT2A 2EGPA 3MHHA 2VPGA 3FANA 2ECGA 3DWDA 2KYUA 2D8SA 4A0CD 4GNGA 2C2LA 3PURA 1WEUA 1CHCA 2LGGA 1VD4A 2CKLA 4TKPB 5B78A 2VPEA 1VYXA 2BAYA 2EODA 2CSZA 3U5OA 3N9QA 5TBNA 3T9KA 3LDYA 1Z60A 2LDRA 3SOUA 2YW8A 3C5KA 2KU3A 5C13A 4WZ0A 2VJEB 2Y43A 4XI1A 4F1PA 3H7HA 3KDEC 5K3QA 1JM7A 4Z0RA 2MT5A 2UZGA 2RR4A 4BBQA 3ZNIA 3U5NA 1JOCA 2P57A 1MM2A 1WENA 5B76A 4YC9A 2AN6A 2H0DA 4BHWA 4FK5A 3M62A 3O35A 5G0FA 2OXQC 2YREA 2MNYA 4LK9A 3LRQA 1N87A 5FB1A 2KFTA 2KGGA 2KWKA 4UP0A 2KKYA 1WE9A 1WILA 5SVIA 2ECJA 2LRIC 3U5PA 2K16A 3I2DA 2Y1NA 2LGKA 2M13A 4S3OC 5B8DA 4R7EA 3RPGC 2XOYA 5B77A 2XOCA 4PTBA 1DVPA 1G25A 3GV4A 3O36A 3SHBA 4AYCB 3L11A 3DQVR 4P5OB 2YHOA 2E6SA 2VPDA 2KWNA 1LDKC 2PUYA 4CCGX 2JMJA 4UP5A 5G05B 4NN2A 4OGCA 2D8UA 3N9LA 2XB1A 3FM8C 2QICA 3DPLR 3EB6A 3LJUX 4YBTA 3ZVYA 5C11A 2YSMA 4I7BA 2Y1MA 2JMIA 1U6GB 1WEVA 2YURA 1WFKA 5B75A 3T7LA 4AUQB 3O33A 2IQJA 1T1HA 2DJAA 3FEHA 4QF3A 3L1XA 4UI9B 2KGIA 4ZQLA 5SVIB 4QQ4A 2LXPC 1X4JA 4YAXA 2ZETC 4L58A 2K17A 1WEOA 4IC2A 1F62A 2KE1A 1MM3A 5SVYA 4Q6FA 2MNZA 3N9NA 2CONA 4B86C 5KH7A 2K4DA 5J3XA 2I50A 4QF2A 2QIZA 3ZYQA 3O37A 2NAAA 5JG6A 3O7AA 3JUEA 3ZPV1 5H1UA 2L75A 3O70A 1HYIA 2FUUA 3O34A 4Z0OA 2YYRA 4WA6A 2XEUA 4GB0A 1V87A 3KNVA 4X3GA 2G43A 2HDPA 3ZVZB 5TABA 3LQIA 2LXHC 2LGVA 2CSVA 4B7YC 2EXUA 2ECNA 5FEYA 2L7PA 5DKAA 4WZ3B 3RTRB 2PNXA 2IDAA 2VJFA 4OGEA 2G45A 1MBMA 2KIZA 5D1MB 2MA6A 3QZVA 4YATA 3FL2A 4LLBA 4CA1A 2LGLA 3SUBA 1RMDA 5H1VA 3M63A 2HYED 2OWAA 1VFYA 2KR4A 4S3OB 5KH3A 4GNEA 1K2FA 3HCSA 4FJCA 2F6NA 5I3LA 2L0BA 4A4CA 2DX8A 3NG2A 3HCUA 5TRBA 3VK6A 5FB0A 2E6RA 4ZDTA 2VNFA 4A49A 3RPGB 3KQIA 3PHDA 2LV9A 2M6MA 2VPBA 2FSAA 2KKXA 4FO9A 3MDBC 2YHNA 3KV6A 2EA6A 2RSDA 2G6QA 5TDWA 4WZ2A 2MD8C 5SVXA 3LVQE 3EB5A 1WESA 4R8PK 4LKAA 2F42A 2F6JA 4GNDA 4W4UA 5G04B 3E2DA 5AIUA 2MD7B 2VP7A 5FERA 1LDJB 3MHSA 4LADB 2VJEA 2YQMA 2CSYA 2K1JA 2YT5A 1JM7B 2YU4A 3LVRE 5TDRA 2CRRA 2E61A 4YBMA 3SOXA 2YUCA 3FJUB 3HTKC 2CKLB 2H0DB 1WIMA 4AP4A 5LCWB 2CRWA 2JMDA 4MVTA 1WGMA 4L7XA 3ZTGA 4LJNA 2FUIA 5D1LB 2XOZA 2MUMA 3N9PA 3SOWA 2LN0A 4AVXA 3O47A 1E4UA 4H9DA 2L5UA 3M7KA 2RI7A 5DINA
chains in the Genus database with same CATH topology
3ASLA 2L43A 2ECVA 2ECTA 5LKZA 2KWOA 5LKXA 2QJ0A 1Z6UA 4GNFA 3T6RA 1IYMA 2MA5A 3C6WA 1X4UA 1WEEA 4I7CA 1HYJA 4V3LC 4FIPA 3GL6A 3LQHA 2VJFB 3LQJA 3KV5A 3N9MA 1WEWA 4MSXA 1BORA 1XWHA 4C9ZA 4A4BA 2L80A 4N3WA 1WEPA 3N9OA 3M99A 4PPEA 4YABA 3IHPA 2ECIA 2LQ6A 3L1ZB 1X4IA 2M3HA 5H1TA 4V3KC 3ZPVE 4AYCA 3PUQA 2M85A 1WEMA 5H9MA 4R2YA 4YADA 1FBVA 4ZUXU 4O64A 2YQLA 3U5MA 2ECWA 4YBSA 5LKUA 5LKTA 5KH9A 5D1KB 3V43A 4I7DA 4N4FA 4IC3A 2KWJA 3HCTA 5AITA 2C2VS 5EYAF 2YSJA 1Z2QA 2MIQA 5B79A 2JRJA 4F52B 2M1RA 1ZBDB 2KREA 1FP0A 1WEQA 2CT2A 2EGPA 3MHHA 2VPGA 2ECGA 2KYUA 2D8SA 4A0CD 4GNGA 2C2LA 3PURA 1WEUA 1CHCA 2LGGA 1VD4A 2CKLA 4TKPB 5B78A 2VPEA 1VYXA 2BAYA 2EODA 2CSZA 3U5OA 3N9QA 5TBNA 1Z60A 2LDRA 3SOUA 2YW8A 3C5KA 2KU3A 5C13A 4WZ0A 2VJEB 2Y43A 4XI1A 1JM7A 2MT5A 2UZGA 4BBQA 3ZNIA 3U5NA 1JOCA 1MM2A 1WENA 5B76A 4YC9A 2AN6A 2H0DA 4BHWA 3M62A 4FK5A 3O35A 5G0FA 2OXQC 2YREA 2MNYA 4LK9A 3LRQA 1N87A 5FB1A 2KFTA 2KGGA 2KWKA 4UP0A 1WE9A 1WILA 2ECJA 2LRIC 3U5PA 2K16A 3I2DA 2Y1NA 2LGKA 4S3OC 5B8DA 4R7EA 3RPGC 5B77A 4PTBA 1DVPA 1G25A 3GV4A 3O36A 3SHBA 4AYCB 3L11A 3DQVR 4P5OB 2YHOA 2E6SA 2VPDA 2KWNA 1LDKC 2PUYA 4CCGX 2JMJA 4UP5A 5G05B 4NN2A 3N9LA 2XB1A 2QICA 3DPLR 3EB6A 4YBTA 3ZVYA 5C11A 2YSMA 4I7BA 2Y1MA 2JMIA 1U6GB 1WEVA 2YURA 1WFKA 5B75A 3T7LA 4AUQB 3O33A 1T1HA 4QF3A 3L1XA 4UI9B 2KGIA 4ZQLA 2LXPC 1X4JA 4YAXA 2ZETC 4L58A 2K17A 1WEOA 4IC2A 1F62A 2KE1A 1MM3A 4Q6FA 2MNZA 3N9NA 4B86C 5KH7A 2K4DA 5J3XA 2I50A 4QF2A 2QIZA 3ZYQA 3O37A 2NAAA 5JG6A 3O7AA 3ZPV1 5H1UA 2L75A 3O70A 1HYIA 2FUUA 3O34A 2YYRA 4WA6A 2XEUA 4GB0A 1V87A 3KNVA 4X3GA 2G43A 2HDPA 3ZVZB 5TABA 3LQIA 2LXHC 2LGVA 4B7YC 2ECNA 5FEYA 5DKAA 4WZ3B 3RTRB 2PNXA 2IDAA 2VJFA 2G45A 2KIZA 5D1MB 2MA6A 3QZVA 4YATA 3FL2A 4LLBA 4CA1A 2LGLA 1RMDA 5H1VA 3M63A 2HYED 1VFYA 2KR4A 4S3OB 5KH3A 4GNEA 1K2FA 3HCSA 4FJCA 2F6NA 5I3LA 2L0BA 4A4CA 2DX8A 3NG2A 3HCUA 5TRBA 3VK6A 5FB0A 2E6RA 4ZDTA 2VNFA 4A49A 3RPGB 3KQIA 3PHDA 2LV9A 2M6MA 2VPBA 2FSAA 4FO9A 2YHNA 3KV6A 2EA6A 2RSDA 2G6QA 5TDWA 4WZ2A 2MD8C 3EB5A 1WESA 4R8PK 4LKAA 2F42A 2F6JA 4GNDA 4W4UA 5G04B 5AIUA 2MD7B 2VP7A 5FERA 1LDJB 3MHSA 4LADB 2VJEA 2YQMA 2CSYA 2K1JA 2YT5A 1JM7B 2YU4A 5TDRA 4YBMA 3SOXA 2YUCA 3HTKC 2CKLB 2H0DB 1WIMA 4AP4A 5LCWB 2JMDA 4MVTA 1WGMA 4L7XA 3ZTGA 4LJNA 2FUIA 5D1LB 2MUMA 3N9PA 3SOWA 2LN0A 4AVXA 1E4UA 2L5UA 2RI7A 5DINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASL A;  2L43 A;  2ECV A;  2ECT A;  5LKZ A;  2KWO A;  5LKX A;  2QJ0 A;  1Z6U A;  4GNF A;  3T6R A;  1IYM A;  2MA5 A;  3C6W A;  1X4U A;  1WEE A;  4I7C A;  1HYJ A;  4V3L C;  4FIP A;  3GL6 A;  3LQH A;  2VJF B;  3LQJ A;  3KV5 A;  3N9M A;  1WEW A;  4MSX A;  1BOR A;  1XWH A;  4C9Z A;  4A4B A;  2L80 A;  4N3W A;  1WEP A;  3N9O A;  3M99 A;  4PPE A;  4YAB A;  3IHP A;  2ECI A;  2LQ6 A;  3L1Z B;  1X4I A;  2M3H A;  5H1T A;  4V3K C;  3ZPV E;  4AYC A;  3PUQ A;  2M85 A;  1WEM A;  5H9M A;  4R2Y A;  4YAD A;  1FBV A;  4ZUX U;  4O64 A;  2YQL A;  3U5M A;  2ECW A;  4YBS A;  5LKU A;  5LKT A;  5KH9 A;  5D1K B;  3V43 A;  4I7D A;  4N4F A;  4IC3 A;  2KWJ A;  3HCT A;  5AIT A;  2C2V S;  5EYA F;  2YSJ A;  1Z2Q A;  2MIQ A;  5B79 A;  2JRJ A;  4F52 B;  2M1R A;  1ZBD B;  2KRE A;  1FP0 A;  1WEQ A;  2CT2 A;  2EGP A;  3MHH A;  2VPG A;  2ECG A;  2KYU A;  2D8S A;  4A0C D;  4GNG A;  2C2L A;  3PUR A;  1WEU A;  1CHC A;  2LGG A;  1VD4 A;  2CKL A;  4TKP B;  5B78 A;  2VPE A;  1VYX A;  2BAY A;  2EOD A;  2CSZ A;  3U5O A;  3N9Q A;  5TBN A;  1Z60 A;  2LDR A;  3SOU A;  2YW8 A;  3C5K A;  2KU3 A;  5C13 A;  4WZ0 A;  2VJE B;  2Y43 A;  4XI1 A;  1JM7 A;  2MT5 A;  2UZG A;  4BBQ A;  3ZNI A;  3U5N A;  1JOC A;  1MM2 A;  1WEN A;  5B76 A;  4YC9 A;  2AN6 A;  2H0D A;  4BHW A;  3M62 A;  4FK5 A;  3O35 A;  5G0F A;  2OXQ C;  2YRE A;  2MNY A;  4LK9 A;  3LRQ A;  1N87 A;  5FB1 A;  2KFT A;  2KGG A;  2KWK A;  4UP0 A;  1WE9 A;  1WIL A;  2ECJ A;  2LRI C;  3U5P A;  2K16 A;  3I2D A;  2Y1N A;  2LGK A;  4S3O C;  5B8D A;  4R7E A;  3RPG C;  5B77 A;  4PTB A;  1DVP A;  1G25 A;  3GV4 A;  3O36 A;  3SHB A;  4AYC B;  3L11 A;  3DQV R;  4P5O B;  2YHO A;  2E6S A;  2VPD A;  2KWN A;  1LDK C;  2PUY A;  4CCG X;  2JMJ A;  4UP5 A;  5G05 B;  4NN2 A;  3N9L A;  2XB1 A;  2QIC A;  3DPL R;  3EB6 A;  4YBT A;  3ZVY A;  5C11 A;  2YSM A;  4I7B A;  2Y1M A;  2JMI A;  1U6G B;  1WEV A;  2YUR A;  1WFK A;  5B75 A;  3T7L A;  4AUQ B;  3O33 A;  1T1H A;  4QF3 A;  3L1X A;  4UI9 B;  2KGI A;  4ZQL A;  2LXP C;  1X4J A;  4YAX A;  2ZET C;  4L58 A;  2K17 A;  1WEO A;  4IC2 A;  1F62 A;  2KE1 A;  1MM3 A;  4Q6F A;  2MNZ A;  3N9N A;  4B86 C;  5KH7 A;  2K4D A;  5J3X A;  2I50 A;  4QF2 A;  2QIZ A;  3ZYQ A;  3O37 A;  2NAA A;  5JG6 A;  3O7A A;  3ZPV 1;  5H1U A;  2L75 A;  3O70 A;  1HYI A;  2FUU A;  3O34 A;  2YYR A;  4WA6 A;  2XEU A;  4GB0 A;  1V87 A;  3KNV A;  4X3G A;  2G43 A;  2HDP A;  3ZVZ B;  5TAB A;  3LQI A;  2LXH C;  2LGV A;  4B7Y C;  2ECN A;  5FEY A;  5DKA A;  4WZ3 B;  3RTR B;  2PNX A;  2IDA A;  2VJF A;  2G45 A;  2KIZ A;  5D1M B;  2MA6 A;  3QZV A;  4YAT A;  3FL2 A;  4LLB A;  4CA1 A;  2LGL A;  1RMD A;  5H1V A;  3M63 A;  2HYE D;  1VFY A;  2KR4 A;  4S3O B;  5KH3 A;  4GNE A;  1K2F A;  3HCS A;  4FJC A;  2F6N A;  5I3L A;  2L0B A;  4A4C A;  2DX8 A;  3NG2 A;  3HCU A;  5TRB A;  3VK6 A;  5FB0 A;  2E6R A;  4ZDT A;  2VNF A;  4A49 A;  3RPG B;  3KQI A;  3PHD A;  2LV9 A;  2M6M A;  2VPB A;  2FSA A;  4FO9 A;  2YHN A;  3KV6 A;  2EA6 A;  2RSD A;  2G6Q A;  5TDW A;  4WZ2 A;  2MD8 C;  3EB5 A;  1WES A;  4R8P K;  4LKA A;  2F42 A;  2F6J A;  4GND A;  4W4U A;  5G04 B;  5AIU A;  2MD7 B;  2VP7 A;  5FER A;  1LDJ B;  3MHS A;  4LAD B;  2VJE A;  2YQM A;  2CSY A;  2K1J A;  2YT5 A;  1JM7 B;  2YU4 A;  5TDR A;  4YBM A;  3SOX A;  2YUC A;  3HTK C;  2CKL B;  2H0D B;  1WIM A;  4AP4 A;  5LCW B;  2JMD A;  4MVT A;  1WGM A;  4L7X A;  3ZTG A;  4LJN A;  2FUI A;  5D1L B;  2MUM A;  3N9P A;  3SOW A;  2LN0 A;  4AVX A;  1E4U A;  2L5U A;  2RI7 A;  5DIN A; 
#chains in the Genus database with same CATH topology
 2FFW A;  3ASL A;  2L43 A;  2ECV A;  2ECT A;  5LKZ A;  2KWO A;  5LKX A;  2B0O E;  2QJ0 A;  1Z6U A;  4GNF A;  3T6R A;  1IYM A;  4O62 A;  2MA5 A;  3C6W A;  1X4U A;  1WEE A;  4I7C A;  1HYJ A;  4V3L C;  2XP0 A;  4FIP A;  3GL6 A;  3LQH A;  2VJF B;  3LQJ A;  2EGM A;  3KV5 A;  3N9M A;  1WEW A;  4MSX A;  1BOR A;  1XWH A;  4C9Z A;  4A4B A;  2L80 A;  4N3W A;  3PLW A;  1WEP A;  3N9O A;  3M99 A;  4PPE A;  4YAB A;  2YVR A;  3IHP A;  2MKE A;  2ECI A;  2JUN A;  3L1Z B;  2LQ6 A;  1X4I A;  2M3H A;  5H1T A;  2FD4 A;  4V3K C;  3ZPV E;  4AYC A;  3PUQ A;  2JM3 A;  2M85 A;  3FAO A;  1WEM A;  2LAU A;  5H9M A;  3Q1D A;  4R2Y A;  4YAD A;  1FBV A;  4ZUX U;  4O64 A;  2YQL A;  3U5M A;  2ECW A;  4YBS A;  2DSM A;  5LKU A;  5LKT A;  5KH9 A;  5D1K B;  3V43 A;  4I7D A;  4N4F A;  4IC3 A;  2KWJ A;  3HCT A;  5AIT A;  2C2V S;  5EYA F;  2YSJ A;  1Z2Q A;  2MIQ A;  5B79 A;  2JRJ A;  4F52 B;  2M1R A;  1ZBD B;  2KRE A;  3DDT A;  1FP0 A;  1WEQ A;  1DCQ A;  2CT2 A;  2EGP A;  3MHH A;  2VPG A;  3FAN A;  2ECG A;  3DWD A;  2KYU A;  2D8S A;  4A0C D;  4GNG A;  2C2L A;  3PUR A;  1WEU A;  1CHC A;  2LGG A;  1VD4 A;  2CKL A;  4TKP B;  5B78 A;  2VPE A;  1VYX A;  2BAY A;  2EOD A;  2CSZ A;  3U5O A;  3N9Q A;  5TBN A;  3T9K A;  3LDY A;  1Z60 A;  2LDR A;  3SOU A;  2YW8 A;  3C5K A;  2KU3 A;  5C13 A;  4WZ0 A;  2VJE B;  2Y43 A;  4XI1 A;  4F1P A;  3H7H A;  3KDE C;  5K3Q A;  1JM7 A;  4Z0R A;  2MT5 A;  2UZG A;  2RR4 A;  4BBQ A;  3ZNI A;  3U5N A;  1JOC A;  2P57 A;  1MM2 A;  1WEN A;  5B76 A;  4YC9 A;  2AN6 A;  2H0D A;  4BHW A;  4FK5 A;  3M62 A;  3O35 A;  5G0F A;  2OXQ C;  2YRE A;  2MNY A;  4LK9 A;  3LRQ A;  1N87 A;  5FB1 A;  2KFT A;  2KGG A;  2KWK A;  4UP0 A;  2KKY A;  1WE9 A;  1WIL A;  5SVI A;  2ECJ A;  2LRI C;  3U5P A;  2K16 A;  3I2D A;  2Y1N A;  2LGK A;  2M13 A;  4S3O C;  5B8D A;  4R7E A;  3RPG C;  2XOY A;  5B77 A;  2XOC A;  4PTB A;  1DVP A;  1G25 A;  3GV4 A;  3O36 A;  3SHB A;  4AYC B;  3L11 A;  3DQV R;  4P5O B;  2YHO A;  2E6S A;  2VPD A;  2KWN A;  1LDK C;  2PUY A;  4CCG X;  2JMJ A;  4UP5 A;  5G05 B;  4NN2 A;  4OGC A;  2D8U A;  3N9L A;  2XB1 A;  3FM8 C;  2QIC A;  3DPL R;  3EB6 A;  3LJU X;  4YBT A;  3ZVY A;  5C11 A;  2YSM A;  4I7B A;  2Y1M A;  2JMI A;  1U6G B;  1WEV A;  2YUR A;  1WFK A;  5B75 A;  3T7L A;  4AUQ B;  3O33 A;  2IQJ A;  1T1H A;  2DJA A;  3FEH A;  4QF3 A;  3L1X A;  4UI9 B;  2KGI A;  4ZQL A;  5SVI B;  4QQ4 A;  2LXP C;  1X4J A;  4YAX A;  2ZET C;  4L58 A;  2K17 A;  1WEO A;  4IC2 A;  1F62 A;  2KE1 A;  1MM3 A;  5SVY A;  4Q6F A;  2MNZ A;  3N9N A;  2CON A;  4B86 C;  5KH7 A;  2K4D A;  5J3X A;  2I50 A;  4QF2 A;  2QIZ A;  3ZYQ A;  3O37 A;  2NAA A;  5JG6 A;  3O7A A;  3JUE A;  3ZPV 1;  5H1U A;  2L75 A;  3O70 A;  1HYI A;  2FUU A;  3O34 A;  4Z0O A;  2YYR A;  4WA6 A;  2XEU A;  4GB0 A;  1V87 A;  3KNV A;  4X3G A;  2G43 A;  2HDP A;  3ZVZ B;  5TAB A;  3LQI A;  2LXH C;  2LGV A;  2CSV A;  4B7Y C;  2EXU A;  2ECN A;  5FEY A;  2L7P A;  5DKA A;  4WZ3 B;  3RTR B;  2PNX A;  2IDA A;  2VJF A;  4OGE A;  2G45 A;  1MBM A;  2KIZ A;  5D1M B;  2MA6 A;  3QZV A;  4YAT A;  3FL2 A;  4LLB A;  4CA1 A;  2LGL A;  3SUB A;  1RMD A;  5H1V A;  3M63 A;  2HYE D;  2OWA A;  1VFY A;  2KR4 A;  4S3O B;  5KH3 A;  4GNE A;  1K2F A;  3HCS A;  4FJC A;  2F6N A;  5I3L A;  2L0B A;  4A4C A;  2DX8 A;  3NG2 A;  3HCU A;  5TRB A;  3VK6 A;  5FB0 A;  2E6R A;  4ZDT A;  2VNF A;  4A49 A;  3RPG B;  3KQI A;  3PHD A;  2LV9 A;  2M6M A;  2VPB A;  2FSA A;  2KKX A;  4FO9 A;  3MDB C;  2YHN A;  3KV6 A;  2EA6 A;  2RSD A;  2G6Q A;  5TDW A;  4WZ2 A;  2MD8 C;  5SVX A;  3LVQ E;  3EB5 A;  1WES A;  4R8P K;  4LKA A;  2F42 A;  2F6J A;  4GND A;  4W4U A;  5G04 B;  3E2D A;  5AIU A;  2MD7 B;  2VP7 A;  5FER A;  1LDJ B;  3MHS A;  4LAD B;  2VJE A;  2YQM A;  2CSY A;  2K1J A;  2YT5 A;  1JM7 B;  2YU4 A;  3LVR E;  5TDR A;  2CRR A;  2E61 A;  4YBM A;  3SOX A;  2YUC A;  3FJU B;  3HTK C;  2CKL B;  2H0D B;  1WIM A;  4AP4 A;  5LCW B;  2CRW A;  2JMD A;  4MVT A;  1WGM A;  4L7X A;  3ZTG A;  4LJN A;  2FUI A;  5D1L B;  2XOZ A;  2MUM A;  3N9P A;  3SOW A;  2LN0 A;  4AVX A;  3O47 A;  1E4U A;  4H9D A;  2L5U A;  3M7K A;  2RI7 A;  5DIN A; 
#chains in the Genus database with same CATH homology
 3ASL A;  2L43 A;  2ECV A;  2ECT A;  5LKZ A;  2KWO A;  5LKX A;  2QJ0 A;  1Z6U A;  4GNF A;  3T6R A;  1IYM A;  2MA5 A;  3C6W A;  1X4U A;  1WEE A;  4I7C A;  1HYJ A;  4V3L C;  4FIP A;  3GL6 A;  3LQH A;  2VJF B;  3LQJ A;  3KV5 A;  3N9M A;  1WEW A;  4MSX A;  1BOR A;  1XWH A;  4C9Z A;  4A4B A;  2L80 A;  4N3W A;  1WEP A;  3N9O A;  3M99 A;  4PPE A;  4YAB A;  3IHP A;  2ECI A;  2LQ6 A;  3L1Z B;  1X4I A;  2M3H A;  5H1T A;  4V3K C;  3ZPV E;  4AYC A;  3PUQ A;  2M85 A;  1WEM A;  5H9M A;  4R2Y A;  4YAD A;  1FBV A;  4ZUX U;  4O64 A;  2YQL A;  3U5M A;  2ECW A;  4YBS A;  5LKU A;  5LKT A;  5KH9 A;  5D1K B;  3V43 A;  4I7D A;  4N4F A;  4IC3 A;  2KWJ A;  3HCT A;  5AIT A;  2C2V S;  5EYA F;  2YSJ A;  1Z2Q A;  2MIQ A;  5B79 A;  2JRJ A;  4F52 B;  2M1R A;  1ZBD B;  2KRE A;  1FP0 A;  1WEQ A;  2CT2 A;  2EGP A;  3MHH A;  2VPG A;  2ECG A;  2KYU A;  2D8S A;  4A0C D;  4GNG A;  2C2L A;  3PUR A;  1WEU A;  1CHC A;  2LGG A;  1VD4 A;  2CKL A;  4TKP B;  5B78 A;  2VPE A;  1VYX A;  2BAY A;  2EOD A;  2CSZ A;  3U5O A;  3N9Q A;  5TBN A;  1Z60 A;  2LDR A;  3SOU A;  2YW8 A;  3C5K A;  2KU3 A;  5C13 A;  4WZ0 A;  2VJE B;  2Y43 A;  4XI1 A;  1JM7 A;  2MT5 A;  2UZG A;  4BBQ A;  3ZNI A;  3U5N A;  1JOC A;  1MM2 A;  1WEN A;  5B76 A;  4YC9 A;  2AN6 A;  2H0D A;  4BHW A;  3M62 A;  4FK5 A;  3O35 A;  5G0F A;  2OXQ C;  2YRE A;  2MNY A;  4LK9 A;  3LRQ A;  1N87 A;  5FB1 A;  2KFT A;  2KGG A;  2KWK A;  4UP0 A;  1WE9 A;  1WIL A;  2ECJ A;  2LRI C;  3U5P A;  2K16 A;  3I2D A;  2Y1N A;  2LGK A;  4S3O C;  5B8D A;  4R7E A;  3RPG C;  5B77 A;  4PTB A;  1DVP A;  1G25 A;  3GV4 A;  3O36 A;  3SHB A;  4AYC B;  3L11 A;  3DQV R;  4P5O B;  2YHO A;  2E6S A;  2VPD A;  2KWN A;  1LDK C;  2PUY A;  4CCG X;  2JMJ A;  4UP5 A;  5G05 B;  4NN2 A;  3N9L A;  2XB1 A;  2QIC A;  3DPL R;  3EB6 A;  4YBT A;  3ZVY A;  5C11 A;  2YSM A;  4I7B A;  2Y1M A;  2JMI A;  1U6G B;  1WEV A;  2YUR A;  1WFK A;  5B75 A;  3T7L A;  4AUQ B;  3O33 A;  1T1H A;  4QF3 A;  3L1X A;  4UI9 B;  2KGI A;  4ZQL A;  2LXP C;  1X4J A;  4YAX A;  2ZET C;  4L58 A;  2K17 A;  1WEO A;  4IC2 A;  1F62 A;  2KE1 A;  1MM3 A;  4Q6F A;  2MNZ A;  3N9N A;  4B86 C;  5KH7 A;  2K4D A;  5J3X A;  2I50 A;  4QF2 A;  2QIZ A;  3ZYQ A;  3O37 A;  2NAA A;  5JG6 A;  3O7A A;  3ZPV 1;  5H1U A;  2L75 A;  3O70 A;  1HYI A;  2FUU A;  3O34 A;  2YYR A;  4WA6 A;  2XEU A;  4GB0 A;  1V87 A;  3KNV A;  4X3G A;  2G43 A;  2HDP A;  3ZVZ B;  5TAB A;  3LQI A;  2LXH C;  2LGV A;  4B7Y C;  2ECN A;  5FEY A;  5DKA A;  4WZ3 B;  3RTR B;  2PNX A;  2IDA A;  2VJF A;  2G45 A;  2KIZ A;  5D1M B;  2MA6 A;  3QZV A;  4YAT A;  3FL2 A;  4LLB A;  4CA1 A;  2LGL A;  1RMD A;  5H1V A;  3M63 A;  2HYE D;  1VFY A;  2KR4 A;  4S3O B;  5KH3 A;  4GNE A;  1K2F A;  3HCS A;  4FJC A;  2F6N A;  5I3L A;  2L0B A;  4A4C A;  2DX8 A;  3NG2 A;  3HCU A;  5TRB A;  3VK6 A;  5FB0 A;  2E6R A;  4ZDT A;  2VNF A;  4A49 A;  3RPG B;  3KQI A;  3PHD A;  2LV9 A;  2M6M A;  2VPB A;  2FSA A;  4FO9 A;  2YHN A;  3KV6 A;  2EA6 A;  2RSD A;  2G6Q A;  5TDW A;  4WZ2 A;  2MD8 C;  3EB5 A;  1WES A;  4R8P K;  4LKA A;  2F42 A;  2F6J A;  4GND A;  4W4U A;  5G04 B;  5AIU A;  2MD7 B;  2VP7 A;  5FER A;  1LDJ B;  3MHS A;  4LAD B;  2VJE A;  2YQM A;  2CSY A;  2K1J A;  2YT5 A;  1JM7 B;  2YU4 A;  5TDR A;  4YBM A;  3SOX A;  2YUC A;  3HTK C;  2CKL B;  2H0D B;  1WIM A;  4AP4 A;  5LCW B;  2JMD A;  4MVT A;  1WGM A;  4L7X A;  3ZTG A;  4LJN A;  2FUI A;  5D1L B;  2MUM A;  3N9P A;  3SOW A;  2LN0 A;  4AVX A;  1E4U A;  2L5U A;  2RI7 A;  5DIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...