4L7XA

Crystal structure of the dido phd finger in complex with h3k4me3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, gene regulation
molecule keywords Death-inducer obliterator 1
publication title Dido3 PHD Modulates Cell Differentiation and Division.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l7xA00
1WENA 2F42A 3PUQA 2CSZA 5TDWA 1JOCA 4FIPA 1VD4A 4R7EA 2KREA 4B7YC 2G43A 3L1ZB 2LN0A 3EB6A 4WA6A 1LDKC 1ZBDB 1HYJA 4YBSA 3N9MA 3IHPA 3SOXA 2LXHC 3RTRB 4LJNA 2JMIA 5KH3A 2F6JA 5FB1A 1WE9A 2G45A 2ECWA 2YYRA 1WIMA 4A0CD 1Z60A 4TKPB 3ZTGA 1JM7A 2CKLB 4PPEA 2YSJA 4AYCB 2QICA 1DVPA 4L58A 3N9QA 2VPBA 4YBTA 5TBNA 5G05B 2VJFA 1HYIA 4N4FA 1WGMA 2EODA 1G25A 2YREA 2VP7A 2YQLA 1WEQA 5DINA 3ASLA 2HYED 4O64A 4R8PK 2YU4A 3LRQA 1WEPA 2JMDA 3U5MA 2KGGA 5J3XA 2CSYA 2LGVA 2M85A 5H1UA 3ZPVE 3O36A 1LDJB 2JRJA 2H0DA 5LKZA 5TABA 4L7XA 4B86C 4LK9A 4S3OC 3I2DA 3V43A 5H1VA 2YT5A 3LQIA 2LQ6A 5B78A 4GNFA 2HDPA 5C13A 2RI7A 1VYXA 2KFTA 4QF2A 5D1KB 5B76A 1JM7B 4YATA 3U5OA 2E6SA 1WESA 4AP4A 4I7BA 2VJFB 5FERA 1IYMA 4GNGA 2OXQC 4YAXA 5LKXA 3L11A 2L5UA 4FJCA 3KQIA 1VFYA 5G04B 3SHBA 2ECJA 2ECTA 3C6WA 3N9LA 3M99A 2K16A 1V87A 1WFKA 5B79A 2H0DB 3LQJA 3DQVR 5LKTA 5D1MB 2KWKA 3EB5A 4A4CA 2C2LA 3ZYQA 2DX8A 4P5OB 4I7CA 1X4UA 2I50A 3T7LA 4ZDTA 4LKAA 2K4DA 2M6MA 5H1TA 4MVTA 4AUQB 4WZ3B 4YABA 2UZGA 4PTBA 3N9NA 3NG2A 3HTKC 3KV5A 4R2YA 2ECVA 4AVXA 2KR4A 1MM2A 2ECNA 2PNXA 2XEUA 2L0BA 3RPGC 5B75A 2MUMA 1E4UA 2MD7B 4ZQLA 1WEOA 2YQMA 4GNEA 5AITA 1MM3A 2F6NA 4WZ2A 3O34A 4YBMA 5LCWB 2YHOA 4CA1A 1WEUA 2FSAA 3MHSA 2KWOA 4I7DA 3KV6A 2LGLA 3U5PA 1RMDA 2KU3A 1N87A 2D8SA 2YUCA 1U6GB 3ZVYA 3M63A 1WEEA 4UI9B 1Z6UA 2LV9A 4V3LC 5TRBA 2K1JA 2MNZA 2VPDA 2LDRA 3T6RA 2KWJA 5EYAF 2KIZA 3U5NA 4YC9A 2E6RA 2VJEA 2MA5A 3O7AA 3GV4A 5KH9A 4Q6FA 4GNDA 5LKUA 2L43A 4FK5A 2L75A 1WEWA 4CCGX 4MSXA 4FO9A 4NN2A 2Y1MA 5D1LB 3SOWA 3VK6A 4ZUXU 4N3WA 4GB0A 1BORA 4IC2A 5B8DA 5AIUA 2NAAA 2ECIA 3ZNIA 4BBQA 5FB0A 1K2FA 5DKAA 5JG6A 1Z2QA 3L1XA 2CT2A 4QF3A 2BAYA 2EA6A 4V3KC 2ZETC 4IC3A 2KWNA 2VPEA 1T1HA 1CHCA 2M1RA 1WEVA 2KYUA 3PURA 2XB1A 2JMJA 2KE1A 4LLBA 3ZVZB 2M3HA 4XI1A 2QJ0A 5FEYA 2ECGA 1WEMA 4YADA 4A4BA 1X4JA 2KGIA 3FL2A 4LADB 5G0FA 5B77A 2MD8C 3RPGB 4C9ZA 4W4UA 2C2VS 2LRIC 2VJEB 4UP0A 2MNYA 4X3GA 2AN6A 2G6QA 2YHNA 3O37A 2Y43A 2LXPC 2YURA 5I3LA 2FUIA 5C11A 3N9PA 3ZPV1 1WILA 4S3OB 5TDRA 2LGGA 2YW8A 2MT5A 2Y1NA 5KH7A 3PHDA 1FP0A 3MHHA 4F52B 2MA6A 3O70A 2EGPA 5H9MA 2QIZA 3LQHA 3C5KA 3N9OA 4A49A 2VPGA 2YSMA 2RSDA 3HCUA 1FBVA 2CKLA 2LGKA 4AYCA 3HCSA 2FUUA 1XWHA 3O33A 4UP5A 2IDAA 3DPLR 3HCTA 2L80A 3GL6A 1F62A 2PUYA 2MIQA 3KNVA 4WZ0A 4BHWA 2VNFA 2K17A 3M62A 3QZVA 3SOUA 3O35A 1X4IA
chains in the Genus database with same CATH superfamily
1WENA 2F42A 3PUQA 2CSZA 5TDWA 1JOCA 2FFWA 2LAUA 4FIPA 1VD4A 4R7EA 2KREA 4B7YC 2G43A 5SVIA 3L1ZB 2LN0A 4Z0RA 3EB6A 3H7HA 2P57A 4WA6A 1LDKC 1ZBDB 1HYJA 4YBSA 3N9MA 2XP0A 3IHPA 3SOXA 2LXHC 3RTRB 4LJNA 2JMIA 5KH3A 2F6JA 5FB1A 1WE9A 2G45A 2ECWA 2YYRA 1WIMA 3LVQE 4A0CD 1Z60A 4TKPB 3ZTGA 1JM7A 2CKLB 4PPEA 2YSJA 4AYCB 2QICA 1DVPA 4L58A 3N9QA 2VPBA 4YBTA 5TBNA 5G05B 2VJFA 1HYIA 4N4FA 1WGMA 2EODA 1G25A 2YREA 2L7PA 2VP7A 2YQLA 3M7KA 1WEQA 5DINA 3ASLA 2HYED 4O64A 4R8PK 2YU4A 3LRQA 1WEPA 2JMDA 3U5MA 2KGGA 5J3XA 2CSYA 2LGVA 2M85A 5H1UA 3ZPVE 3O36A 1LDJB 2JRJA 2H0DA 4OGEA 5LKZA 5TABA 4L7XA 4B86C 5SVIB 4LK9A 4S3OC 3I2DA 3V43A 3Q1DA 5K3QA 3DWDA 5H1VA 2YT5A 3KDEC 2E61A 3LQIA 2LQ6A 5B78A 2JUNA 3FANA 4GNFA 2HDPA 5C13A 2RI7A 1VYXA 2KFTA 4QF2A 5D1KB 2D8UA 5B76A 1JM7B 4YATA 3U5OA 2E6SA 1WESA 3PLWA 4AP4A 2CRRA 4I7BA 3SUBA 2VJFB 5FERA 1IYMA 4GNGA 2OXQC 4YAXA 5LKXA 3L11A 2L5UA 4FJCA 3KQIA 1VFYA 3FM8C 2KKYA 5G04B 3SHBA 2DJAA 2EXUA 2ECJA 2ECTA 3C6WA 3N9LA 3M99A 2K16A 1V87A 1DCQA 1WFKA 5B79A 2H0DB 3LQJA 3DQVR 5LKTA 5D1MB 2KWKA 3EB5A 4A4CA 2C2LA 3ZYQA 2DX8A 4P5OB 4I7CA 1X4UA 2RR4A 2I50A 3T7LA 4ZDTA 2CONA 4LKAA 2K4DA 3O47A 2M6MA 5H1TA 4MVTA 4AUQB 4WZ3B 4YABA 2UZGA 4PTBA 3N9NA 3NG2A 3HTKC 3KV5A 4R2YA 2ECVA 4AVXA 2KR4A 1MM2A 2ECNA 2PNXA 2XEUA 2L0BA 3RPGC 5B75A 2MUMA 1E4UA 2MD7B 4ZQLA 5SVXA 2XOYA 3LJUX 1WEOA 2YQMA 4GNEA 2MKEA 5AITA 1MM3A 2F6NA 4WZ2A 3O34A 4YBMA 5LCWB 2YHOA 2OWAA 4CA1A 1WEUA 2FSAA 2B0OE 3MHSA 2KWOA 4I7DA 3KV6A 2XOZA 2LGLA 3U5PA 1RMDA 2KU3A 1N87A 2D8SA 2YUCA 1U6GB 3ZVYA 3M63A 1MBMA 1WEEA 4UI9B 1Z6UA 2LV9A 4V3LC 5TRBA 2K1JA 2MNZA 2VPDA 2XOCA 2LDRA 2EGMA 3FAOA 3T6RA 4Z0OA 2KWJA 5EYAF 2KIZA 3U5NA 4YC9A 2E6RA 2VJEA 2MA5A 3O7AA 3GV4A 5KH9A 4Q6FA 4GNDA 5LKUA 2L43A 4FK5A 2L75A 1WEWA 4CCGX 4MSXA 4FO9A 4F1PA 4NN2A 2Y1MA 5D1LB 3SOWA 3VK6A 4ZUXU 4N3WA 4GB0A 1BORA 4IC2A 3MDBC 5B8DA 5AIUA 2NAAA 2ECIA 3ZNIA 4BBQA 5FB0A 1K2FA 5DKAA 5JG6A 3LVRE 1Z2QA 3L1XA 2CT2A 5SVYA 4QF3A 2BAYA 2EA6A 4V3KC 2ZETC 4QQ4A 4IC3A 2KWNA 2VPEA 1T1HA 1CHCA 3E2DA 2M1RA 1WEVA 2FD4A 2CRWA 2KYUA 3PURA 2XB1A 2YVRA 2JMJA 2KE1A 3DDTA 4LLBA 3ZVZB 2M3HA 4XI1A 2QJ0A 2M13A 5FEYA 2CSVA 2ECGA 1WEMA 4YADA 4A4BA 1X4JA 2KGIA 3FL2A 4LADB 5G0FA 5B77A 2MD8C 3RPGB 4C9ZA 4W4UA 2C2VS 2LRIC 2VJEB 4UP0A 2MNYA 4X3GA 2AN6A 2G6QA 2YHNA 3O37A 2Y43A 2LXPC 2YURA 5I3LA 2FUIA 5C11A 3N9PA 3ZPV1 1WILA 4S3OB 5TDRA 2LGGA 2YW8A 2KKXA 4O62A 2MT5A 2Y1NA 3FEHA 5KH7A 3PHDA 1FP0A 3MHHA 4F52B 2MA6A 2IQJA 3O70A 2EGPA 5H9MA 2QIZA 3LQHA 3C5KA 3N9OA 3FJUB 4A49A 2VPGA 2YSMA 2RSDA 3HCUA 2DSMA 1FBVA 2CKLA 2LGKA 4AYCA 3HCSA 2FUUA 1XWHA 3O33A 4UP5A 3T9KA 2IDAA 3DPLR 3HCTA 2L80A 3GL6A 1F62A 2PUYA 3JUEA 2MIQA 3KNVA 4WZ0A 4BHWA 2VNFA 2K17A 2JM3A 4H9DA 3M62A 4OGCA 3QZVA 3SOUA 3LDYA 3O35A 1X4IA
chains in the Genus database with same CATH topology
1WENA 2F42A 3PUQA 2CSZA 5TDWA 1JOCA 4FIPA 1VD4A 4R7EA 2KREA 4B7YC 2G43A 3L1ZB 2LN0A 3EB6A 4WA6A 1LDKC 1ZBDB 1HYJA 4YBSA 3N9MA 3IHPA 3SOXA 2LXHC 3RTRB 4LJNA 2JMIA 5KH3A 2F6JA 5FB1A 1WE9A 2G45A 2ECWA 2YYRA 1WIMA 4A0CD 1Z60A 4TKPB 3ZTGA 1JM7A 2CKLB 4PPEA 2YSJA 4AYCB 2QICA 1DVPA 4L58A 3N9QA 2VPBA 4YBTA 5TBNA 5G05B 2VJFA 1HYIA 4N4FA 1WGMA 2EODA 1G25A 2YREA 2VP7A 2YQLA 1WEQA 5DINA 3ASLA 2HYED 4O64A 4R8PK 2YU4A 3LRQA 1WEPA 2JMDA 3U5MA 2KGGA 5J3XA 2CSYA 2LGVA 2M85A 5H1UA 3ZPVE 3O36A 1LDJB 2JRJA 2H0DA 5LKZA 5TABA 4L7XA 4B86C 4LK9A 4S3OC 3I2DA 3V43A 5H1VA 2YT5A 3LQIA 2LQ6A 5B78A 4GNFA 2HDPA 5C13A 2RI7A 1VYXA 2KFTA 4QF2A 5D1KB 5B76A 1JM7B 4YATA 3U5OA 2E6SA 1WESA 4AP4A 4I7BA 2VJFB 5FERA 1IYMA 4GNGA 2OXQC 4YAXA 5LKXA 3L11A 2L5UA 4FJCA 3KQIA 1VFYA 5G04B 3SHBA 2ECJA 2ECTA 3C6WA 3N9LA 3M99A 2K16A 1V87A 1WFKA 5B79A 2H0DB 3LQJA 3DQVR 5LKTA 5D1MB 2KWKA 3EB5A 4A4CA 2C2LA 3ZYQA 2DX8A 4P5OB 4I7CA 1X4UA 2I50A 3T7LA 4ZDTA 4LKAA 2K4DA 2M6MA 5H1TA 4MVTA 4AUQB 4WZ3B 4YABA 2UZGA 4PTBA 3N9NA 3NG2A 3HTKC 3KV5A 4R2YA 2ECVA 4AVXA 2KR4A 1MM2A 2ECNA 2PNXA 2XEUA 2L0BA 3RPGC 5B75A 2MUMA 1E4UA 2MD7B 4ZQLA 1WEOA 2YQMA 4GNEA 5AITA 1MM3A 2F6NA 4WZ2A 3O34A 4YBMA 5LCWB 2YHOA 4CA1A 1WEUA 2FSAA 3MHSA 2KWOA 4I7DA 3KV6A 2LGLA 3U5PA 1RMDA 2KU3A 1N87A 2D8SA 2YUCA 1U6GB 3ZVYA 3M63A 1WEEA 4UI9B 1Z6UA 2LV9A 4V3LC 5TRBA 2K1JA 2MNZA 2VPDA 2LDRA 3T6RA 2KWJA 5EYAF 2KIZA 3U5NA 4YC9A 2E6RA 2VJEA 2MA5A 3O7AA 3GV4A 5KH9A 4Q6FA 4GNDA 5LKUA 2L43A 4FK5A 2L75A 1WEWA 4CCGX 4MSXA 4FO9A 4NN2A 2Y1MA 5D1LB 3SOWA 3VK6A 4ZUXU 4N3WA 4GB0A 1BORA 4IC2A 5B8DA 5AIUA 2NAAA 2ECIA 3ZNIA 4BBQA 5FB0A 1K2FA 5DKAA 5JG6A 1Z2QA 3L1XA 2CT2A 4QF3A 2BAYA 2EA6A 4V3KC 2ZETC 4IC3A 2KWNA 2VPEA 1T1HA 1CHCA 2M1RA 1WEVA 2KYUA 3PURA 2XB1A 2JMJA 2KE1A 4LLBA 3ZVZB 2M3HA 4XI1A 2QJ0A 5FEYA 2ECGA 1WEMA 4YADA 4A4BA 1X4JA 2KGIA 3FL2A 4LADB 5G0FA 5B77A 2MD8C 3RPGB 4C9ZA 4W4UA 2C2VS 2LRIC 2VJEB 4UP0A 2MNYA 4X3GA 2AN6A 2G6QA 2YHNA 3O37A 2Y43A 2LXPC 2YURA 5I3LA 2FUIA 5C11A 3N9PA 3ZPV1 1WILA 4S3OB 5TDRA 2LGGA 2YW8A 2MT5A 2Y1NA 5KH7A 3PHDA 1FP0A 3MHHA 4F52B 2MA6A 3O70A 2EGPA 5H9MA 2QIZA 3LQHA 3C5KA 3N9OA 4A49A 2VPGA 2YSMA 2RSDA 3HCUA 1FBVA 2CKLA 2LGKA 4AYCA 3HCSA 2FUUA 1XWHA 3O33A 4UP5A 2IDAA 3DPLR 3HCTA 2L80A 3GL6A 1F62A 2PUYA 2MIQA 3KNVA 4WZ0A 4BHWA 2VNFA 2K17A 3M62A 3QZVA 3SOUA 3O35A 1X4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEN A;  2F42 A;  3PUQ A;  2CSZ A;  5TDW A;  1JOC A;  4FIP A;  1VD4 A;  4R7E A;  2KRE A;  4B7Y C;  2G43 A;  3L1Z B;  2LN0 A;  3EB6 A;  4WA6 A;  1LDK C;  1ZBD B;  1HYJ A;  4YBS A;  3N9M A;  3IHP A;  3SOX A;  2LXH C;  3RTR B;  4LJN A;  2JMI A;  5KH3 A;  2F6J A;  5FB1 A;  1WE9 A;  2G45 A;  2ECW A;  2YYR A;  1WIM A;  4A0C D;  1Z60 A;  4TKP B;  3ZTG A;  1JM7 A;  2CKL B;  4PPE A;  2YSJ A;  4AYC B;  2QIC A;  1DVP A;  4L58 A;  3N9Q A;  2VPB A;  4YBT A;  5TBN A;  5G05 B;  2VJF A;  1HYI A;  4N4F A;  1WGM A;  2EOD A;  1G25 A;  2YRE A;  2VP7 A;  2YQL A;  1WEQ A;  5DIN A;  3ASL A;  2HYE D;  4O64 A;  4R8P K;  2YU4 A;  3LRQ A;  1WEP A;  2JMD A;  3U5M A;  2KGG A;  5J3X A;  2CSY A;  2LGV A;  2M85 A;  5H1U A;  3ZPV E;  3O36 A;  1LDJ B;  2JRJ A;  2H0D A;  5LKZ A;  5TAB A;  4L7X A;  4B86 C;  4LK9 A;  4S3O C;  3I2D A;  3V43 A;  5H1V A;  2YT5 A;  3LQI A;  2LQ6 A;  5B78 A;  4GNF A;  2HDP A;  5C13 A;  2RI7 A;  1VYX A;  2KFT A;  4QF2 A;  5D1K B;  5B76 A;  1JM7 B;  4YAT A;  3U5O A;  2E6S A;  1WES A;  4AP4 A;  4I7B A;  2VJF B;  5FER A;  1IYM A;  4GNG A;  2OXQ C;  4YAX A;  5LKX A;  3L11 A;  2L5U A;  4FJC A;  3KQI A;  1VFY A;  5G04 B;  3SHB A;  2ECJ A;  2ECT A;  3C6W A;  3N9L A;  3M99 A;  2K16 A;  1V87 A;  1WFK A;  5B79 A;  2H0D B;  3LQJ A;  3DQV R;  5LKT A;  5D1M B;  2KWK A;  3EB5 A;  4A4C A;  2C2L A;  3ZYQ A;  2DX8 A;  4P5O B;  4I7C A;  1X4U A;  2I50 A;  3T7L A;  4ZDT A;  4LKA A;  2K4D A;  2M6M A;  5H1T A;  4MVT A;  4AUQ B;  4WZ3 B;  4YAB A;  2UZG A;  4PTB A;  3N9N A;  3NG2 A;  3HTK C;  3KV5 A;  4R2Y A;  2ECV A;  4AVX A;  2KR4 A;  1MM2 A;  2ECN A;  2PNX A;  2XEU A;  2L0B A;  3RPG C;  5B75 A;  2MUM A;  1E4U A;  2MD7 B;  4ZQL A;  1WEO A;  2YQM A;  4GNE A;  5AIT A;  1MM3 A;  2F6N A;  4WZ2 A;  3O34 A;  4YBM A;  5LCW B;  2YHO A;  4CA1 A;  1WEU A;  2FSA A;  3MHS A;  2KWO A;  4I7D A;  3KV6 A;  2LGL A;  3U5P A;  1RMD A;  2KU3 A;  1N87 A;  2D8S A;  2YUC A;  1U6G B;  3ZVY A;  3M63 A;  1WEE A;  4UI9 B;  1Z6U A;  2LV9 A;  4V3L C;  5TRB A;  2K1J A;  2MNZ A;  2VPD A;  2LDR A;  3T6R A;  2KWJ A;  5EYA F;  2KIZ A;  3U5N A;  4YC9 A;  2E6R A;  2VJE A;  2MA5 A;  3O7A A;  3GV4 A;  5KH9 A;  4Q6F A;  4GND A;  5LKU A;  2L43 A;  4FK5 A;  2L75 A;  1WEW A;  4CCG X;  4MSX A;  4FO9 A;  4NN2 A;  2Y1M A;  5D1L B;  3SOW A;  3VK6 A;  4ZUX U;  4N3W A;  4GB0 A;  1BOR A;  4IC2 A;  5B8D A;  5AIU A;  2NAA A;  2ECI A;  3ZNI A;  4BBQ A;  5FB0 A;  1K2F A;  5DKA A;  5JG6 A;  1Z2Q A;  3L1X A;  2CT2 A;  4QF3 A;  2BAY A;  2EA6 A;  4V3K C;  2ZET C;  4IC3 A;  2KWN A;  2VPE A;  1T1H A;  1CHC A;  2M1R A;  1WEV A;  2KYU A;  3PUR A;  2XB1 A;  2JMJ A;  2KE1 A;  4LLB A;  3ZVZ B;  2M3H A;  4XI1 A;  2QJ0 A;  5FEY A;  2ECG A;  1WEM A;  4YAD A;  4A4B A;  1X4J A;  2KGI A;  3FL2 A;  4LAD B;  5G0F A;  5B77 A;  2MD8 C;  3RPG B;  4C9Z A;  4W4U A;  2C2V S;  2LRI C;  2VJE B;  4UP0 A;  2MNY A;  4X3G A;  2AN6 A;  2G6Q A;  2YHN A;  3O37 A;  2Y43 A;  2LXP C;  2YUR A;  5I3L A;  2FUI A;  5C11 A;  3N9P A;  3ZPV 1;  1WIL A;  4S3O B;  5TDR A;  2LGG A;  2YW8 A;  2MT5 A;  2Y1N A;  5KH7 A;  3PHD A;  1FP0 A;  3MHH A;  4F52 B;  2MA6 A;  3O70 A;  2EGP A;  5H9M A;  2QIZ A;  3LQH A;  3C5K A;  3N9O A;  4A49 A;  2VPG A;  2YSM A;  2RSD A;  3HCU A;  1FBV A;  2CKL A;  2LGK A;  4AYC A;  3HCS A;  2FUU A;  1XWH A;  3O33 A;  4UP5 A;  2IDA A;  3DPL R;  3HCT A;  2L80 A;  3GL6 A;  1F62 A;  2PUY A;  2MIQ A;  3KNV A;  4WZ0 A;  4BHW A;  2VNF A;  2K17 A;  3M62 A;  3QZV A;  3SOU A;  3O35 A;  1X4I A; 
#chains in the Genus database with same CATH topology
 1WEN A;  2F42 A;  3PUQ A;  2CSZ A;  5TDW A;  1JOC A;  2FFW A;  2LAU A;  4FIP A;  1VD4 A;  4R7E A;  2KRE A;  4B7Y C;  2G43 A;  5SVI A;  3L1Z B;  2LN0 A;  4Z0R A;  3EB6 A;  3H7H A;  2P57 A;  4WA6 A;  1LDK C;  1ZBD B;  1HYJ A;  4YBS A;  3N9M A;  2XP0 A;  3IHP A;  3SOX A;  2LXH C;  3RTR B;  4LJN A;  2JMI A;  5KH3 A;  2F6J A;  5FB1 A;  1WE9 A;  2G45 A;  2ECW A;  2YYR A;  1WIM A;  3LVQ E;  4A0C D;  1Z60 A;  4TKP B;  3ZTG A;  1JM7 A;  2CKL B;  4PPE A;  2YSJ A;  4AYC B;  2QIC A;  1DVP A;  4L58 A;  3N9Q A;  2VPB A;  4YBT A;  5TBN A;  5G05 B;  2VJF A;  1HYI A;  4N4F A;  1WGM A;  2EOD A;  1G25 A;  2YRE A;  2L7P A;  2VP7 A;  2YQL A;  3M7K A;  1WEQ A;  5DIN A;  3ASL A;  2HYE D;  4O64 A;  4R8P K;  2YU4 A;  3LRQ A;  1WEP A;  2JMD A;  3U5M A;  2KGG A;  5J3X A;  2CSY A;  2LGV A;  2M85 A;  5H1U A;  3ZPV E;  3O36 A;  1LDJ B;  2JRJ A;  2H0D A;  4OGE A;  5LKZ A;  5TAB A;  4L7X A;  4B86 C;  5SVI B;  4LK9 A;  4S3O C;  3I2D A;  3V43 A;  3Q1D A;  5K3Q A;  3DWD A;  5H1V A;  2YT5 A;  3KDE C;  2E61 A;  3LQI A;  2LQ6 A;  5B78 A;  2JUN A;  3FAN A;  4GNF A;  2HDP A;  5C13 A;  2RI7 A;  1VYX A;  2KFT A;  4QF2 A;  5D1K B;  2D8U A;  5B76 A;  1JM7 B;  4YAT A;  3U5O A;  2E6S A;  1WES A;  3PLW A;  4AP4 A;  2CRR A;  4I7B A;  3SUB A;  2VJF B;  5FER A;  1IYM A;  4GNG A;  2OXQ C;  4YAX A;  5LKX A;  3L11 A;  2L5U A;  4FJC A;  3KQI A;  1VFY A;  3FM8 C;  2KKY A;  5G04 B;  3SHB A;  2DJA A;  2EXU A;  2ECJ A;  2ECT A;  3C6W A;  3N9L A;  3M99 A;  2K16 A;  1V87 A;  1DCQ A;  1WFK A;  5B79 A;  2H0D B;  3LQJ A;  3DQV R;  5LKT A;  5D1M B;  2KWK A;  3EB5 A;  4A4C A;  2C2L A;  3ZYQ A;  2DX8 A;  4P5O B;  4I7C A;  1X4U A;  2RR4 A;  2I50 A;  3T7L A;  4ZDT A;  2CON A;  4LKA A;  2K4D A;  3O47 A;  2M6M A;  5H1T A;  4MVT A;  4AUQ B;  4WZ3 B;  4YAB A;  2UZG A;  4PTB A;  3N9N A;  3NG2 A;  3HTK C;  3KV5 A;  4R2Y A;  2ECV A;  4AVX A;  2KR4 A;  1MM2 A;  2ECN A;  2PNX A;  2XEU A;  2L0B A;  3RPG C;  5B75 A;  2MUM A;  1E4U A;  2MD7 B;  4ZQL A;  5SVX A;  2XOY A;  3LJU X;  1WEO A;  2YQM A;  4GNE A;  2MKE A;  5AIT A;  1MM3 A;  2F6N A;  4WZ2 A;  3O34 A;  4YBM A;  5LCW B;  2YHO A;  2OWA A;  4CA1 A;  1WEU A;  2FSA A;  2B0O E;  3MHS A;  2KWO A;  4I7D A;  3KV6 A;  2XOZ A;  2LGL A;  3U5P A;  1RMD A;  2KU3 A;  1N87 A;  2D8S A;  2YUC A;  1U6G B;  3ZVY A;  3M63 A;  1MBM A;  1WEE A;  4UI9 B;  1Z6U A;  2LV9 A;  4V3L C;  5TRB A;  2K1J A;  2MNZ A;  2VPD A;  2XOC A;  2LDR A;  2EGM A;  3FAO A;  3T6R A;  4Z0O A;  2KWJ A;  5EYA F;  2KIZ A;  3U5N A;  4YC9 A;  2E6R A;  2VJE A;  2MA5 A;  3O7A A;  3GV4 A;  5KH9 A;  4Q6F A;  4GND A;  5LKU A;  2L43 A;  4FK5 A;  2L75 A;  1WEW A;  4CCG X;  4MSX A;  4FO9 A;  4F1P A;  4NN2 A;  2Y1M A;  5D1L B;  3SOW A;  3VK6 A;  4ZUX U;  4N3W A;  4GB0 A;  1BOR A;  4IC2 A;  3MDB C;  5B8D A;  5AIU A;  2NAA A;  2ECI A;  3ZNI A;  4BBQ A;  5FB0 A;  1K2F A;  5DKA A;  5JG6 A;  3LVR E;  1Z2Q A;  3L1X A;  2CT2 A;  5SVY A;  4QF3 A;  2BAY A;  2EA6 A;  4V3K C;  2ZET C;  4QQ4 A;  4IC3 A;  2KWN A;  2VPE A;  1T1H A;  1CHC A;  3E2D A;  2M1R A;  1WEV A;  2FD4 A;  2CRW A;  2KYU A;  3PUR A;  2XB1 A;  2YVR A;  2JMJ A;  2KE1 A;  3DDT A;  4LLB A;  3ZVZ B;  2M3H A;  4XI1 A;  2QJ0 A;  2M13 A;  5FEY A;  2CSV A;  2ECG A;  1WEM A;  4YAD A;  4A4B A;  1X4J A;  2KGI A;  3FL2 A;  4LAD B;  5G0F A;  5B77 A;  2MD8 C;  3RPG B;  4C9Z A;  4W4U A;  2C2V S;  2LRI C;  2VJE B;  4UP0 A;  2MNY A;  4X3G A;  2AN6 A;  2G6Q A;  2YHN A;  3O37 A;  2Y43 A;  2LXP C;  2YUR A;  5I3L A;  2FUI A;  5C11 A;  3N9P A;  3ZPV 1;  1WIL A;  4S3O B;  5TDR A;  2LGG A;  2YW8 A;  2KKX A;  4O62 A;  2MT5 A;  2Y1N A;  3FEH A;  5KH7 A;  3PHD A;  1FP0 A;  3MHH A;  4F52 B;  2MA6 A;  2IQJ A;  3O70 A;  2EGP A;  5H9M A;  2QIZ A;  3LQH A;  3C5K A;  3N9O A;  3FJU B;  4A49 A;  2VPG A;  2YSM A;  2RSD A;  3HCU A;  2DSM A;  1FBV A;  2CKL A;  2LGK A;  4AYC A;  3HCS A;  2FUU A;  1XWH A;  3O33 A;  4UP5 A;  3T9K A;  2IDA A;  3DPL R;  3HCT A;  2L80 A;  3GL6 A;  1F62 A;  2PUY A;  3JUE A;  2MIQ A;  3KNV A;  4WZ0 A;  4BHW A;  2VNF A;  2K17 A;  2JM3 A;  4H9D A;  3M62 A;  4OGC A;  3QZV A;  3SOU A;  3LDY A;  3O35 A;  1X4I A; 
#chains in the Genus database with same CATH homology
 1WEN A;  2F42 A;  3PUQ A;  2CSZ A;  5TDW A;  1JOC A;  4FIP A;  1VD4 A;  4R7E A;  2KRE A;  4B7Y C;  2G43 A;  3L1Z B;  2LN0 A;  3EB6 A;  4WA6 A;  1LDK C;  1ZBD B;  1HYJ A;  4YBS A;  3N9M A;  3IHP A;  3SOX A;  2LXH C;  3RTR B;  4LJN A;  2JMI A;  5KH3 A;  2F6J A;  5FB1 A;  1WE9 A;  2G45 A;  2ECW A;  2YYR A;  1WIM A;  4A0C D;  1Z60 A;  4TKP B;  3ZTG A;  1JM7 A;  2CKL B;  4PPE A;  2YSJ A;  4AYC B;  2QIC A;  1DVP A;  4L58 A;  3N9Q A;  2VPB A;  4YBT A;  5TBN A;  5G05 B;  2VJF A;  1HYI A;  4N4F A;  1WGM A;  2EOD A;  1G25 A;  2YRE A;  2VP7 A;  2YQL A;  1WEQ A;  5DIN A;  3ASL A;  2HYE D;  4O64 A;  4R8P K;  2YU4 A;  3LRQ A;  1WEP A;  2JMD A;  3U5M A;  2KGG A;  5J3X A;  2CSY A;  2LGV A;  2M85 A;  5H1U A;  3ZPV E;  3O36 A;  1LDJ B;  2JRJ A;  2H0D A;  5LKZ A;  5TAB A;  4L7X A;  4B86 C;  4LK9 A;  4S3O C;  3I2D A;  3V43 A;  5H1V A;  2YT5 A;  3LQI A;  2LQ6 A;  5B78 A;  4GNF A;  2HDP A;  5C13 A;  2RI7 A;  1VYX A;  2KFT A;  4QF2 A;  5D1K B;  5B76 A;  1JM7 B;  4YAT A;  3U5O A;  2E6S A;  1WES A;  4AP4 A;  4I7B A;  2VJF B;  5FER A;  1IYM A;  4GNG A;  2OXQ C;  4YAX A;  5LKX A;  3L11 A;  2L5U A;  4FJC A;  3KQI A;  1VFY A;  5G04 B;  3SHB A;  2ECJ A;  2ECT A;  3C6W A;  3N9L A;  3M99 A;  2K16 A;  1V87 A;  1WFK A;  5B79 A;  2H0D B;  3LQJ A;  3DQV R;  5LKT A;  5D1M B;  2KWK A;  3EB5 A;  4A4C A;  2C2L A;  3ZYQ A;  2DX8 A;  4P5O B;  4I7C A;  1X4U A;  2I50 A;  3T7L A;  4ZDT A;  4LKA A;  2K4D A;  2M6M A;  5H1T A;  4MVT A;  4AUQ B;  4WZ3 B;  4YAB A;  2UZG A;  4PTB A;  3N9N A;  3NG2 A;  3HTK C;  3KV5 A;  4R2Y A;  2ECV A;  4AVX A;  2KR4 A;  1MM2 A;  2ECN A;  2PNX A;  2XEU A;  2L0B A;  3RPG C;  5B75 A;  2MUM A;  1E4U A;  2MD7 B;  4ZQL A;  1WEO A;  2YQM A;  4GNE A;  5AIT A;  1MM3 A;  2F6N A;  4WZ2 A;  3O34 A;  4YBM A;  5LCW B;  2YHO A;  4CA1 A;  1WEU A;  2FSA A;  3MHS A;  2KWO A;  4I7D A;  3KV6 A;  2LGL A;  3U5P A;  1RMD A;  2KU3 A;  1N87 A;  2D8S A;  2YUC A;  1U6G B;  3ZVY A;  3M63 A;  1WEE A;  4UI9 B;  1Z6U A;  2LV9 A;  4V3L C;  5TRB A;  2K1J A;  2MNZ A;  2VPD A;  2LDR A;  3T6R A;  2KWJ A;  5EYA F;  2KIZ A;  3U5N A;  4YC9 A;  2E6R A;  2VJE A;  2MA5 A;  3O7A A;  3GV4 A;  5KH9 A;  4Q6F A;  4GND A;  5LKU A;  2L43 A;  4FK5 A;  2L75 A;  1WEW A;  4CCG X;  4MSX A;  4FO9 A;  4NN2 A;  2Y1M A;  5D1L B;  3SOW A;  3VK6 A;  4ZUX U;  4N3W A;  4GB0 A;  1BOR A;  4IC2 A;  5B8D A;  5AIU A;  2NAA A;  2ECI A;  3ZNI A;  4BBQ A;  5FB0 A;  1K2F A;  5DKA A;  5JG6 A;  1Z2Q A;  3L1X A;  2CT2 A;  4QF3 A;  2BAY A;  2EA6 A;  4V3K C;  2ZET C;  4IC3 A;  2KWN A;  2VPE A;  1T1H A;  1CHC A;  2M1R A;  1WEV A;  2KYU A;  3PUR A;  2XB1 A;  2JMJ A;  2KE1 A;  4LLB A;  3ZVZ B;  2M3H A;  4XI1 A;  2QJ0 A;  5FEY A;  2ECG A;  1WEM A;  4YAD A;  4A4B A;  1X4J A;  2KGI A;  3FL2 A;  4LAD B;  5G0F A;  5B77 A;  2MD8 C;  3RPG B;  4C9Z A;  4W4U A;  2C2V S;  2LRI C;  2VJE B;  4UP0 A;  2MNY A;  4X3G A;  2AN6 A;  2G6Q A;  2YHN A;  3O37 A;  2Y43 A;  2LXP C;  2YUR A;  5I3L A;  2FUI A;  5C11 A;  3N9P A;  3ZPV 1;  1WIL A;  4S3O B;  5TDR A;  2LGG A;  2YW8 A;  2MT5 A;  2Y1N A;  5KH7 A;  3PHD A;  1FP0 A;  3MHH A;  4F52 B;  2MA6 A;  3O70 A;  2EGP A;  5H9M A;  2QIZ A;  3LQH A;  3C5K A;  3N9O A;  4A49 A;  2VPG A;  2YSM A;  2RSD A;  3HCU A;  1FBV A;  2CKL A;  2LGK A;  4AYC A;  3HCS A;  2FUU A;  1XWH A;  3O33 A;  4UP5 A;  2IDA A;  3DPL R;  3HCT A;  2L80 A;  3GL6 A;  1F62 A;  2PUY A;  2MIQ A;  3KNV A;  4WZ0 A;  4BHW A;  2VNF A;  2K17 A;  3M62 A;  3QZV A;  3SOU A;  3O35 A;  1X4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...